diff --git a/go.mod b/go.mod
index 79753126..3159f727 100644
--- a/go.mod
+++ b/go.mod
@@ -3,17 +3,17 @@ module github.com/datarhei/core/v16
go 1.18
require (
- github.com/99designs/gqlgen v0.17.31
+ github.com/99designs/gqlgen v0.17.33
github.com/Masterminds/semver/v3 v3.2.1
- github.com/adhocore/gronx v1.1.2
+ github.com/adhocore/gronx v1.6.3
github.com/atrox/haikunatorgo/v2 v2.0.1
- github.com/caddyserver/certmagic v0.17.2
- github.com/casbin/casbin/v2 v2.69.1
+ github.com/caddyserver/certmagic v0.18.0
+ github.com/casbin/casbin/v2 v2.71.0
github.com/datarhei/core-client-go/v16 v16.11.1-0.20230614141756-a25a5fc3c60e
- github.com/datarhei/gosrt v0.4.1
+ github.com/datarhei/gosrt v0.5.0
github.com/datarhei/joy4 v0.0.0-20230505074825-fde05957445a
github.com/fujiwara/shapeio v1.0.0
- github.com/go-playground/validator/v10 v10.14.0
+ github.com/go-playground/validator/v10 v10.14.1
github.com/gobwas/glob v0.2.3
github.com/golang-jwt/jwt/v4 v4.5.0
github.com/google/uuid v1.3.0
@@ -26,19 +26,19 @@ require (
github.com/lestrrat-go/strftime v1.0.6
github.com/lithammer/shortuuid/v4 v4.0.0
github.com/mattn/go-isatty v0.0.19
- github.com/minio/minio-go/v7 v7.0.55
+ github.com/minio/minio-go/v7 v7.0.57
github.com/prep/average v0.0.0-20200506183628-d26c465f48c3
- github.com/prometheus/client_golang v1.15.1
- github.com/shirou/gopsutil/v3 v3.23.4
+ github.com/prometheus/client_golang v1.16.0
+ github.com/shirou/gopsutil/v3 v3.23.5
github.com/stretchr/testify v1.8.4
github.com/swaggo/echo-swagger v1.4.0
github.com/swaggo/swag v1.16.1
- github.com/vektah/gqlparser/v2 v2.5.1
+ github.com/vektah/gqlparser/v2 v2.5.3
github.com/xeipuuv/gojsonschema v1.2.0
go.etcd.io/bbolt v1.3.7
go.uber.org/automaxprocs v1.5.2
go.uber.org/zap v1.24.0
- golang.org/x/mod v0.10.0
+ golang.org/x/mod v0.11.0
)
//replace github.com/datarhei/core-client-go/v16 => ../core-client-go
@@ -61,7 +61,7 @@ require (
github.com/go-openapi/jsonpointer v0.19.6 // indirect
github.com/go-openapi/jsonreference v0.20.2 // indirect
github.com/go-openapi/spec v0.20.9 // indirect
- github.com/go-openapi/swag v0.22.3 // indirect
+ github.com/go-openapi/swag v0.22.4 // indirect
github.com/go-playground/locales v0.14.1 // indirect
github.com/go-playground/universal-translator v0.18.1 // indirect
github.com/golang-jwt/jwt v3.2.2+incompatible // indirect
@@ -70,12 +70,12 @@ require (
github.com/hashicorp/go-immutable-radix v1.3.1 // indirect
github.com/hashicorp/go-msgpack v0.5.5 // indirect
github.com/hashicorp/golang-lru v0.5.4 // indirect
- github.com/hashicorp/golang-lru/v2 v2.0.2 // indirect
+ github.com/hashicorp/golang-lru/v2 v2.0.3 // indirect
github.com/iancoleman/orderedmap v0.2.0 // indirect
github.com/josharian/intern v1.0.0 // indirect
github.com/json-iterator/go v1.1.12 // indirect
- github.com/klauspost/compress v1.16.5 // indirect
- github.com/klauspost/cpuid/v2 v2.2.4 // indirect
+ github.com/klauspost/compress v1.16.6 // indirect
+ github.com/klauspost/cpuid/v2 v2.2.5 // indirect
github.com/labstack/gommon v0.4.0 // indirect
github.com/leodido/go-urn v1.2.4 // indirect
github.com/libdns/libdns v0.2.1 // indirect
@@ -99,11 +99,11 @@ require (
github.com/rs/xid v1.5.0 // indirect
github.com/russross/blackfriday/v2 v2.1.0 // indirect
github.com/shoenig/go-m1cpu v0.1.6 // indirect
- github.com/sirupsen/logrus v1.9.2 // indirect
+ github.com/sirupsen/logrus v1.9.3 // indirect
github.com/swaggo/files/v2 v2.0.0 // indirect
github.com/tklauser/go-sysconf v0.3.11 // indirect
- github.com/tklauser/numcpus v0.6.0 // indirect
- github.com/urfave/cli/v2 v2.24.4 // indirect
+ github.com/tklauser/numcpus v0.6.1 // indirect
+ github.com/urfave/cli/v2 v2.25.5 // indirect
github.com/valyala/bytebufferpool v1.0.0 // indirect
github.com/valyala/fasttemplate v1.2.2 // indirect
github.com/xeipuuv/gojsonpointer v0.0.0-20190905194746-02993c407bfb // indirect
@@ -113,12 +113,12 @@ require (
go.uber.org/atomic v1.11.0 // indirect
go.uber.org/goleak v1.1.12 // indirect
go.uber.org/multierr v1.11.0 // indirect
- golang.org/x/crypto v0.9.0 // indirect
- golang.org/x/net v0.10.0 // indirect
- golang.org/x/sys v0.8.0 // indirect
- golang.org/x/text v0.9.0 // indirect
+ golang.org/x/crypto v0.10.0 // indirect
+ golang.org/x/net v0.11.0 // indirect
+ golang.org/x/sys v0.9.0 // indirect
+ golang.org/x/text v0.10.0 // indirect
golang.org/x/time v0.3.0 // indirect
- golang.org/x/tools v0.9.1 // indirect
+ golang.org/x/tools v0.10.0 // indirect
google.golang.org/protobuf v1.30.0 // indirect
gopkg.in/ini.v1 v1.67.0 // indirect
gopkg.in/yaml.v3 v3.0.1 // indirect
diff --git a/go.sum b/go.sum
index eb3b80be..0a6903f2 100644
--- a/go.sum
+++ b/go.sum
@@ -1,5 +1,5 @@
-github.com/99designs/gqlgen v0.17.31 h1:VncSQ82VxieHkea8tz11p7h/zSbvHSxSDZfywqWt158=
-github.com/99designs/gqlgen v0.17.31/go.mod h1:i4rEatMrzzu6RXaHydq1nmEPZkb3bKQsnxNRHS4DQB4=
+github.com/99designs/gqlgen v0.17.33 h1:VTUpAtElDszatPSe26N0SD0deJCSxb7TZLlUb6JnVRY=
+github.com/99designs/gqlgen v0.17.33/go.mod h1:ygDK+m8zGpoQuSh8xoq80UfisR5JTZr7mN57qXlSIZs=
github.com/DataDog/datadog-go v2.2.0+incompatible/go.mod h1:LButxg5PwREeZtORoXG3tL4fMGNddJ+vMq1mwgfaqoQ=
github.com/DataDog/datadog-go v3.2.0+incompatible/go.mod h1:LButxg5PwREeZtORoXG3tL4fMGNddJ+vMq1mwgfaqoQ=
github.com/Knetic/govaluate v3.0.1-0.20171022003610-9aa49832a739+incompatible h1:1G1pk05UrOh0NlF1oeaaix1x8XzrfjIDK47TY0Zehcw=
@@ -8,11 +8,8 @@ github.com/KyleBanks/depth v1.2.1 h1:5h8fQADFrWtarTdtDudMmGsC7GPbOAu6RVB3ffsVFHc
github.com/KyleBanks/depth v1.2.1/go.mod h1:jzSb9d0L43HxTQfT+oSA1EEp2q+ne2uh6XgeJcm8brE=
github.com/Masterminds/semver/v3 v3.2.1 h1:RN9w6+7QoMeJVGyfmbcgs28Br8cvmnucEXnY0rYXWg0=
github.com/Masterminds/semver/v3 v3.2.1/go.mod h1:qvl/7zhW3nngYb5+80sSMF+FG2BjYrf8m9wsX0PNOMQ=
-github.com/PuerkitoBio/purell v1.1.1/go.mod h1:c11w/QuzBsJSee3cPx9rAFu61PvFxuPbtSwDGJws/X0=
-github.com/PuerkitoBio/urlesc v0.0.0-20170810143723-de5bf2ad4578/go.mod h1:uGdkoq3SwY9Y+13GIhn11/XLaGBb4BfwItxLd5jeuXE=
-github.com/adhocore/gronx v1.1.2 h1:Hgm+d8SyGtn+rCoDkxZq3nLNFLLkzRGR7L2ziRRD1w8=
-github.com/adhocore/gronx v1.1.2/go.mod h1:7oUY1WAU8rEJWmAxXR2DN0JaO4gi9khSgKjiRypqteg=
-github.com/agnivade/levenshtein v1.0.1/go.mod h1:CURSv5d9Uaml+FovSIICkLbAUZ9S4RqaHDIsdSBg7lM=
+github.com/adhocore/gronx v1.6.3 h1:bnm5vieTrY3QQPpsfB0hrAaeaHDpuZTUC2LLCVMLe9c=
+github.com/adhocore/gronx v1.6.3/go.mod h1:7oUY1WAU8rEJWmAxXR2DN0JaO4gi9khSgKjiRypqteg=
github.com/agnivade/levenshtein v1.1.1 h1:QY8M92nrzkmr798gCo3kmMyqXFzdQVpxLlGPRBij0P8=
github.com/agnivade/levenshtein v1.1.1/go.mod h1:veldBMzWxcCG2ZvUTKD2kJNRdCk5hVbJomOvKkmgYbo=
github.com/alecthomas/template v0.0.0-20160405071501-a0175ee3bccc/go.mod h1:LOuyumcjzFXgccqObfd/Ljyb9UuFJ6TxHnclSeseNhc=
@@ -29,7 +26,6 @@ github.com/armon/go-metrics v0.4.1/go.mod h1:E6amYzXo6aW1tqzoZGT755KkbgrJsSdpwZ+
github.com/atrox/haikunatorgo/v2 v2.0.1 h1:FCVx2KL2YvZtI1rI9WeEHxeLRrKGr0Dd4wfCJiUXupc=
github.com/atrox/haikunatorgo/v2 v2.0.1/go.mod h1:BBQmx2o+1Z5poziaHRgddAZKOpijwfKdAmMnSYlFK70=
github.com/benbjohnson/clock v1.1.0 h1:Q92kusRqC1XV2MjkWETPvjJVqKetz1OzxZB7mHJLju8=
-github.com/benbjohnson/clock v1.1.0/go.mod h1:J11/hYXuz8f4ySSvYwY0FKfm+ezbsZBKZxNJlLklBHA=
github.com/benburkert/openpgp v0.0.0-20160410205803-c2471f86866c h1:8XZeJrs4+ZYhJeJ2aZxADI2tGADS15AzIF8MQ8XAhT4=
github.com/benburkert/openpgp v0.0.0-20160410205803-c2471f86866c/go.mod h1:x1vxHcL/9AVzuk5HOloOEPrtJY0MaalYr78afXZ+pWI=
github.com/beorn7/perks v0.0.0-20180321164747-3a771d992973/go.mod h1:Dwedo/Wpr24TaqPxmxbtue+5NUziq4I4S80YR8gNf3Q=
@@ -38,10 +34,10 @@ github.com/beorn7/perks v1.0.1 h1:VlbKKnNfV8bJzeqoa4cOKqO6bYr3WgKZxO8Z16+hsOM=
github.com/beorn7/perks v1.0.1/go.mod h1:G2ZrVWU2WbWT9wwq4/hrbKbnv/1ERSJQ0ibhJ6rlkpw=
github.com/boltdb/bolt v1.3.1 h1:JQmyP4ZBrce+ZQu0dY660FMfatumYDLun9hBCUVIkF4=
github.com/boltdb/bolt v1.3.1/go.mod h1:clJnj/oiGkjum5o1McbSZDSLxVThjynRyGBgiAx27Ps=
-github.com/caddyserver/certmagic v0.17.2 h1:o30seC1T/dBqBCNNGNHWwj2i5/I/FMjBbTAhjADP3nE=
-github.com/caddyserver/certmagic v0.17.2/go.mod h1:ouWUuC490GOLJzkyN35eXfV8bSbwMwSf4bdhkIxtdQE=
-github.com/casbin/casbin/v2 v2.69.1 h1:R3e7uveIRN5Pdqvq0GXEhXmn7HyfoEVjp21/mgEXbdI=
-github.com/casbin/casbin/v2 v2.69.1/go.mod h1:vByNa/Fchek0KZUgG5wEsl7iFsiviAYKRtgrQfcJqHg=
+github.com/caddyserver/certmagic v0.18.0 h1:L22mJES1WllfLoHUcQUy4wVO7UfOsoL5wtg/Bj7kmIw=
+github.com/caddyserver/certmagic v0.18.0/go.mod h1:e0YLTnXIopZ05bBWCLzpIf1Yvk27Q90FGUmGowFRDY8=
+github.com/casbin/casbin/v2 v2.71.0 h1:pVzHKXkGgOXIjksEwnrOjNu5CE4xy6aAVzdR8td2gSc=
+github.com/casbin/casbin/v2 v2.71.0/go.mod h1:vByNa/Fchek0KZUgG5wEsl7iFsiviAYKRtgrQfcJqHg=
github.com/cespare/xxhash/v2 v2.1.1/go.mod h1:VGX0DQ3Q6kWi7AoAeZDth3/j3BFtOZR5XLFGgcrjCOs=
github.com/cespare/xxhash/v2 v2.2.0 h1:DC2CZ1Ep5Y4k3ZQ899DldepgrayRUGE6BBZ/cd9Cj44=
github.com/cespare/xxhash/v2 v2.2.0/go.mod h1:VGX0DQ3Q6kWi7AoAeZDth3/j3BFtOZR5XLFGgcrjCOs=
@@ -50,14 +46,10 @@ github.com/circonus-labs/circonusllhist v0.1.3/go.mod h1:kMXHVDlOchFAehlya5ePtbp
github.com/cpuguy83/go-md2man/v2 v2.0.2 h1:p1EgwI/C7NhT0JmVkwCD2ZBK8j4aeHQX2pMHHBfMQ6w=
github.com/cpuguy83/go-md2man/v2 v2.0.2/go.mod h1:tgQtvFlXSQOSOSIRvRPT7W67SCa46tRHOmNcaadrF8o=
github.com/creack/pty v1.1.9/go.mod h1:oKZEueFk5CKHvIhNR5MUki03XCEU+Q6VDXinZuGJ33E=
-github.com/datarhei/core-client-go/v16 v16.11.1-0.20230605095314-42546fbbbece h1:Gv+W986jLcMa/TOKg5YF3RMDlNDDyj7uHuH+mHP7xq8=
-github.com/datarhei/core-client-go/v16 v16.11.1-0.20230605095314-42546fbbbece/go.mod h1:6L0zr/NUwvaPsCTK/IL17m8JUEtgLp3BDtlsBREwacg=
-github.com/datarhei/core-client-go/v16 v16.11.1-0.20230614130211-fb0f92af8ac9 h1:ntM1tymajXx92ydwi6RSiDG54aQV3cMOtlGRBT6p9Z8=
-github.com/datarhei/core-client-go/v16 v16.11.1-0.20230614130211-fb0f92af8ac9/go.mod h1:6L0zr/NUwvaPsCTK/IL17m8JUEtgLp3BDtlsBREwacg=
github.com/datarhei/core-client-go/v16 v16.11.1-0.20230614141756-a25a5fc3c60e h1:iQKqGTyIdCyO7kY/G5MCKhzt3xZ5YPRubbJskVp5EvQ=
github.com/datarhei/core-client-go/v16 v16.11.1-0.20230614141756-a25a5fc3c60e/go.mod h1:6L0zr/NUwvaPsCTK/IL17m8JUEtgLp3BDtlsBREwacg=
-github.com/datarhei/gosrt v0.4.1 h1:08km3wKy72jOdC+JzBDWN57H7xST4mz5lFeJQHuWmMs=
-github.com/datarhei/gosrt v0.4.1/go.mod h1:FtsulRiUc67Oi3Ii9JH9aQkpO+ZfgeauRAtIE40mIVA=
+github.com/datarhei/gosrt v0.5.0 h1:MhM8kb00nbWc+haNKU7ZdYgSm9pLdxdtas7tcERh8j8=
+github.com/datarhei/gosrt v0.5.0/go.mod h1:bcLf0p0FeZl+QY87b+Q8nGkyjyX6IDvI9y9raol8vng=
github.com/datarhei/joy4 v0.0.0-20230505074825-fde05957445a h1:Tf4DSHY1xruBglr+yYP5Wct7czM86GKMYgbXH8a7OFo=
github.com/datarhei/joy4 v0.0.0-20230505074825-fde05957445a/go.mod h1:Jcw/6jZDQQmPx8A7INEkXmuEF7E9jjBbSTfVSLwmiQw=
github.com/davecgh/go-spew v1.1.0/go.mod h1:J7Y8YcW2NihsgmVo/mv3lAwl/skON4iLHjSsI+c5H38=
@@ -79,7 +71,6 @@ github.com/go-kit/kit v0.8.0/go.mod h1:xBxKIO96dXMWWy0MnWVtmwkA9/13aqxPnvrjFYMA2
github.com/go-kit/kit v0.9.0/go.mod h1:xBxKIO96dXMWWy0MnWVtmwkA9/13aqxPnvrjFYMA2as=
github.com/go-logfmt/logfmt v0.3.0/go.mod h1:Qt1PoO58o5twSAckw1HlFXLmHsOX5/0LbT9GBnD5lWE=
github.com/go-logfmt/logfmt v0.4.0/go.mod h1:3RMwSq7FuexP4Kalkev3ejPJsZTpXXBr9+V4qmtdjCk=
-github.com/go-logfmt/logfmt v0.5.1/go.mod h1:WYhtIu8zTZfxdn5+rREduYbwxfcBr/Vr6KEVveWlfTs=
github.com/go-ole/go-ole v1.2.6 h1:/Fpf6oFPoeFik9ty7siob0G6Ke8QvQEuVcuChpwXzpY=
github.com/go-ole/go-ole v1.2.6/go.mod h1:pprOEPIfldk/42T2oK7lQ4v4JSDwmV0As9GaiUsvbm0=
github.com/go-openapi/jsonpointer v0.19.3/go.mod h1:Pl9vOtqEWErmShwVjC8pYs9cog34VGT37dQOVbmoatg=
@@ -93,15 +84,16 @@ github.com/go-openapi/spec v0.20.9 h1:xnlYNQAwKd2VQRRfwTEI0DcK+2cbuvI/0c7jx3gA8/
github.com/go-openapi/spec v0.20.9/go.mod h1:2OpW+JddWPrpXSCIX8eOx7lZ5iyuWj3RYR6VaaBKcWA=
github.com/go-openapi/swag v0.19.5/go.mod h1:POnQmlKehdgb5mhVOsnJFsivZCEZ/vjK9gh66Z9tfKk=
github.com/go-openapi/swag v0.19.15/go.mod h1:QYRuS/SOXUCsnplDa677K7+DxSOj6IPNl/eQntq43wQ=
-github.com/go-openapi/swag v0.22.3 h1:yMBqmnQ0gyZvEb/+KzuWZOXgllrXT4SADYbvDaXHv/g=
github.com/go-openapi/swag v0.22.3/go.mod h1:UzaqsxGiab7freDnrUUra0MwWfN/q7tE4j+VcZ0yl14=
+github.com/go-openapi/swag v0.22.4 h1:QLMzNJnMGPRNDCbySlcj1x01tzU8/9LTTL9hZZZogBU=
+github.com/go-openapi/swag v0.22.4/go.mod h1:UzaqsxGiab7freDnrUUra0MwWfN/q7tE4j+VcZ0yl14=
github.com/go-playground/assert/v2 v2.2.0 h1:JvknZsQTYeFEAhQwI4qEt9cyV5ONwRHC+lYKSsYSR8s=
github.com/go-playground/locales v0.14.1 h1:EWaQ/wswjilfKLTECiXz7Rh+3BjFhfDFKv/oXslEjJA=
github.com/go-playground/locales v0.14.1/go.mod h1:hxrqLVvrK65+Rwrd5Fc6F2O76J/NuW9t0sjnWqG1slY=
github.com/go-playground/universal-translator v0.18.1 h1:Bcnm0ZwsGyWbCzImXv+pAJnYK9S473LQFuzCbDbfSFY=
github.com/go-playground/universal-translator v0.18.1/go.mod h1:xekY+UJKNuX9WP91TpwSH2VMlDf28Uj24BCp08ZFTUY=
-github.com/go-playground/validator/v10 v10.14.0 h1:vgvQWe3XCz3gIeFDm/HnTIbj6UGmg/+t63MyGU2n5js=
-github.com/go-playground/validator/v10 v10.14.0/go.mod h1:9iXMNT7sEkjXb0I+enO7QXmzG6QCsPWY4zveKFVRSyU=
+github.com/go-playground/validator/v10 v10.14.1 h1:9c50NUPC30zyuKprjL3vNZ0m5oG+jU0zvx4AqHGnv4k=
+github.com/go-playground/validator/v10 v10.14.1/go.mod h1:9iXMNT7sEkjXb0I+enO7QXmzG6QCsPWY4zveKFVRSyU=
github.com/go-stack/stack v1.8.0/go.mod h1:v0f6uXyyMGvRgIKkXu+yp6POWl0qKG85gN/melR3HDY=
github.com/gobwas/glob v0.2.3 h1:A4xDbljILXROh+kObIiy5kIaPYD8e96x1tgBhUI5J+Y=
github.com/gobwas/glob v0.2.3/go.mod h1:d3Ez4x06l9bZtSvzIay5+Yzi0fmZzPgnTbPcKjJAkT8=
@@ -144,8 +136,8 @@ github.com/hashicorp/go-uuid v1.0.0/go.mod h1:6SBZvOh/SIDV7/2o3Jml5SYk/TvGqwFJ/b
github.com/hashicorp/golang-lru v0.5.0/go.mod h1:/m3WP610KZHVQ1SGc6re/UDhFvYD7pJ4Ao+sR/qLZy8=
github.com/hashicorp/golang-lru v0.5.4 h1:YDjusn29QI/Das2iO9M0BHnIbxPeyuCHsjMW+lJfyTc=
github.com/hashicorp/golang-lru v0.5.4/go.mod h1:iADmTwqILo4mZ8BN3D2Q6+9jd8WM5uGBxy+E8yxSoD4=
-github.com/hashicorp/golang-lru/v2 v2.0.2 h1:Dwmkdr5Nc/oBiXgJS3CDHNhJtIHkuZ3DZF5twqnfBdU=
-github.com/hashicorp/golang-lru/v2 v2.0.2/go.mod h1:QeFd9opnmA6QUJc5vARoKUSoFhyfM2/ZepoAG6RGpeM=
+github.com/hashicorp/golang-lru/v2 v2.0.3 h1:kmRrRLlInXvng0SmLxmQpQkpbYAvcXm7NPDrgxJa9mE=
+github.com/hashicorp/golang-lru/v2 v2.0.3/go.mod h1:QeFd9opnmA6QUJc5vARoKUSoFhyfM2/ZepoAG6RGpeM=
github.com/hashicorp/raft v1.1.0/go.mod h1:4Ak7FSPnuvmb0GV6vgIAJ4vYT4bek9bb6Q+7HVbyzqM=
github.com/hashicorp/raft v1.5.0 h1:uNs9EfJ4FwiArZRxxfd/dQ5d33nV31/CdCHArH89hT8=
github.com/hashicorp/raft v1.5.0/go.mod h1:pKHB2mf/Y25u3AHNSXVRv+yT+WAnmeTX0BwVppVQV+M=
@@ -162,18 +154,16 @@ github.com/joho/godotenv v1.5.1 h1:7eLL/+HRGLY0ldzfGMeQkb7vMd0as4CfYvUVzLqw0N0=
github.com/joho/godotenv v1.5.1/go.mod h1:f4LDr5Voq0i2e/R5DDNOoa2zzDfwtkZa6DnEwAbqwq4=
github.com/josharian/intern v1.0.0 h1:vlS4z54oSdjm0bgjRigI+G1HpF+tI+9rE5LLzOg8HmY=
github.com/josharian/intern v1.0.0/go.mod h1:5DoeVV0s6jJacbCEi61lwdGj/aVlrQvzHFFd8Hwg//Y=
-github.com/jpillora/backoff v1.0.0/go.mod h1:J/6gKK9jxlEcS3zixgDgUAsiuZ7yrSoa/FX5e0EB2j4=
github.com/json-iterator/go v1.1.6/go.mod h1:+SdeFBvtyEkXs7REEP0seUULqWtbJapLOCVDaaPEHmU=
github.com/json-iterator/go v1.1.9/go.mod h1:KdQUCv79m/52Kvf8AW2vK1V8akMuk1QjK/uOdHXbAo4=
github.com/json-iterator/go v1.1.12 h1:PV8peI4a0ysnczrg+LtxykD8LfKY9ML6u2jnxaEnrnM=
github.com/json-iterator/go v1.1.12/go.mod h1:e30LSqwooZae/UwlEbR2852Gd8hjQvJoHmT4TnhNGBo=
github.com/julienschmidt/httprouter v1.2.0/go.mod h1:SYymIcj16QtmaHHD7aYtjjsJG7VTCxuUUipMqKk8s4w=
-github.com/julienschmidt/httprouter v1.3.0/go.mod h1:JR6WtHb+2LUe8TCKY3cZOxFyyO8IZAc4RVcycCCAKdM=
-github.com/klauspost/compress v1.16.5 h1:IFV2oUNUzZaz+XyusxpLzpzS8Pt5rh0Z16For/djlyI=
-github.com/klauspost/compress v1.16.5/go.mod h1:ntbaceVETuRiXiv4DpjP66DpAtAGkEQskQzEyD//IeE=
+github.com/klauspost/compress v1.16.6 h1:91SKEy4K37vkp255cJ8QesJhjyRO0hn9i9G0GoUwLsk=
+github.com/klauspost/compress v1.16.6/go.mod h1:ntbaceVETuRiXiv4DpjP66DpAtAGkEQskQzEyD//IeE=
github.com/klauspost/cpuid/v2 v2.0.1/go.mod h1:FInQzS24/EEf25PyTYn52gqo7WaD8xa0213Md/qVLRg=
-github.com/klauspost/cpuid/v2 v2.2.4 h1:acbojRNwl3o09bUq+yDCtZFc1aiwaAAxtcn8YkZXnvk=
-github.com/klauspost/cpuid/v2 v2.2.4/go.mod h1:RVVoqg1df56z8g3pUjL/3lE5UfnlrJX8tyFgg4nqhuY=
+github.com/klauspost/cpuid/v2 v2.2.5 h1:0E5MSMDEoAulmXNFquVs//DdoomxaoTY1kUhbc/qbZg=
+github.com/klauspost/cpuid/v2 v2.2.5/go.mod h1:Lcz8mBdAVJIBVzewtcLocK12l3Y+JytZYpaMropDUws=
github.com/konsorten/go-windows-terminal-sequences v1.0.1/go.mod h1:T0+1ngSBFLxvqU3pZ+m/2kptfBszLMUkC4ZK/EgS/cQ=
github.com/kr/logfmt v0.0.0-20140226030751-b84e30acd515/go.mod h1:+0opPa2QZZtGFBFZlji/RkVcI2GknAs/DXo4wKdlNEc=
github.com/kr/pretty v0.1.0/go.mod h1:dAy3ld7l9f0ibDNOQOHHMYYIIbhfbHSm3C4ZsoJORNo=
@@ -224,8 +214,8 @@ github.com/miekg/dns v1.1.54 h1:5jon9mWcb0sFJGpnI99tOMhCPyJ+RPVz5b63MQG0VWI=
github.com/miekg/dns v1.1.54/go.mod h1:uInx36IzPl7FYnDcMeVWxj9byh7DutNykX4G9Sj60FY=
github.com/minio/md5-simd v1.1.2 h1:Gdi1DZK69+ZVMoNHRXJyNcxrMA4dSxoYHZSQbirFg34=
github.com/minio/md5-simd v1.1.2/go.mod h1:MzdKDxYpY2BT9XQFocsiZf/NKVtR7nkE4RoEpN+20RM=
-github.com/minio/minio-go/v7 v7.0.55 h1:ZXqUO/8cgfHzI+08h/zGuTTFpISSA32BZmBE3FCLJas=
-github.com/minio/minio-go/v7 v7.0.55/go.mod h1:NUDy4A4oXPq1l2yK6LTSvCEzAMeIcoz9lcj5dbzSrRE=
+github.com/minio/minio-go/v7 v7.0.57 h1:xsFiOiWjpC1XAGbFEUOzj1/gMXGz7ljfxifwcb/5YXU=
+github.com/minio/minio-go/v7 v7.0.57/go.mod h1:NUDy4A4oXPq1l2yK6LTSvCEzAMeIcoz9lcj5dbzSrRE=
github.com/minio/sha256-simd v1.0.1 h1:6kaan5IFmwTNynnKKpDHe6FWHohJOHhCPchzK49dzMM=
github.com/minio/sha256-simd v1.0.1/go.mod h1:Pz6AKMiUdngCLpeTL/RJY1M9rUuPMYujV5xJjtbRSN8=
github.com/mitchellh/mapstructure v1.5.0 h1:jeMsZIYE/09sWLaz43PL7Gy6RuMjD2eJVyuac5Z2hdY=
@@ -238,7 +228,6 @@ github.com/modern-go/reflect2 v1.0.1/go.mod h1:bx2lNnkwVCuqBIxFjflWJWanXIb3Rllmb
github.com/modern-go/reflect2 v1.0.2 h1:xBagoLtFs94CBntxluKeaWgTMpvLxC4ur3nMaC9Gz0M=
github.com/modern-go/reflect2 v1.0.2/go.mod h1:yWuevngMOJpCy52FWWMvUC8ws7m/LJsjYzDa0/r8luk=
github.com/mwitkow/go-conntrack v0.0.0-20161129095857-cc309e4a2223/go.mod h1:qRWi+5nqEBWmkhHvq77mSJWrCKwh8bxhgT7d/eI7P4U=
-github.com/mwitkow/go-conntrack v0.0.0-20190716064945-2f068394615f/go.mod h1:qRWi+5nqEBWmkhHvq77mSJWrCKwh8bxhgT7d/eI7P4U=
github.com/niemeyer/pretty v0.0.0-20200227124842-a10e7caefd8e/go.mod h1:zD1mROLANZcx1PVRCS0qkT7pwLkGfwJo4zjcN/Tysno=
github.com/pascaldekloe/goe v0.1.0 h1:cBOtyMzM9HTpWjXfbbunk26uA6nG3a8n06Wieeh0MwY=
github.com/pascaldekloe/goe v0.1.0/go.mod h1:lzWF7FIEvWOWxwDKqyGYQf6ZUaNfKdP144TG7ZOy1lc=
@@ -259,8 +248,8 @@ github.com/prometheus/client_golang v0.9.1/go.mod h1:7SWBe2y4D6OKWSNQJUaRYU/AaXP
github.com/prometheus/client_golang v0.9.2/go.mod h1:OsXs2jCmiKlQ1lTBmv21f2mNfw4xf/QclQDMrYNZzcM=
github.com/prometheus/client_golang v1.0.0/go.mod h1:db9x61etRT2tGnBNRi70OPL5FsnadC4Ky3P0J6CfImo=
github.com/prometheus/client_golang v1.4.0/go.mod h1:e9GMxYsXl05ICDXkRhurwBS4Q3OK1iX/F2sw+iXX5zU=
-github.com/prometheus/client_golang v1.15.1 h1:8tXpTmJbyH5lydzFPoxSIJ0J46jdh3tylbvM1xCv0LI=
-github.com/prometheus/client_golang v1.15.1/go.mod h1:e9yaBhRPU2pPNsZwE+JdQl0KEt1N9XgF6zxWmaC0xOk=
+github.com/prometheus/client_golang v1.16.0 h1:yk/hx9hDbrGHovbci4BY+pRMfSuuat626eFsHb7tmT8=
+github.com/prometheus/client_golang v1.16.0/go.mod h1:Zsulrv/L9oM40tJ7T815tM89lFEugiJ9HzIqaAx4LKc=
github.com/prometheus/client_model v0.0.0-20180712105110-5c3871d89910/go.mod h1:MbSGuTsp3dbXC40dX6PRTWyKYBIrTGTE9sqQNg2J8bo=
github.com/prometheus/client_model v0.0.0-20190129233127-fd36f4220a90/go.mod h1:xMI15A0UPsDsEKsMN9yxemIoYk6Tm2C1GtYGdfGttqA=
github.com/prometheus/client_model v0.2.0/go.mod h1:xMI15A0UPsDsEKsMN9yxemIoYk6Tm2C1GtYGdfGttqA=
@@ -282,20 +271,18 @@ github.com/rs/xid v1.5.0 h1:mKX4bl4iPYJtEIxp6CYiUuLQ/8DYMoz0PUdtGgMFRVc=
github.com/rs/xid v1.5.0/go.mod h1:trrq9SKmegXys3aeAKXMUTdJsYXVwGY3RLcfgqegfbg=
github.com/russross/blackfriday/v2 v2.1.0 h1:JIOH55/0cWyOuilr9/qlrm0BSXldqnqwMsf35Ld67mk=
github.com/russross/blackfriday/v2 v2.1.0/go.mod h1:+Rmxgy9KzJVeS9/2gXHxylqXiyQDYRxCVz55jmeOWTM=
-github.com/sergi/go-diff v1.1.0 h1:we8PVUC3FE2uYfodKH/nBHMSetSfHDR6scGdBi+erh0=
-github.com/sergi/go-diff v1.1.0/go.mod h1:STckp+ISIX8hZLjrqAeVduY0gWCT9IjLuqbuNXdaHfM=
-github.com/shirou/gopsutil/v3 v3.23.4 h1:hZwmDxZs7Ewt75DV81r4pFMqbq+di2cbt9FsQBqLD2o=
-github.com/shirou/gopsutil/v3 v3.23.4/go.mod h1:ZcGxyfzAMRevhUR2+cfhXDH6gQdFYE/t8j1nsU4mPI8=
-github.com/shoenig/go-m1cpu v0.1.5/go.mod h1:Wwvst4LR89UxjeFtLRMrpgRiyY4xPsejnVZym39dbAQ=
+github.com/sergi/go-diff v1.3.1 h1:xkr+Oxo4BOQKmkn/B9eMK0g5Kg/983T9DqqPHwYqD+8=
+github.com/sergi/go-diff v1.3.1/go.mod h1:aMJSSKb2lpPvRNec0+w3fl7LP9IOFzdc9Pa4NFbPK1I=
+github.com/shirou/gopsutil/v3 v3.23.5 h1:5SgDCeQ0KW0S4N0znjeM/eFHXXOKyv2dVNgRq/c9P6Y=
+github.com/shirou/gopsutil/v3 v3.23.5/go.mod h1:Ng3Maa27Q2KARVJ0SPZF5NdrQSC3XHKP8IIWrHgMeLY=
github.com/shoenig/go-m1cpu v0.1.6 h1:nxdKQNcEB6vzgA2E2bvzKIYRuNj7XNJ4S/aRSwKzFtM=
github.com/shoenig/go-m1cpu v0.1.6/go.mod h1:1JJMcUBvfNwpq05QDQVAnx3gUHr9IYF7GNg9SUEw2VQ=
-github.com/shoenig/test v0.6.3/go.mod h1:byHiCGXqrVaflBLAMq/srcZIHynQPQgeyvkvXnjqq0k=
github.com/shoenig/test v0.6.4 h1:kVTaSd7WLz5WZ2IaoM0RSzRsUD+m8wRR+5qvntpn4LU=
-github.com/shurcooL/sanitized_anchor_name v1.0.0/go.mod h1:1NzhyTcUVG4SuEtjjoZeVRXNmyL/1OwPU0+IJeTBvfc=
+github.com/shoenig/test v0.6.4/go.mod h1:byHiCGXqrVaflBLAMq/srcZIHynQPQgeyvkvXnjqq0k=
github.com/sirupsen/logrus v1.2.0/go.mod h1:LxeOpSwHxABJmUn/MG1IvRgCAasNZTLOkJPxbbu5VWo=
github.com/sirupsen/logrus v1.4.2/go.mod h1:tLMulIdttU9McNUspp0xgXVQah82FyeX6MwdIuYE2rE=
-github.com/sirupsen/logrus v1.9.2 h1:oxx1eChJGI6Uks2ZC4W1zpLlVgqB8ner4EuQwV4Ik1Y=
-github.com/sirupsen/logrus v1.9.2/go.mod h1:naHLuLoDiP4jHNo9R0sCBMtWGeIprob74mVsIT4qYEQ=
+github.com/sirupsen/logrus v1.9.3 h1:dueUQJ1C2q9oE3F7wvmSGAaVtTmUizReu6fjN8uqzbQ=
+github.com/sirupsen/logrus v1.9.3/go.mod h1:naHLuLoDiP4jHNo9R0sCBMtWGeIprob74mVsIT4qYEQ=
github.com/stretchr/objx v0.1.0/go.mod h1:HFkY916IF+rwdDfMAkV7OtwuqBVzrE8GR6GFx+wExME=
github.com/stretchr/objx v0.1.1/go.mod h1:HFkY916IF+rwdDfMAkV7OtwuqBVzrE8GR6GFx+wExME=
github.com/stretchr/objx v0.4.0/go.mod h1:YvHI0jy2hoMjB+UWwv71VJQ9isScKT/TqJzVSSt89Yw=
@@ -311,6 +298,7 @@ github.com/stretchr/testify v1.7.2/go.mod h1:R6va5+xMeoiuVRoj+gSkQ7d3FALtqAAGI1F
github.com/stretchr/testify v1.8.0/go.mod h1:yNjHg4UonilssWZ8iaSj1OCr/vHnekPRkoO+kdMU+MU=
github.com/stretchr/testify v1.8.1/go.mod h1:w2LPCIKwWwSfY2zedu0+kehJoqGctiVI29o6fzry7u4=
github.com/stretchr/testify v1.8.2/go.mod h1:w2LPCIKwWwSfY2zedu0+kehJoqGctiVI29o6fzry7u4=
+github.com/stretchr/testify v1.8.3/go.mod h1:sz/lmYIOXD/1dqDmKjjqLyZ2RngseejIcXlSw2iwfAo=
github.com/stretchr/testify v1.8.4 h1:CcVxjf3Q8PM0mHUKJCdn+eZZtm5yQwehR5yeSVQQcUk=
github.com/stretchr/testify v1.8.4/go.mod h1:sz/lmYIOXD/1dqDmKjjqLyZ2RngseejIcXlSw2iwfAo=
github.com/swaggo/echo-swagger v1.4.0 h1:RCxLKySw1SceHLqnmc41pKyiIeE+OiD7NSI7FUOBlLo=
@@ -321,18 +309,19 @@ github.com/swaggo/swag v1.16.1 h1:fTNRhKstPKxcnoKsytm4sahr8FaYzUcT7i1/3nd/fBg=
github.com/swaggo/swag v1.16.1/go.mod h1:9/LMvHycG3NFHfR6LwvikHv5iFvmPADQ359cKikGxto=
github.com/tklauser/go-sysconf v0.3.11 h1:89WgdJhk5SNwJfu+GKyYveZ4IaJ7xAkecBo+KdJV0CM=
github.com/tklauser/go-sysconf v0.3.11/go.mod h1:GqXfhXY3kiPa0nAXPDIQIWzJbMCB7AmcWpGR8lSZfqI=
-github.com/tklauser/numcpus v0.6.0 h1:kebhY2Qt+3U6RNK7UqpYNA+tJ23IBEGKkB7JQBfDYms=
github.com/tklauser/numcpus v0.6.0/go.mod h1:FEZLMke0lhOUG6w2JadTzp0a+Nl8PF/GFkQ5UVIcaL4=
+github.com/tklauser/numcpus v0.6.1 h1:ng9scYS7az0Bk4OZLvrNXNSAO2Pxr1XXRAPyjhIx+Fk=
+github.com/tklauser/numcpus v0.6.1/go.mod h1:1XfjsgE2zo8GVw7POkMbHENHzVg3GzmoZ9fESEdAacY=
github.com/tv42/httpunix v0.0.0-20150427012821-b75d8614f926/go.mod h1:9ESjWnEqriFuLhtthL60Sar/7RFoluCcXsuvEwTV5KM=
-github.com/urfave/cli/v2 v2.24.4 h1:0gyJJEBYtCV87zI/x2nZCPyDxD51K6xM8SkwjHFCNEU=
-github.com/urfave/cli/v2 v2.24.4/go.mod h1:GHupkWPMM0M/sj1a2b4wUrWBPzazNrIjouW6fmdJLxc=
+github.com/urfave/cli/v2 v2.25.5 h1:d0NIAyhh5shGscroL7ek/Ya9QYQE0KNabJgiUinIQkc=
+github.com/urfave/cli/v2 v2.25.5/go.mod h1:GHupkWPMM0M/sj1a2b4wUrWBPzazNrIjouW6fmdJLxc=
github.com/valyala/bytebufferpool v1.0.0 h1:GqA5TC/0021Y/b9FG4Oi9Mr3q7XYx6KllzawFIhcdPw=
github.com/valyala/bytebufferpool v1.0.0/go.mod h1:6bBcMArwyJ5K/AmCkWv1jt77kVWyCJ6HpOuEn7z0Csc=
github.com/valyala/fasttemplate v1.2.1/go.mod h1:KHLXt3tVN2HBp8eijSv/kGJopbvo7S+qRAEEKiv+SiQ=
github.com/valyala/fasttemplate v1.2.2 h1:lxLXG0uE3Qnshl9QyaK6XJxMXlQZELvChBOCmQD0Loo=
github.com/valyala/fasttemplate v1.2.2/go.mod h1:KHLXt3tVN2HBp8eijSv/kGJopbvo7S+qRAEEKiv+SiQ=
-github.com/vektah/gqlparser/v2 v2.5.1 h1:ZGu+bquAY23jsxDRcYpWjttRZrUz07LbiY77gUOHcr4=
-github.com/vektah/gqlparser/v2 v2.5.1/go.mod h1:mPgqFBu/woKTVYWyNk8cO3kh4S/f4aRFZrvOnp3hmCs=
+github.com/vektah/gqlparser/v2 v2.5.3 h1:goUwv4+blhtwR3GwefadPVI4ubYc/WZSypljWMQa6IE=
+github.com/vektah/gqlparser/v2 v2.5.3/go.mod h1:z8xXUff237NntSuH8mLFijZ+1tjV1swDbpDqjJmk6ME=
github.com/xeipuuv/gojsonpointer v0.0.0-20180127040702-4e3ac2762d5f/go.mod h1:N2zxlSyiKSe5eX1tZViRH5QA0qijqEDrYZiPEAiq3wU=
github.com/xeipuuv/gojsonpointer v0.0.0-20190905194746-02993c407bfb h1:zGWFAtiMcyryUHoUjUJX0/lt1H2+i2Ka2n+D3DImSNo=
github.com/xeipuuv/gojsonpointer v0.0.0-20190905194746-02993c407bfb/go.mod h1:N2zxlSyiKSe5eX1tZViRH5QA0qijqEDrYZiPEAiq3wU=
@@ -343,7 +332,6 @@ github.com/xeipuuv/gojsonschema v1.2.0/go.mod h1:anYRn/JVcOK2ZgGU+IjEV4nwlhoK5sQ
github.com/xrash/smetrics v0.0.0-20201216005158-039620a65673 h1:bAn7/zixMGCfxrRTfdpNzjtPYqr8smhKouy9mxVdGPU=
github.com/xrash/smetrics v0.0.0-20201216005158-039620a65673/go.mod h1:N3UwUGtsrSj3ccvlPHLoLsHnpR27oXr4ZE984MbSER8=
github.com/yuin/goldmark v1.3.5/go.mod h1:mwnBkeHKe2W/ZEtQ+71ViKU8L12m81fl3OWwC1Zlc8k=
-github.com/yusufpapurcu/wmi v1.2.2/go.mod h1:SBZ9tNy3G9/m5Oi98Zks0QjeHVDvuK0qfxQmPyzfmi0=
github.com/yusufpapurcu/wmi v1.2.3 h1:E1ctvB7uKFMOJw3fdOW32DwGE9I7t++CRUEMKvFoFiw=
github.com/yusufpapurcu/wmi v1.2.3/go.mod h1:SBZ9tNy3G9/m5Oi98Zks0QjeHVDvuK0qfxQmPyzfmi0=
go.etcd.io/bbolt v1.3.5/go.mod h1:G5EMThwa9y8QZGBClrRx5EY+Yw9kAhnjy3bSjsnlVTQ=
@@ -362,12 +350,12 @@ go.uber.org/zap v1.24.0/go.mod h1:2kMP+WWQ8aoFoedH3T2sq6iJ2yDWpHbP0f6MQbS9Gkg=
golang.org/x/crypto v0.0.0-20180904163835-0709b304e793/go.mod h1:6SG95UA2DQfeDnfUPMdvaQW0Q7yPrPDi9nlGo2tz2b4=
golang.org/x/crypto v0.0.0-20190308221718-c2843e01d9a2/go.mod h1:djNgcEr1/C05ACkg1iLfiJU5Ep61QUkGW8qpdssI0+w=
golang.org/x/crypto v0.0.0-20191011191535-87dc89f01550/go.mod h1:yigFU9vqHzYiE8UmvKecakEJjdnWj3jj499lnFckfCI=
-golang.org/x/crypto v0.9.0 h1:LF6fAI+IutBocDJ2OT0Q1g8plpYljMZ4+lty+dsqw3g=
-golang.org/x/crypto v0.9.0/go.mod h1:yrmDGqONDYtNj3tH8X9dzUun2m2lzPa9ngI6/RUPGR0=
+golang.org/x/crypto v0.10.0 h1:LKqV2xt9+kDzSTfOhx4FrkEBcMrAgHSYgzywV9zcGmM=
+golang.org/x/crypto v0.10.0/go.mod h1:o4eNf7Ede1fv+hwOwZsTHl9EsPFO6q6ZvYR8vYfY45I=
golang.org/x/lint v0.0.0-20190930215403-16217165b5de/go.mod h1:6SW0HCj/g11FgYtHlgUYUwCkIfeOF89ocIRzGO/8vkc=
golang.org/x/mod v0.4.2/go.mod h1:s0Qsj1ACt9ePp/hMypM3fl4fZqREWJwdYDEqhRiZZUA=
-golang.org/x/mod v0.10.0 h1:lFO9qtOdlre5W1jxS3r/4szv2/6iXxScdzjoBMXNhYk=
-golang.org/x/mod v0.10.0/go.mod h1:iBbtSCu2XBx23ZKBPSOrRkjjQPZFPuis4dIYUhu/chs=
+golang.org/x/mod v0.11.0 h1:bUO06HqtnRcc/7l71XBe4WcqTZ+3AH1J59zWDDwLKgU=
+golang.org/x/mod v0.11.0/go.mod h1:iBbtSCu2XBx23ZKBPSOrRkjjQPZFPuis4dIYUhu/chs=
golang.org/x/net v0.0.0-20181114220301-adae6a3d119a/go.mod h1:mL1N/T3taQHkDXs73rZJwtUhF3w3ftmwwsq0BUmARs4=
golang.org/x/net v0.0.0-20181201002055-351d144fa1fc/go.mod h1:mL1N/T3taQHkDXs73rZJwtUhF3w3ftmwwsq0BUmARs4=
golang.org/x/net v0.0.0-20190311183353-d8887717615a/go.mod h1:t9HGtf8HONx5eT2rtn7q6eTqICYqUVnKs3thJo3Qplg=
@@ -375,14 +363,14 @@ golang.org/x/net v0.0.0-20190404232315-eb5bcb51f2a3/go.mod h1:t9HGtf8HONx5eT2rtn
golang.org/x/net v0.0.0-20190613194153-d28f0bde5980/go.mod h1:z5CRVTTTmAJ677TzLLGU+0bjPO0LkuOLi4/5GtJWs/s=
golang.org/x/net v0.0.0-20190620200207-3b0461eec859/go.mod h1:z5CRVTTTmAJ677TzLLGU+0bjPO0LkuOLi4/5GtJWs/s=
golang.org/x/net v0.0.0-20210405180319-a5a99cb37ef4/go.mod h1:p54w0d4576C0XHj96bSt6lcn1PtDYWL6XObtHCRCNQM=
-golang.org/x/net v0.10.0 h1:X2//UzNDwYmtCLn7To6G58Wr6f5ahEAQgKNzv9Y951M=
-golang.org/x/net v0.10.0/go.mod h1:0qNGK6F8kojg2nk9dLZ2mShWaEBan6FAoqfSigmmuDg=
+golang.org/x/net v0.11.0 h1:Gi2tvZIJyBtO9SDr1q9h5hEQCp/4L2RQ+ar0qjx2oNU=
+golang.org/x/net v0.11.0/go.mod h1:2L/ixqYpgIVXmeoSA/4Lu7BzTG4KIyPIryS4IsOd1oQ=
golang.org/x/sync v0.0.0-20181108010431-42b317875d0f/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM=
golang.org/x/sync v0.0.0-20181221193216-37e7f081c4d4/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM=
golang.org/x/sync v0.0.0-20190423024810-112230192c58/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM=
golang.org/x/sync v0.0.0-20190911185100-cd5d95a43a6e/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM=
golang.org/x/sync v0.0.0-20210220032951-036812b2e83c/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM=
-golang.org/x/sync v0.2.0 h1:PUR+T4wwASmuSTYdKjYHI5TD22Wy5ogLU5qZCOLxBrI=
+golang.org/x/sync v0.3.0 h1:ftCYgMx6zT/asHUrPw8BLLscYtGznsLAnjq5RH9P66E=
golang.org/x/sys v0.0.0-20180905080454-ebe1bf3edb33/go.mod h1:STP8DvDyc/dI5b8T5hshtkjS+E42TnysNCUPdjciGhY=
golang.org/x/sys v0.0.0-20181116152217-5ac8a444bdc5/go.mod h1:STP8DvDyc/dI5b8T5hshtkjS+E42TnysNCUPdjciGhY=
golang.org/x/sys v0.0.0-20190215142949-d0b11bdaac8a/go.mod h1:STP8DvDyc/dI5b8T5hshtkjS+E42TnysNCUPdjciGhY=
@@ -401,19 +389,19 @@ golang.org/x/sys v0.0.0-20210630005230-0f9fa26af87c/go.mod h1:oPkhp1MJrh7nUepCBc
golang.org/x/sys v0.0.0-20210927094055-39ccf1dd6fa6/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
golang.org/x/sys v0.0.0-20211103235746-7861aae1554b/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
golang.org/x/sys v0.0.0-20220503163025-988cb79eb6c6/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
-golang.org/x/sys v0.0.0-20220704084225-05e143d24a9e/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
golang.org/x/sys v0.0.0-20220715151400-c0bba94af5f8/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
golang.org/x/sys v0.0.0-20220811171246-fbc7d0a398ab/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
golang.org/x/sys v0.2.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
+golang.org/x/sys v0.5.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
golang.org/x/sys v0.6.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
-golang.org/x/sys v0.7.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
-golang.org/x/sys v0.8.0 h1:EBmGv8NaZBZTWvrbjNoL6HVt+IVy3QDQpJs7VRIw3tU=
golang.org/x/sys v0.8.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
+golang.org/x/sys v0.9.0 h1:KS/R3tvhPqvJvwcKfnBHJwwthS11LRhmM5D59eEXa0s=
+golang.org/x/sys v0.9.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg=
golang.org/x/term v0.0.0-20201126162022-7de9c90e9dd1/go.mod h1:bj7SfCRtBDWHUb9snDiAeCFNEtKQo2Wmx5Cou7ajbmo=
golang.org/x/text v0.3.0/go.mod h1:NqM8EUOU14njkJ3fqMW+pc6Ldnwhi/IjpwHt7yyuwOQ=
golang.org/x/text v0.3.3/go.mod h1:5Zoc/QRtKVWzQhOtBMvqHzDpF6irO9z98xDceosuGiQ=
-golang.org/x/text v0.9.0 h1:2sjJmO8cDvYveuX97RDLsxlyUxLl+GHoLxBiRdHllBE=
-golang.org/x/text v0.9.0/go.mod h1:e1OnstbJyHTd6l/uOt8jFFHp6TRDWZR/bV3emEE/zU8=
+golang.org/x/text v0.10.0 h1:UpjohKhiEgNc0CSauXmwYftY1+LlaC75SJwh0SgCX58=
+golang.org/x/text v0.10.0/go.mod h1:TvPlkZtksWOMsz7fbANvkp4WM8x/WCo/om8BMLbz+aE=
golang.org/x/time v0.0.0-20210220033141-f8bda1e9f3ba/go.mod h1:tRJNPiyCQ0inRvYxbN9jk5I+vvW/OXSQhTDSoE431IQ=
golang.org/x/time v0.3.0 h1:rg5rLMjNzMS1RkNLzCG38eapWhnYLFYXDXj2gOlr8j4=
golang.org/x/time v0.3.0/go.mod h1:tRJNPiyCQ0inRvYxbN9jk5I+vvW/OXSQhTDSoE431IQ=
@@ -422,8 +410,8 @@ golang.org/x/tools v0.0.0-20190311212946-11955173bddd/go.mod h1:LCzVGOaR6xXOjkQ3
golang.org/x/tools v0.0.0-20190425150028-36563e24a262/go.mod h1:RgjU9mgBXZiqYHBnxXauZ1Gv1EHHAz9KjViQ78xBX0Q=
golang.org/x/tools v0.0.0-20191119224855-298f0cb1881e/go.mod h1:b+2E5dAYhXwXZwtnZ6UAqBI28+e2cm9otk0dWdXHAEo=
golang.org/x/tools v0.1.5/go.mod h1:o0xws9oXOQQZyjljx8fwUC0k7L1pTE6eaCbjGeHmOkk=
-golang.org/x/tools v0.9.1 h1:8WMNJAz3zrtPmnYC7ISf5dEn3MT0gY7jBJfw27yrrLo=
-golang.org/x/tools v0.9.1/go.mod h1:owI94Op576fPu3cIGQeHs3joujW/2Oc6MtlxbF5dfNc=
+golang.org/x/tools v0.10.0 h1:tvDr/iQoUqNdohiYm0LmmKcBk+q86lb9EprIUFhHHGg=
+golang.org/x/tools v0.10.0/go.mod h1:UJwyiVBsOA2uwvK/e5OY3GTpDUJriEd+/YlqAwLPmyM=
golang.org/x/xerrors v0.0.0-20190717185122-a985d3407aa7/go.mod h1:I/5z698sn9Ka8TeJc9MKroUUfqBBauWjQqLJ2OPfmY0=
golang.org/x/xerrors v0.0.0-20191011141410-1b5146add898/go.mod h1:I/5z698sn9Ka8TeJc9MKroUUfqBBauWjQqLJ2OPfmY0=
golang.org/x/xerrors v0.0.0-20191204190536-9bdfabe68543/go.mod h1:I/5z698sn9Ka8TeJc9MKroUUfqBBauWjQqLJ2OPfmY0=
@@ -445,7 +433,6 @@ gopkg.in/yaml.v2 v2.2.1/go.mod h1:hI93XBmqTisBFMUTm0b8Fm+jr3Dg1NNxqwp+5A1VGuI=
gopkg.in/yaml.v2 v2.2.2/go.mod h1:hI93XBmqTisBFMUTm0b8Fm+jr3Dg1NNxqwp+5A1VGuI=
gopkg.in/yaml.v2 v2.2.4/go.mod h1:hI93XBmqTisBFMUTm0b8Fm+jr3Dg1NNxqwp+5A1VGuI=
gopkg.in/yaml.v2 v2.2.5/go.mod h1:hI93XBmqTisBFMUTm0b8Fm+jr3Dg1NNxqwp+5A1VGuI=
-gopkg.in/yaml.v2 v2.2.8/go.mod h1:hI93XBmqTisBFMUTm0b8Fm+jr3Dg1NNxqwp+5A1VGuI=
gopkg.in/yaml.v2 v2.4.0 h1:D8xgwECY7CYvx+Y2n4sBz93Jn9JRvxdiyyo8CTfuKaY=
gopkg.in/yaml.v2 v2.4.0/go.mod h1:RDklbk79AGWmwhnvt/jBztapEOGDOx6ZbXqjP6csGnQ=
gopkg.in/yaml.v3 v3.0.0-20200313102051-9f266ea9e77c/go.mod h1:K4uyk7z7BCEPqu6E+C64Yfv1cQ7kz7rIZviUmN+EgEM=
diff --git a/http/graph/graph/graph.go b/http/graph/graph/graph.go
index 57d0564e..6db1ccba 100644
--- a/http/graph/graph/graph.go
+++ b/http/graph/graph/graph.go
@@ -304,7 +304,7 @@ func (e *executableSchema) Schema() *ast.Schema {
}
func (e *executableSchema) Complexity(typeName, field string, childComplexity int, rawArgs map[string]interface{}) (int, bool) {
- ec := executionContext{nil, e}
+ ec := executionContext{nil, e, 0, 0, nil}
_ = ec
switch typeName + "." + field {
@@ -1480,7 +1480,7 @@ func (e *executableSchema) Complexity(typeName, field string, childComplexity in
func (e *executableSchema) Exec(ctx context.Context) graphql.ResponseHandler {
rc := graphql.GetOperationContext(ctx)
- ec := executionContext{rc, e}
+ ec := executionContext{rc, e, 0, 0, make(chan graphql.DeferredResult)}
inputUnmarshalMap := graphql.BuildUnmarshalerMap(
ec.unmarshalInputMetricInput,
ec.unmarshalInputMetricsInput,
@@ -1490,18 +1490,33 @@ func (e *executableSchema) Exec(ctx context.Context) graphql.ResponseHandler {
switch rc.Operation.Operation {
case ast.Query:
return func(ctx context.Context) *graphql.Response {
- if !first {
- return nil
+ var response graphql.Response
+ var data graphql.Marshaler
+ if first {
+ first = false
+ ctx = graphql.WithUnmarshalerMap(ctx, inputUnmarshalMap)
+ data = ec._Query(ctx, rc.Operation.SelectionSet)
+ } else {
+ if atomic.LoadInt32(&ec.pendingDeferred) > 0 {
+ result := <-ec.deferredResults
+ atomic.AddInt32(&ec.pendingDeferred, -1)
+ data = result.Result
+ response.Path = result.Path
+ response.Label = result.Label
+ response.Errors = result.Errors
+ } else {
+ return nil
+ }
}
- first = false
- ctx = graphql.WithUnmarshalerMap(ctx, inputUnmarshalMap)
- data := ec._Query(ctx, rc.Operation.SelectionSet)
var buf bytes.Buffer
data.MarshalGQL(&buf)
-
- return &graphql.Response{
- Data: buf.Bytes(),
+ response.Data = buf.Bytes()
+ if atomic.LoadInt32(&ec.deferred) > 0 {
+ hasNext := atomic.LoadInt32(&ec.pendingDeferred) > 0
+ response.HasNext = &hasNext
}
+
+ return &response
}
case ast.Mutation:
return func(ctx context.Context) *graphql.Response {
@@ -1527,6 +1542,28 @@ func (e *executableSchema) Exec(ctx context.Context) graphql.ResponseHandler {
type executionContext struct {
*graphql.OperationContext
*executableSchema
+ deferred int32
+ pendingDeferred int32
+ deferredResults chan graphql.DeferredResult
+}
+
+func (ec *executionContext) processDeferredGroup(dg graphql.DeferredGroup) {
+ atomic.AddInt32(&ec.pendingDeferred, 1)
+ go func() {
+ ctx := graphql.WithFreshResponseContext(dg.Context)
+ dg.FieldSet.Dispatch(ctx)
+ ds := graphql.DeferredResult{
+ Path: dg.Path,
+ Label: dg.Label,
+ Result: dg.FieldSet,
+ Errors: graphql.GetErrors(ctx),
+ }
+ // null fields should bubble up
+ if dg.FieldSet.Invalids > 0 {
+ ds.Result = graphql.Null
+ }
+ ec.deferredResults <- ds
+ }()
}
func (ec *executionContext) introspectSchema() (*introspection.Schema, error) {
@@ -8337,7 +8374,7 @@ func (ec *executionContext) fieldContext_Query_metrics(ctx context.Context, fiel
ctx = graphql.WithFieldContext(ctx, fc)
if fc.Args, err = ec.field_Query_metrics_args(ctx, field.ArgumentMap(ec.Variables)); err != nil {
ec.Error(ctx, err)
- return
+ return fc, err
}
return fc, nil
}
@@ -8421,7 +8458,7 @@ func (ec *executionContext) fieldContext_Query_playoutStatus(ctx context.Context
ctx = graphql.WithFieldContext(ctx, fc)
if fc.Args, err = ec.field_Query_playoutStatus_args(ctx, field.ArgumentMap(ec.Variables)); err != nil {
ec.Error(ctx, err)
- return
+ return fc, err
}
return fc, nil
}
@@ -8498,7 +8535,7 @@ func (ec *executionContext) fieldContext_Query_processes(ctx context.Context, fi
ctx = graphql.WithFieldContext(ctx, fc)
if fc.Args, err = ec.field_Query_processes_args(ctx, field.ArgumentMap(ec.Variables)); err != nil {
ec.Error(ctx, err)
- return
+ return fc, err
}
return fc, nil
}
@@ -8572,7 +8609,7 @@ func (ec *executionContext) fieldContext_Query_process(ctx context.Context, fiel
ctx = graphql.WithFieldContext(ctx, fc)
if fc.Args, err = ec.field_Query_process_args(ctx, field.ArgumentMap(ec.Variables)); err != nil {
ec.Error(ctx, err)
- return
+ return fc, err
}
return fc, nil
}
@@ -8633,7 +8670,7 @@ func (ec *executionContext) fieldContext_Query_probe(ctx context.Context, field
ctx = graphql.WithFieldContext(ctx, fc)
if fc.Args, err = ec.field_Query_probe_args(ctx, field.ArgumentMap(ec.Variables)); err != nil {
ec.Error(ctx, err)
- return
+ return fc, err
}
return fc, nil
}
@@ -8707,7 +8744,7 @@ func (ec *executionContext) fieldContext_Query___type(ctx context.Context, field
ctx = graphql.WithFieldContext(ctx, fc)
if fc.Args, err = ec.field_Query___type_args(ctx, field.ArgumentMap(ec.Variables)); err != nil {
ec.Error(ctx, err)
- return
+ return fc, err
}
return fc, nil
}
@@ -11227,7 +11264,7 @@ func (ec *executionContext) fieldContext___Type_fields(ctx context.Context, fiel
ctx = graphql.WithFieldContext(ctx, fc)
if fc.Args, err = ec.field___Type_fields_args(ctx, field.ArgumentMap(ec.Variables)); err != nil {
ec.Error(ctx, err)
- return
+ return fc, err
}
return fc, nil
}
@@ -11415,7 +11452,7 @@ func (ec *executionContext) fieldContext___Type_enumValues(ctx context.Context,
ctx = graphql.WithFieldContext(ctx, fc)
if fc.Args, err = ec.field___Type_enumValues_args(ctx, field.ArgumentMap(ec.Variables)); err != nil {
ec.Error(ctx, err)
- return
+ return fc, err
}
return fc, nil
}
@@ -11597,18 +11634,20 @@ func (ec *executionContext) unmarshalInputMetricInput(ctx context.Context, obj i
var err error
ctx := graphql.WithPathContext(ctx, graphql.NewPathWithField("name"))
- it.Name, err = ec.unmarshalNString2string(ctx, v)
+ data, err := ec.unmarshalNString2string(ctx, v)
if err != nil {
return it, err
}
+ it.Name = data
case "labels":
var err error
ctx := graphql.WithPathContext(ctx, graphql.NewPathWithField("labels"))
- it.Labels, err = ec.unmarshalOMap2map(ctx, v)
+ data, err := ec.unmarshalOMap2map(ctx, v)
if err != nil {
return it, err
}
+ it.Labels = data
}
}
@@ -11633,26 +11672,29 @@ func (ec *executionContext) unmarshalInputMetricsInput(ctx context.Context, obj
var err error
ctx := graphql.WithPathContext(ctx, graphql.NewPathWithField("timerange_seconds"))
- it.TimerangeSeconds, err = ec.unmarshalOInt2ᚖint(ctx, v)
+ data, err := ec.unmarshalOInt2ᚖint(ctx, v)
if err != nil {
return it, err
}
+ it.TimerangeSeconds = data
case "interval_seconds":
var err error
ctx := graphql.WithPathContext(ctx, graphql.NewPathWithField("interval_seconds"))
- it.IntervalSeconds, err = ec.unmarshalOInt2ᚖint(ctx, v)
+ data, err := ec.unmarshalOInt2ᚖint(ctx, v)
if err != nil {
return it, err
}
+ it.IntervalSeconds = data
case "metrics":
var err error
ctx := graphql.WithPathContext(ctx, graphql.NewPathWithField("metrics"))
- it.Metrics, err = ec.unmarshalNMetricInput2ᚕᚖgithubᚗcomᚋdatarheiᚋcoreᚋv16ᚋhttpᚋgraphᚋmodelsᚐMetricInputᚄ(ctx, v)
+ data, err := ec.unmarshalNMetricInput2ᚕᚖgithubᚗcomᚋdatarheiᚋcoreᚋv16ᚋhttpᚋgraphᚋmodelsᚐMetricInputᚄ(ctx, v)
if err != nil {
return it, err
}
+ it.Metrics = data
}
}
@@ -11694,90 +11736,83 @@ var aVStreamImplementors = []string{"AVStream"}
func (ec *executionContext) _AVStream(ctx context.Context, sel ast.SelectionSet, obj *models.AVStream) graphql.Marshaler {
fields := graphql.CollectFields(ec.OperationContext, sel, aVStreamImplementors)
+
out := graphql.NewFieldSet(fields)
- var invalids uint32
+ deferred := make(map[string]*graphql.FieldSet)
for i, field := range fields {
switch field.Name {
case "__typename":
out.Values[i] = graphql.MarshalString("AVStream")
case "input":
-
out.Values[i] = ec._AVStream_input(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "output":
-
out.Values[i] = ec._AVStream_output(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "aqueue":
-
out.Values[i] = ec._AVStream_aqueue(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "queue":
-
out.Values[i] = ec._AVStream_queue(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "dup":
-
out.Values[i] = ec._AVStream_dup(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "drop":
-
out.Values[i] = ec._AVStream_drop(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "enc":
-
out.Values[i] = ec._AVStream_enc(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "looping":
-
out.Values[i] = ec._AVStream_looping(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "duplicating":
-
out.Values[i] = ec._AVStream_duplicating(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "gop":
-
out.Values[i] = ec._AVStream_gop(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
default:
panic("unknown field " + strconv.Quote(field.Name))
}
}
- out.Dispatch()
- if invalids > 0 {
+ out.Dispatch(ctx)
+ if out.Invalids > 0 {
return graphql.Null
}
+
+ atomic.AddInt32(&ec.deferred, int32(len(deferred)))
+
+ for label, dfs := range deferred {
+ ec.processDeferredGroup(graphql.DeferredGroup{
+ Label: label,
+ Path: graphql.GetPath(ctx),
+ FieldSet: dfs,
+ Context: ctx,
+ })
+ }
+
return out
}
@@ -11785,48 +11820,53 @@ var aVStreamIOImplementors = []string{"AVStreamIO"}
func (ec *executionContext) _AVStreamIO(ctx context.Context, sel ast.SelectionSet, obj *models.AVStreamIo) graphql.Marshaler {
fields := graphql.CollectFields(ec.OperationContext, sel, aVStreamIOImplementors)
+
out := graphql.NewFieldSet(fields)
- var invalids uint32
+ deferred := make(map[string]*graphql.FieldSet)
for i, field := range fields {
switch field.Name {
case "__typename":
out.Values[i] = graphql.MarshalString("AVStreamIO")
case "state":
-
out.Values[i] = ec._AVStreamIO_state(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "packet":
-
out.Values[i] = ec._AVStreamIO_packet(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "time":
-
out.Values[i] = ec._AVStreamIO_time(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "size_kb":
-
out.Values[i] = ec._AVStreamIO_size_kb(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
default:
panic("unknown field " + strconv.Quote(field.Name))
}
}
- out.Dispatch()
- if invalids > 0 {
+ out.Dispatch(ctx)
+ if out.Invalids > 0 {
return graphql.Null
}
+
+ atomic.AddInt32(&ec.deferred, int32(len(deferred)))
+
+ for label, dfs := range deferred {
+ ec.processDeferredGroup(graphql.DeferredGroup{
+ Label: label,
+ Path: graphql.GetPath(ctx),
+ FieldSet: dfs,
+ Context: ctx,
+ })
+ }
+
return out
}
@@ -11834,62 +11874,63 @@ var aboutImplementors = []string{"About"}
func (ec *executionContext) _About(ctx context.Context, sel ast.SelectionSet, obj *models.About) graphql.Marshaler {
fields := graphql.CollectFields(ec.OperationContext, sel, aboutImplementors)
+
out := graphql.NewFieldSet(fields)
- var invalids uint32
+ deferred := make(map[string]*graphql.FieldSet)
for i, field := range fields {
switch field.Name {
case "__typename":
out.Values[i] = graphql.MarshalString("About")
case "app":
-
out.Values[i] = ec._About_app(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "id":
-
out.Values[i] = ec._About_id(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "name":
-
out.Values[i] = ec._About_name(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "created_at":
-
out.Values[i] = ec._About_created_at(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "uptime_seconds":
-
out.Values[i] = ec._About_uptime_seconds(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "version":
-
out.Values[i] = ec._About_version(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
default:
panic("unknown field " + strconv.Quote(field.Name))
}
}
- out.Dispatch()
- if invalids > 0 {
+ out.Dispatch(ctx)
+ if out.Invalids > 0 {
return graphql.Null
}
+
+ atomic.AddInt32(&ec.deferred, int32(len(deferred)))
+
+ for label, dfs := range deferred {
+ ec.processDeferredGroup(graphql.DeferredGroup{
+ Label: label,
+ Path: graphql.GetPath(ctx),
+ FieldSet: dfs,
+ Context: ctx,
+ })
+ }
+
return out
}
@@ -11897,62 +11938,63 @@ var aboutVersionImplementors = []string{"AboutVersion"}
func (ec *executionContext) _AboutVersion(ctx context.Context, sel ast.SelectionSet, obj *models.AboutVersion) graphql.Marshaler {
fields := graphql.CollectFields(ec.OperationContext, sel, aboutVersionImplementors)
+
out := graphql.NewFieldSet(fields)
- var invalids uint32
+ deferred := make(map[string]*graphql.FieldSet)
for i, field := range fields {
switch field.Name {
case "__typename":
out.Values[i] = graphql.MarshalString("AboutVersion")
case "number":
-
out.Values[i] = ec._AboutVersion_number(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "repository_commit":
-
out.Values[i] = ec._AboutVersion_repository_commit(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "repository_branch":
-
out.Values[i] = ec._AboutVersion_repository_branch(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "build_date":
-
out.Values[i] = ec._AboutVersion_build_date(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "arch":
-
out.Values[i] = ec._AboutVersion_arch(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "compiler":
-
out.Values[i] = ec._AboutVersion_compiler(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
default:
panic("unknown field " + strconv.Quote(field.Name))
}
}
- out.Dispatch()
- if invalids > 0 {
+ out.Dispatch(ctx)
+ if out.Invalids > 0 {
return graphql.Null
}
+
+ atomic.AddInt32(&ec.deferred, int32(len(deferred)))
+
+ for label, dfs := range deferred {
+ ec.processDeferredGroup(graphql.DeferredGroup{
+ Label: label,
+ Path: graphql.GetPath(ctx),
+ FieldSet: dfs,
+ Context: ctx,
+ })
+ }
+
return out
}
@@ -11960,38 +12002,45 @@ var metricImplementors = []string{"Metric"}
func (ec *executionContext) _Metric(ctx context.Context, sel ast.SelectionSet, obj *models.Metric) graphql.Marshaler {
fields := graphql.CollectFields(ec.OperationContext, sel, metricImplementors)
+
out := graphql.NewFieldSet(fields)
- var invalids uint32
+ deferred := make(map[string]*graphql.FieldSet)
for i, field := range fields {
switch field.Name {
case "__typename":
out.Values[i] = graphql.MarshalString("Metric")
case "name":
-
out.Values[i] = ec._Metric_name(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "labels":
-
out.Values[i] = ec._Metric_labels(ctx, field, obj)
-
case "values":
-
out.Values[i] = ec._Metric_values(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
default:
panic("unknown field " + strconv.Quote(field.Name))
}
}
- out.Dispatch()
- if invalids > 0 {
+ out.Dispatch(ctx)
+ if out.Invalids > 0 {
return graphql.Null
}
+
+ atomic.AddInt32(&ec.deferred, int32(len(deferred)))
+
+ for label, dfs := range deferred {
+ ec.processDeferredGroup(graphql.DeferredGroup{
+ Label: label,
+ Path: graphql.GetPath(ctx),
+ FieldSet: dfs,
+ Context: ctx,
+ })
+ }
+
return out
}
@@ -11999,35 +12048,42 @@ var metricsImplementors = []string{"Metrics"}
func (ec *executionContext) _Metrics(ctx context.Context, sel ast.SelectionSet, obj *models.Metrics) graphql.Marshaler {
fields := graphql.CollectFields(ec.OperationContext, sel, metricsImplementors)
+
out := graphql.NewFieldSet(fields)
- var invalids uint32
+ deferred := make(map[string]*graphql.FieldSet)
for i, field := range fields {
switch field.Name {
case "__typename":
out.Values[i] = graphql.MarshalString("Metrics")
case "timerange_seconds":
-
out.Values[i] = ec._Metrics_timerange_seconds(ctx, field, obj)
-
case "interval_seconds":
-
out.Values[i] = ec._Metrics_interval_seconds(ctx, field, obj)
-
case "metrics":
-
out.Values[i] = ec._Metrics_metrics(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
default:
panic("unknown field " + strconv.Quote(field.Name))
}
}
- out.Dispatch()
- if invalids > 0 {
+ out.Dispatch(ctx)
+ if out.Invalids > 0 {
return graphql.Null
}
+
+ atomic.AddInt32(&ec.deferred, int32(len(deferred)))
+
+ for label, dfs := range deferred {
+ ec.processDeferredGroup(graphql.DeferredGroup{
+ Label: label,
+ Path: graphql.GetPath(ctx),
+ FieldSet: dfs,
+ Context: ctx,
+ })
+ }
+
return out
}
@@ -12040,7 +12096,7 @@ func (ec *executionContext) _Mutation(ctx context.Context, sel ast.SelectionSet)
})
out := graphql.NewFieldSet(fields)
- var invalids uint32
+ deferred := make(map[string]*graphql.FieldSet)
for i, field := range fields {
innerCtx := graphql.WithRootFieldContext(ctx, &graphql.RootFieldContext{
Object: field.Name,
@@ -12051,22 +12107,32 @@ func (ec *executionContext) _Mutation(ctx context.Context, sel ast.SelectionSet)
case "__typename":
out.Values[i] = graphql.MarshalString("Mutation")
case "ping":
-
out.Values[i] = ec.OperationContext.RootResolverMiddleware(innerCtx, func(ctx context.Context) (res graphql.Marshaler) {
return ec._Mutation_ping(ctx, field)
})
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
default:
panic("unknown field " + strconv.Quote(field.Name))
}
}
- out.Dispatch()
- if invalids > 0 {
+ out.Dispatch(ctx)
+ if out.Invalids > 0 {
return graphql.Null
}
+
+ atomic.AddInt32(&ec.deferred, int32(len(deferred)))
+
+ for label, dfs := range deferred {
+ ec.processDeferredGroup(graphql.DeferredGroup{
+ Label: label,
+ Path: graphql.GetPath(ctx),
+ FieldSet: dfs,
+ Context: ctx,
+ })
+ }
+
return out
}
@@ -12074,34 +12140,43 @@ var probeImplementors = []string{"Probe"}
func (ec *executionContext) _Probe(ctx context.Context, sel ast.SelectionSet, obj *models.Probe) graphql.Marshaler {
fields := graphql.CollectFields(ec.OperationContext, sel, probeImplementors)
+
out := graphql.NewFieldSet(fields)
- var invalids uint32
+ deferred := make(map[string]*graphql.FieldSet)
for i, field := range fields {
switch field.Name {
case "__typename":
out.Values[i] = graphql.MarshalString("Probe")
case "streams":
-
out.Values[i] = ec._Probe_streams(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "log":
-
out.Values[i] = ec._Probe_log(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
default:
panic("unknown field " + strconv.Quote(field.Name))
}
}
- out.Dispatch()
- if invalids > 0 {
+ out.Dispatch(ctx)
+ if out.Invalids > 0 {
return graphql.Null
}
+
+ atomic.AddInt32(&ec.deferred, int32(len(deferred)))
+
+ for label, dfs := range deferred {
+ ec.processDeferredGroup(graphql.DeferredGroup{
+ Label: label,
+ Path: graphql.GetPath(ctx),
+ FieldSet: dfs,
+ Context: ctx,
+ })
+ }
+
return out
}
@@ -12109,132 +12184,113 @@ var probeIOImplementors = []string{"ProbeIO"}
func (ec *executionContext) _ProbeIO(ctx context.Context, sel ast.SelectionSet, obj *models.ProbeIo) graphql.Marshaler {
fields := graphql.CollectFields(ec.OperationContext, sel, probeIOImplementors)
+
out := graphql.NewFieldSet(fields)
- var invalids uint32
+ deferred := make(map[string]*graphql.FieldSet)
for i, field := range fields {
switch field.Name {
case "__typename":
out.Values[i] = graphql.MarshalString("ProbeIO")
case "url":
-
out.Values[i] = ec._ProbeIO_url(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "index":
-
out.Values[i] = ec._ProbeIO_index(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "stream":
-
out.Values[i] = ec._ProbeIO_stream(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "language":
-
out.Values[i] = ec._ProbeIO_language(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "type":
-
out.Values[i] = ec._ProbeIO_type(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "codec":
-
out.Values[i] = ec._ProbeIO_codec(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "coder":
-
out.Values[i] = ec._ProbeIO_coder(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "bitrate_kbps":
-
out.Values[i] = ec._ProbeIO_bitrate_kbps(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "duration_seconds":
-
out.Values[i] = ec._ProbeIO_duration_seconds(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "fps":
-
out.Values[i] = ec._ProbeIO_fps(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "pix_fmt":
-
out.Values[i] = ec._ProbeIO_pix_fmt(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "width":
-
out.Values[i] = ec._ProbeIO_width(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "height":
-
out.Values[i] = ec._ProbeIO_height(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "sampling":
-
out.Values[i] = ec._ProbeIO_sampling(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "layout":
-
out.Values[i] = ec._ProbeIO_layout(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "channels":
-
out.Values[i] = ec._ProbeIO_channels(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
default:
panic("unknown field " + strconv.Quote(field.Name))
}
}
- out.Dispatch()
- if invalids > 0 {
+ out.Dispatch(ctx)
+ if out.Invalids > 0 {
return graphql.Null
}
+
+ atomic.AddInt32(&ec.deferred, int32(len(deferred)))
+
+ for label, dfs := range deferred {
+ ec.processDeferredGroup(graphql.DeferredGroup{
+ Label: label,
+ Path: graphql.GetPath(ctx),
+ FieldSet: dfs,
+ Context: ctx,
+ })
+ }
+
return out
}
@@ -12242,87 +12298,80 @@ var processImplementors = []string{"Process"}
func (ec *executionContext) _Process(ctx context.Context, sel ast.SelectionSet, obj *models.Process) graphql.Marshaler {
fields := graphql.CollectFields(ec.OperationContext, sel, processImplementors)
+
out := graphql.NewFieldSet(fields)
- var invalids uint32
+ deferred := make(map[string]*graphql.FieldSet)
for i, field := range fields {
switch field.Name {
case "__typename":
out.Values[i] = graphql.MarshalString("Process")
case "id":
-
out.Values[i] = ec._Process_id(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "owner":
-
out.Values[i] = ec._Process_owner(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "domain":
-
out.Values[i] = ec._Process_domain(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "type":
-
out.Values[i] = ec._Process_type(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "reference":
-
out.Values[i] = ec._Process_reference(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "created_at":
-
out.Values[i] = ec._Process_created_at(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "config":
-
out.Values[i] = ec._Process_config(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "state":
-
out.Values[i] = ec._Process_state(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "report":
-
out.Values[i] = ec._Process_report(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "metadata":
-
out.Values[i] = ec._Process_metadata(ctx, field, obj)
-
default:
panic("unknown field " + strconv.Quote(field.Name))
}
}
- out.Dispatch()
- if invalids > 0 {
+ out.Dispatch(ctx)
+ if out.Invalids > 0 {
return graphql.Null
}
+
+ atomic.AddInt32(&ec.deferred, int32(len(deferred)))
+
+ for label, dfs := range deferred {
+ ec.processDeferredGroup(graphql.DeferredGroup{
+ Label: label,
+ Path: graphql.GetPath(ctx),
+ FieldSet: dfs,
+ Context: ctx,
+ })
+ }
+
return out
}
@@ -12330,111 +12379,98 @@ var processConfigImplementors = []string{"ProcessConfig"}
func (ec *executionContext) _ProcessConfig(ctx context.Context, sel ast.SelectionSet, obj *models.ProcessConfig) graphql.Marshaler {
fields := graphql.CollectFields(ec.OperationContext, sel, processConfigImplementors)
+
out := graphql.NewFieldSet(fields)
- var invalids uint32
+ deferred := make(map[string]*graphql.FieldSet)
for i, field := range fields {
switch field.Name {
case "__typename":
out.Values[i] = graphql.MarshalString("ProcessConfig")
case "id":
-
out.Values[i] = ec._ProcessConfig_id(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "owner":
-
out.Values[i] = ec._ProcessConfig_owner(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "domain":
-
out.Values[i] = ec._ProcessConfig_domain(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "type":
-
out.Values[i] = ec._ProcessConfig_type(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "reference":
-
out.Values[i] = ec._ProcessConfig_reference(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "input":
-
out.Values[i] = ec._ProcessConfig_input(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "output":
-
out.Values[i] = ec._ProcessConfig_output(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "options":
-
out.Values[i] = ec._ProcessConfig_options(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "reconnect":
-
out.Values[i] = ec._ProcessConfig_reconnect(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "reconnect_delay_seconds":
-
out.Values[i] = ec._ProcessConfig_reconnect_delay_seconds(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "autostart":
-
out.Values[i] = ec._ProcessConfig_autostart(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "stale_timeout_seconds":
-
out.Values[i] = ec._ProcessConfig_stale_timeout_seconds(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "limits":
-
out.Values[i] = ec._ProcessConfig_limits(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
default:
panic("unknown field " + strconv.Quote(field.Name))
}
}
- out.Dispatch()
- if invalids > 0 {
+ out.Dispatch(ctx)
+ if out.Invalids > 0 {
return graphql.Null
}
+
+ atomic.AddInt32(&ec.deferred, int32(len(deferred)))
+
+ for label, dfs := range deferred {
+ ec.processDeferredGroup(graphql.DeferredGroup{
+ Label: label,
+ Path: graphql.GetPath(ctx),
+ FieldSet: dfs,
+ Context: ctx,
+ })
+ }
+
return out
}
@@ -12442,41 +12478,48 @@ var processConfigIOImplementors = []string{"ProcessConfigIO"}
func (ec *executionContext) _ProcessConfigIO(ctx context.Context, sel ast.SelectionSet, obj *models.ProcessConfigIo) graphql.Marshaler {
fields := graphql.CollectFields(ec.OperationContext, sel, processConfigIOImplementors)
+
out := graphql.NewFieldSet(fields)
- var invalids uint32
+ deferred := make(map[string]*graphql.FieldSet)
for i, field := range fields {
switch field.Name {
case "__typename":
out.Values[i] = graphql.MarshalString("ProcessConfigIO")
case "id":
-
out.Values[i] = ec._ProcessConfigIO_id(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "address":
-
out.Values[i] = ec._ProcessConfigIO_address(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "options":
-
out.Values[i] = ec._ProcessConfigIO_options(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
default:
panic("unknown field " + strconv.Quote(field.Name))
}
}
- out.Dispatch()
- if invalids > 0 {
+ out.Dispatch(ctx)
+ if out.Invalids > 0 {
return graphql.Null
}
+
+ atomic.AddInt32(&ec.deferred, int32(len(deferred)))
+
+ for label, dfs := range deferred {
+ ec.processDeferredGroup(graphql.DeferredGroup{
+ Label: label,
+ Path: graphql.GetPath(ctx),
+ FieldSet: dfs,
+ Context: ctx,
+ })
+ }
+
return out
}
@@ -12484,41 +12527,48 @@ var processConfigLimitsImplementors = []string{"ProcessConfigLimits"}
func (ec *executionContext) _ProcessConfigLimits(ctx context.Context, sel ast.SelectionSet, obj *models.ProcessConfigLimits) graphql.Marshaler {
fields := graphql.CollectFields(ec.OperationContext, sel, processConfigLimitsImplementors)
+
out := graphql.NewFieldSet(fields)
- var invalids uint32
+ deferred := make(map[string]*graphql.FieldSet)
for i, field := range fields {
switch field.Name {
case "__typename":
out.Values[i] = graphql.MarshalString("ProcessConfigLimits")
case "cpu_usage":
-
out.Values[i] = ec._ProcessConfigLimits_cpu_usage(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "memory_bytes":
-
out.Values[i] = ec._ProcessConfigLimits_memory_bytes(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "waitfor_seconds":
-
out.Values[i] = ec._ProcessConfigLimits_waitfor_seconds(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
default:
panic("unknown field " + strconv.Quote(field.Name))
}
}
- out.Dispatch()
- if invalids > 0 {
+ out.Dispatch(ctx)
+ if out.Invalids > 0 {
return graphql.Null
}
+
+ atomic.AddInt32(&ec.deferred, int32(len(deferred)))
+
+ for label, dfs := range deferred {
+ ec.processDeferredGroup(graphql.DeferredGroup{
+ Label: label,
+ Path: graphql.GetPath(ctx),
+ FieldSet: dfs,
+ Context: ctx,
+ })
+ }
+
return out
}
@@ -12526,48 +12576,53 @@ var processReportImplementors = []string{"ProcessReport", "IProcessReportHistory
func (ec *executionContext) _ProcessReport(ctx context.Context, sel ast.SelectionSet, obj *models.ProcessReport) graphql.Marshaler {
fields := graphql.CollectFields(ec.OperationContext, sel, processReportImplementors)
+
out := graphql.NewFieldSet(fields)
- var invalids uint32
+ deferred := make(map[string]*graphql.FieldSet)
for i, field := range fields {
switch field.Name {
case "__typename":
out.Values[i] = graphql.MarshalString("ProcessReport")
case "created_at":
-
out.Values[i] = ec._ProcessReport_created_at(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "prelude":
-
out.Values[i] = ec._ProcessReport_prelude(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "log":
-
out.Values[i] = ec._ProcessReport_log(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "history":
-
out.Values[i] = ec._ProcessReport_history(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
default:
panic("unknown field " + strconv.Quote(field.Name))
}
}
- out.Dispatch()
- if invalids > 0 {
+ out.Dispatch(ctx)
+ if out.Invalids > 0 {
return graphql.Null
}
+
+ atomic.AddInt32(&ec.deferred, int32(len(deferred)))
+
+ for label, dfs := range deferred {
+ ec.processDeferredGroup(graphql.DeferredGroup{
+ Label: label,
+ Path: graphql.GetPath(ctx),
+ FieldSet: dfs,
+ Context: ctx,
+ })
+ }
+
return out
}
@@ -12575,41 +12630,48 @@ var processReportHistoryEntryImplementors = []string{"ProcessReportHistoryEntry"
func (ec *executionContext) _ProcessReportHistoryEntry(ctx context.Context, sel ast.SelectionSet, obj *models.ProcessReportHistoryEntry) graphql.Marshaler {
fields := graphql.CollectFields(ec.OperationContext, sel, processReportHistoryEntryImplementors)
+
out := graphql.NewFieldSet(fields)
- var invalids uint32
+ deferred := make(map[string]*graphql.FieldSet)
for i, field := range fields {
switch field.Name {
case "__typename":
out.Values[i] = graphql.MarshalString("ProcessReportHistoryEntry")
case "created_at":
-
out.Values[i] = ec._ProcessReportHistoryEntry_created_at(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "prelude":
-
out.Values[i] = ec._ProcessReportHistoryEntry_prelude(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "log":
-
out.Values[i] = ec._ProcessReportHistoryEntry_log(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
default:
panic("unknown field " + strconv.Quote(field.Name))
}
}
- out.Dispatch()
- if invalids > 0 {
+ out.Dispatch(ctx)
+ if out.Invalids > 0 {
return graphql.Null
}
+
+ atomic.AddInt32(&ec.deferred, int32(len(deferred)))
+
+ for label, dfs := range deferred {
+ ec.processDeferredGroup(graphql.DeferredGroup{
+ Label: label,
+ Path: graphql.GetPath(ctx),
+ FieldSet: dfs,
+ Context: ctx,
+ })
+ }
+
return out
}
@@ -12617,34 +12679,43 @@ var processReportLogEntryImplementors = []string{"ProcessReportLogEntry"}
func (ec *executionContext) _ProcessReportLogEntry(ctx context.Context, sel ast.SelectionSet, obj *models.ProcessReportLogEntry) graphql.Marshaler {
fields := graphql.CollectFields(ec.OperationContext, sel, processReportLogEntryImplementors)
+
out := graphql.NewFieldSet(fields)
- var invalids uint32
+ deferred := make(map[string]*graphql.FieldSet)
for i, field := range fields {
switch field.Name {
case "__typename":
out.Values[i] = graphql.MarshalString("ProcessReportLogEntry")
case "timestamp":
-
out.Values[i] = ec._ProcessReportLogEntry_timestamp(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "data":
-
out.Values[i] = ec._ProcessReportLogEntry_data(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
default:
panic("unknown field " + strconv.Quote(field.Name))
}
}
- out.Dispatch()
- if invalids > 0 {
+ out.Dispatch(ctx)
+ if out.Invalids > 0 {
return graphql.Null
}
+
+ atomic.AddInt32(&ec.deferred, int32(len(deferred)))
+
+ for label, dfs := range deferred {
+ ec.processDeferredGroup(graphql.DeferredGroup{
+ Label: label,
+ Path: graphql.GetPath(ctx),
+ FieldSet: dfs,
+ Context: ctx,
+ })
+ }
+
return out
}
@@ -12652,83 +12723,78 @@ var processStateImplementors = []string{"ProcessState"}
func (ec *executionContext) _ProcessState(ctx context.Context, sel ast.SelectionSet, obj *models.ProcessState) graphql.Marshaler {
fields := graphql.CollectFields(ec.OperationContext, sel, processStateImplementors)
+
out := graphql.NewFieldSet(fields)
- var invalids uint32
+ deferred := make(map[string]*graphql.FieldSet)
for i, field := range fields {
switch field.Name {
case "__typename":
out.Values[i] = graphql.MarshalString("ProcessState")
case "order":
-
out.Values[i] = ec._ProcessState_order(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "state":
-
out.Values[i] = ec._ProcessState_state(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "runtime_seconds":
-
out.Values[i] = ec._ProcessState_runtime_seconds(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "reconnect_seconds":
-
out.Values[i] = ec._ProcessState_reconnect_seconds(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "last_logline":
-
out.Values[i] = ec._ProcessState_last_logline(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "progress":
-
out.Values[i] = ec._ProcessState_progress(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "memory_bytes":
-
out.Values[i] = ec._ProcessState_memory_bytes(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "cpu_usage":
-
out.Values[i] = ec._ProcessState_cpu_usage(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "command":
-
out.Values[i] = ec._ProcessState_command(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
default:
panic("unknown field " + strconv.Quote(field.Name))
}
}
- out.Dispatch()
- if invalids > 0 {
+ out.Dispatch(ctx)
+ if out.Invalids > 0 {
return graphql.Null
}
+
+ atomic.AddInt32(&ec.deferred, int32(len(deferred)))
+
+ for label, dfs := range deferred {
+ ec.processDeferredGroup(graphql.DeferredGroup{
+ Label: label,
+ Path: graphql.GetPath(ctx),
+ FieldSet: dfs,
+ Context: ctx,
+ })
+ }
+
return out
}
@@ -12736,104 +12802,93 @@ var progressImplementors = []string{"Progress"}
func (ec *executionContext) _Progress(ctx context.Context, sel ast.SelectionSet, obj *models.Progress) graphql.Marshaler {
fields := graphql.CollectFields(ec.OperationContext, sel, progressImplementors)
+
out := graphql.NewFieldSet(fields)
- var invalids uint32
+ deferred := make(map[string]*graphql.FieldSet)
for i, field := range fields {
switch field.Name {
case "__typename":
out.Values[i] = graphql.MarshalString("Progress")
case "input":
-
out.Values[i] = ec._Progress_input(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "output":
-
out.Values[i] = ec._Progress_output(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "frame":
-
out.Values[i] = ec._Progress_frame(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "packet":
-
out.Values[i] = ec._Progress_packet(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "fps":
-
out.Values[i] = ec._Progress_fps(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "q":
-
out.Values[i] = ec._Progress_q(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "size_kb":
-
out.Values[i] = ec._Progress_size_kb(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "time":
-
out.Values[i] = ec._Progress_time(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "bitrate_kbit":
-
out.Values[i] = ec._Progress_bitrate_kbit(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "speed":
-
out.Values[i] = ec._Progress_speed(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "drop":
-
out.Values[i] = ec._Progress_drop(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "dup":
-
out.Values[i] = ec._Progress_dup(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
default:
panic("unknown field " + strconv.Quote(field.Name))
}
}
- out.Dispatch()
- if invalids > 0 {
+ out.Dispatch(ctx)
+ if out.Invalids > 0 {
return graphql.Null
}
+
+ atomic.AddInt32(&ec.deferred, int32(len(deferred)))
+
+ for label, dfs := range deferred {
+ ec.processDeferredGroup(graphql.DeferredGroup{
+ Label: label,
+ Path: graphql.GetPath(ctx),
+ FieldSet: dfs,
+ Context: ctx,
+ })
+ }
+
return out
}
@@ -12841,171 +12896,140 @@ var progressIOImplementors = []string{"ProgressIO"}
func (ec *executionContext) _ProgressIO(ctx context.Context, sel ast.SelectionSet, obj *models.ProgressIo) graphql.Marshaler {
fields := graphql.CollectFields(ec.OperationContext, sel, progressIOImplementors)
+
out := graphql.NewFieldSet(fields)
- var invalids uint32
+ deferred := make(map[string]*graphql.FieldSet)
for i, field := range fields {
switch field.Name {
case "__typename":
out.Values[i] = graphql.MarshalString("ProgressIO")
case "id":
-
out.Values[i] = ec._ProgressIO_id(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "address":
-
out.Values[i] = ec._ProgressIO_address(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "index":
-
out.Values[i] = ec._ProgressIO_index(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "stream":
-
out.Values[i] = ec._ProgressIO_stream(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "format":
-
out.Values[i] = ec._ProgressIO_format(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "type":
-
out.Values[i] = ec._ProgressIO_type(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "codec":
-
out.Values[i] = ec._ProgressIO_codec(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "coder":
-
out.Values[i] = ec._ProgressIO_coder(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "frame":
-
out.Values[i] = ec._ProgressIO_frame(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "fps":
-
out.Values[i] = ec._ProgressIO_fps(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "packet":
-
out.Values[i] = ec._ProgressIO_packet(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "pps":
-
out.Values[i] = ec._ProgressIO_pps(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "size_kb":
-
out.Values[i] = ec._ProgressIO_size_kb(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "bitrate_kbit":
-
out.Values[i] = ec._ProgressIO_bitrate_kbit(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "pixfmt":
-
out.Values[i] = ec._ProgressIO_pixfmt(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "q":
-
out.Values[i] = ec._ProgressIO_q(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "width":
-
out.Values[i] = ec._ProgressIO_width(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "height":
-
out.Values[i] = ec._ProgressIO_height(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "sampling":
-
out.Values[i] = ec._ProgressIO_sampling(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "layout":
-
out.Values[i] = ec._ProgressIO_layout(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "channels":
-
out.Values[i] = ec._ProgressIO_channels(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "avstream":
-
out.Values[i] = ec._ProgressIO_avstream(ctx, field, obj)
-
default:
panic("unknown field " + strconv.Quote(field.Name))
}
}
- out.Dispatch()
- if invalids > 0 {
+ out.Dispatch(ctx)
+ if out.Invalids > 0 {
return graphql.Null
}
+
+ atomic.AddInt32(&ec.deferred, int32(len(deferred)))
+
+ for label, dfs := range deferred {
+ ec.processDeferredGroup(graphql.DeferredGroup{
+ Label: label,
+ Path: graphql.GetPath(ctx),
+ FieldSet: dfs,
+ Context: ctx,
+ })
+ }
+
return out
}
@@ -13018,7 +13042,7 @@ func (ec *executionContext) _Query(ctx context.Context, sel ast.SelectionSet) gr
})
out := graphql.NewFieldSet(fields)
- var invalids uint32
+ deferred := make(map[string]*graphql.FieldSet)
for i, field := range fields {
innerCtx := graphql.WithRootFieldContext(ctx, &graphql.RootFieldContext{
Object: field.Name,
@@ -13031,7 +13055,7 @@ func (ec *executionContext) _Query(ctx context.Context, sel ast.SelectionSet) gr
case "ping":
field := field
- innerFunc := func(ctx context.Context) (res graphql.Marshaler) {
+ innerFunc := func(ctx context.Context, fs *graphql.FieldSet) (res graphql.Marshaler) {
defer func() {
if r := recover(); r != nil {
ec.Error(ctx, ec.Recover(ctx, r))
@@ -13039,22 +13063,21 @@ func (ec *executionContext) _Query(ctx context.Context, sel ast.SelectionSet) gr
}()
res = ec._Query_ping(ctx, field)
if res == graphql.Null {
- atomic.AddUint32(&invalids, 1)
+ atomic.AddUint32(&fs.Invalids, 1)
}
return res
}
rrm := func(ctx context.Context) graphql.Marshaler {
- return ec.OperationContext.RootResolverMiddleware(ctx, innerFunc)
+ return ec.OperationContext.RootResolverMiddleware(ctx,
+ func(ctx context.Context) graphql.Marshaler { return innerFunc(ctx, out) })
}
- out.Concurrently(i, func() graphql.Marshaler {
- return rrm(innerCtx)
- })
+ out.Concurrently(i, func(ctx context.Context) graphql.Marshaler { return rrm(innerCtx) })
case "about":
field := field
- innerFunc := func(ctx context.Context) (res graphql.Marshaler) {
+ innerFunc := func(ctx context.Context, fs *graphql.FieldSet) (res graphql.Marshaler) {
defer func() {
if r := recover(); r != nil {
ec.Error(ctx, ec.Recover(ctx, r))
@@ -13065,16 +13088,15 @@ func (ec *executionContext) _Query(ctx context.Context, sel ast.SelectionSet) gr
}
rrm := func(ctx context.Context) graphql.Marshaler {
- return ec.OperationContext.RootResolverMiddleware(ctx, innerFunc)
+ return ec.OperationContext.RootResolverMiddleware(ctx,
+ func(ctx context.Context) graphql.Marshaler { return innerFunc(ctx, out) })
}
- out.Concurrently(i, func() graphql.Marshaler {
- return rrm(innerCtx)
- })
+ out.Concurrently(i, func(ctx context.Context) graphql.Marshaler { return rrm(innerCtx) })
case "log":
field := field
- innerFunc := func(ctx context.Context) (res graphql.Marshaler) {
+ innerFunc := func(ctx context.Context, fs *graphql.FieldSet) (res graphql.Marshaler) {
defer func() {
if r := recover(); r != nil {
ec.Error(ctx, ec.Recover(ctx, r))
@@ -13082,22 +13104,21 @@ func (ec *executionContext) _Query(ctx context.Context, sel ast.SelectionSet) gr
}()
res = ec._Query_log(ctx, field)
if res == graphql.Null {
- atomic.AddUint32(&invalids, 1)
+ atomic.AddUint32(&fs.Invalids, 1)
}
return res
}
rrm := func(ctx context.Context) graphql.Marshaler {
- return ec.OperationContext.RootResolverMiddleware(ctx, innerFunc)
+ return ec.OperationContext.RootResolverMiddleware(ctx,
+ func(ctx context.Context) graphql.Marshaler { return innerFunc(ctx, out) })
}
- out.Concurrently(i, func() graphql.Marshaler {
- return rrm(innerCtx)
- })
+ out.Concurrently(i, func(ctx context.Context) graphql.Marshaler { return rrm(innerCtx) })
case "metrics":
field := field
- innerFunc := func(ctx context.Context) (res graphql.Marshaler) {
+ innerFunc := func(ctx context.Context, fs *graphql.FieldSet) (res graphql.Marshaler) {
defer func() {
if r := recover(); r != nil {
ec.Error(ctx, ec.Recover(ctx, r))
@@ -13105,22 +13126,21 @@ func (ec *executionContext) _Query(ctx context.Context, sel ast.SelectionSet) gr
}()
res = ec._Query_metrics(ctx, field)
if res == graphql.Null {
- atomic.AddUint32(&invalids, 1)
+ atomic.AddUint32(&fs.Invalids, 1)
}
return res
}
rrm := func(ctx context.Context) graphql.Marshaler {
- return ec.OperationContext.RootResolverMiddleware(ctx, innerFunc)
+ return ec.OperationContext.RootResolverMiddleware(ctx,
+ func(ctx context.Context) graphql.Marshaler { return innerFunc(ctx, out) })
}
- out.Concurrently(i, func() graphql.Marshaler {
- return rrm(innerCtx)
- })
+ out.Concurrently(i, func(ctx context.Context) graphql.Marshaler { return rrm(innerCtx) })
case "playoutStatus":
field := field
- innerFunc := func(ctx context.Context) (res graphql.Marshaler) {
+ innerFunc := func(ctx context.Context, fs *graphql.FieldSet) (res graphql.Marshaler) {
defer func() {
if r := recover(); r != nil {
ec.Error(ctx, ec.Recover(ctx, r))
@@ -13131,16 +13151,15 @@ func (ec *executionContext) _Query(ctx context.Context, sel ast.SelectionSet) gr
}
rrm := func(ctx context.Context) graphql.Marshaler {
- return ec.OperationContext.RootResolverMiddleware(ctx, innerFunc)
+ return ec.OperationContext.RootResolverMiddleware(ctx,
+ func(ctx context.Context) graphql.Marshaler { return innerFunc(ctx, out) })
}
- out.Concurrently(i, func() graphql.Marshaler {
- return rrm(innerCtx)
- })
+ out.Concurrently(i, func(ctx context.Context) graphql.Marshaler { return rrm(innerCtx) })
case "processes":
field := field
- innerFunc := func(ctx context.Context) (res graphql.Marshaler) {
+ innerFunc := func(ctx context.Context, fs *graphql.FieldSet) (res graphql.Marshaler) {
defer func() {
if r := recover(); r != nil {
ec.Error(ctx, ec.Recover(ctx, r))
@@ -13148,22 +13167,21 @@ func (ec *executionContext) _Query(ctx context.Context, sel ast.SelectionSet) gr
}()
res = ec._Query_processes(ctx, field)
if res == graphql.Null {
- atomic.AddUint32(&invalids, 1)
+ atomic.AddUint32(&fs.Invalids, 1)
}
return res
}
rrm := func(ctx context.Context) graphql.Marshaler {
- return ec.OperationContext.RootResolverMiddleware(ctx, innerFunc)
+ return ec.OperationContext.RootResolverMiddleware(ctx,
+ func(ctx context.Context) graphql.Marshaler { return innerFunc(ctx, out) })
}
- out.Concurrently(i, func() graphql.Marshaler {
- return rrm(innerCtx)
- })
+ out.Concurrently(i, func(ctx context.Context) graphql.Marshaler { return rrm(innerCtx) })
case "process":
field := field
- innerFunc := func(ctx context.Context) (res graphql.Marshaler) {
+ innerFunc := func(ctx context.Context, fs *graphql.FieldSet) (res graphql.Marshaler) {
defer func() {
if r := recover(); r != nil {
ec.Error(ctx, ec.Recover(ctx, r))
@@ -13174,16 +13192,15 @@ func (ec *executionContext) _Query(ctx context.Context, sel ast.SelectionSet) gr
}
rrm := func(ctx context.Context) graphql.Marshaler {
- return ec.OperationContext.RootResolverMiddleware(ctx, innerFunc)
+ return ec.OperationContext.RootResolverMiddleware(ctx,
+ func(ctx context.Context) graphql.Marshaler { return innerFunc(ctx, out) })
}
- out.Concurrently(i, func() graphql.Marshaler {
- return rrm(innerCtx)
- })
+ out.Concurrently(i, func(ctx context.Context) graphql.Marshaler { return rrm(innerCtx) })
case "probe":
field := field
- innerFunc := func(ctx context.Context) (res graphql.Marshaler) {
+ innerFunc := func(ctx context.Context, fs *graphql.FieldSet) (res graphql.Marshaler) {
defer func() {
if r := recover(); r != nil {
ec.Error(ctx, ec.Recover(ctx, r))
@@ -13191,38 +13208,45 @@ func (ec *executionContext) _Query(ctx context.Context, sel ast.SelectionSet) gr
}()
res = ec._Query_probe(ctx, field)
if res == graphql.Null {
- atomic.AddUint32(&invalids, 1)
+ atomic.AddUint32(&fs.Invalids, 1)
}
return res
}
rrm := func(ctx context.Context) graphql.Marshaler {
- return ec.OperationContext.RootResolverMiddleware(ctx, innerFunc)
+ return ec.OperationContext.RootResolverMiddleware(ctx,
+ func(ctx context.Context) graphql.Marshaler { return innerFunc(ctx, out) })
}
- out.Concurrently(i, func() graphql.Marshaler {
- return rrm(innerCtx)
- })
+ out.Concurrently(i, func(ctx context.Context) graphql.Marshaler { return rrm(innerCtx) })
case "__type":
-
out.Values[i] = ec.OperationContext.RootResolverMiddleware(innerCtx, func(ctx context.Context) (res graphql.Marshaler) {
return ec._Query___type(ctx, field)
})
-
case "__schema":
-
out.Values[i] = ec.OperationContext.RootResolverMiddleware(innerCtx, func(ctx context.Context) (res graphql.Marshaler) {
return ec._Query___schema(ctx, field)
})
-
default:
panic("unknown field " + strconv.Quote(field.Name))
}
}
- out.Dispatch()
- if invalids > 0 {
+ out.Dispatch(ctx)
+ if out.Invalids > 0 {
return graphql.Null
}
+
+ atomic.AddInt32(&ec.deferred, int32(len(deferred)))
+
+ for label, dfs := range deferred {
+ ec.processDeferredGroup(graphql.DeferredGroup{
+ Label: label,
+ Path: graphql.GetPath(ctx),
+ FieldSet: dfs,
+ Context: ctx,
+ })
+ }
+
return out
}
@@ -13230,122 +13254,105 @@ var rawAVstreamImplementors = []string{"RawAVstream"}
func (ec *executionContext) _RawAVstream(ctx context.Context, sel ast.SelectionSet, obj *models.RawAVstream) graphql.Marshaler {
fields := graphql.CollectFields(ec.OperationContext, sel, rawAVstreamImplementors)
+
out := graphql.NewFieldSet(fields)
- var invalids uint32
+ deferred := make(map[string]*graphql.FieldSet)
for i, field := range fields {
switch field.Name {
case "__typename":
out.Values[i] = graphql.MarshalString("RawAVstream")
case "id":
-
out.Values[i] = ec._RawAVstream_id(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "url":
-
out.Values[i] = ec._RawAVstream_url(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "stream":
-
out.Values[i] = ec._RawAVstream_stream(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "queue":
-
out.Values[i] = ec._RawAVstream_queue(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "aqueue":
-
out.Values[i] = ec._RawAVstream_aqueue(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "dup":
-
out.Values[i] = ec._RawAVstream_dup(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "drop":
-
out.Values[i] = ec._RawAVstream_drop(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "enc":
-
out.Values[i] = ec._RawAVstream_enc(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "looping":
-
out.Values[i] = ec._RawAVstream_looping(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "duplicating":
-
out.Values[i] = ec._RawAVstream_duplicating(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "gop":
-
out.Values[i] = ec._RawAVstream_gop(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "debug":
-
out.Values[i] = ec._RawAVstream_debug(ctx, field, obj)
-
case "input":
-
out.Values[i] = ec._RawAVstream_input(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "output":
-
out.Values[i] = ec._RawAVstream_output(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "swap":
-
out.Values[i] = ec._RawAVstream_swap(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
default:
panic("unknown field " + strconv.Quote(field.Name))
}
}
- out.Dispatch()
- if invalids > 0 {
+ out.Dispatch(ctx)
+ if out.Invalids > 0 {
return graphql.Null
}
+
+ atomic.AddInt32(&ec.deferred, int32(len(deferred)))
+
+ for label, dfs := range deferred {
+ ec.processDeferredGroup(graphql.DeferredGroup{
+ Label: label,
+ Path: graphql.GetPath(ctx),
+ FieldSet: dfs,
+ Context: ctx,
+ })
+ }
+
return out
}
@@ -13353,48 +13360,53 @@ var rawAVstreamIOImplementors = []string{"RawAVstreamIO"}
func (ec *executionContext) _RawAVstreamIO(ctx context.Context, sel ast.SelectionSet, obj *models.RawAVstreamIo) graphql.Marshaler {
fields := graphql.CollectFields(ec.OperationContext, sel, rawAVstreamIOImplementors)
+
out := graphql.NewFieldSet(fields)
- var invalids uint32
+ deferred := make(map[string]*graphql.FieldSet)
for i, field := range fields {
switch field.Name {
case "__typename":
out.Values[i] = graphql.MarshalString("RawAVstreamIO")
case "state":
-
out.Values[i] = ec._RawAVstreamIO_state(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "packet":
-
out.Values[i] = ec._RawAVstreamIO_packet(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "time":
-
out.Values[i] = ec._RawAVstreamIO_time(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "size_kb":
-
out.Values[i] = ec._RawAVstreamIO_size_kb(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
default:
panic("unknown field " + strconv.Quote(field.Name))
}
}
- out.Dispatch()
- if invalids > 0 {
+ out.Dispatch(ctx)
+ if out.Invalids > 0 {
return graphql.Null
}
+
+ atomic.AddInt32(&ec.deferred, int32(len(deferred)))
+
+ for label, dfs := range deferred {
+ ec.processDeferredGroup(graphql.DeferredGroup{
+ Label: label,
+ Path: graphql.GetPath(ctx),
+ FieldSet: dfs,
+ Context: ctx,
+ })
+ }
+
return out
}
@@ -13402,48 +13414,53 @@ var rawAVstreamSwapImplementors = []string{"RawAVstreamSwap"}
func (ec *executionContext) _RawAVstreamSwap(ctx context.Context, sel ast.SelectionSet, obj *models.RawAVstreamSwap) graphql.Marshaler {
fields := graphql.CollectFields(ec.OperationContext, sel, rawAVstreamSwapImplementors)
+
out := graphql.NewFieldSet(fields)
- var invalids uint32
+ deferred := make(map[string]*graphql.FieldSet)
for i, field := range fields {
switch field.Name {
case "__typename":
out.Values[i] = graphql.MarshalString("RawAVstreamSwap")
case "url":
-
out.Values[i] = ec._RawAVstreamSwap_url(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "status":
-
out.Values[i] = ec._RawAVstreamSwap_status(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "lasturl":
-
out.Values[i] = ec._RawAVstreamSwap_lasturl(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "lasterror":
-
out.Values[i] = ec._RawAVstreamSwap_lasterror(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
default:
panic("unknown field " + strconv.Quote(field.Name))
}
}
- out.Dispatch()
- if invalids > 0 {
+ out.Dispatch(ctx)
+ if out.Invalids > 0 {
return graphql.Null
}
+
+ atomic.AddInt32(&ec.deferred, int32(len(deferred)))
+
+ for label, dfs := range deferred {
+ ec.processDeferredGroup(graphql.DeferredGroup{
+ Label: label,
+ Path: graphql.GetPath(ctx),
+ FieldSet: dfs,
+ Context: ctx,
+ })
+ }
+
return out
}
@@ -13451,52 +13468,55 @@ var __DirectiveImplementors = []string{"__Directive"}
func (ec *executionContext) ___Directive(ctx context.Context, sel ast.SelectionSet, obj *introspection.Directive) graphql.Marshaler {
fields := graphql.CollectFields(ec.OperationContext, sel, __DirectiveImplementors)
+
out := graphql.NewFieldSet(fields)
- var invalids uint32
+ deferred := make(map[string]*graphql.FieldSet)
for i, field := range fields {
switch field.Name {
case "__typename":
out.Values[i] = graphql.MarshalString("__Directive")
case "name":
-
out.Values[i] = ec.___Directive_name(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "description":
-
out.Values[i] = ec.___Directive_description(ctx, field, obj)
-
case "locations":
-
out.Values[i] = ec.___Directive_locations(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "args":
-
out.Values[i] = ec.___Directive_args(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "isRepeatable":
-
out.Values[i] = ec.___Directive_isRepeatable(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
default:
panic("unknown field " + strconv.Quote(field.Name))
}
}
- out.Dispatch()
- if invalids > 0 {
+ out.Dispatch(ctx)
+ if out.Invalids > 0 {
return graphql.Null
}
+
+ atomic.AddInt32(&ec.deferred, int32(len(deferred)))
+
+ for label, dfs := range deferred {
+ ec.processDeferredGroup(graphql.DeferredGroup{
+ Label: label,
+ Path: graphql.GetPath(ctx),
+ FieldSet: dfs,
+ Context: ctx,
+ })
+ }
+
return out
}
@@ -13504,42 +13524,47 @@ var __EnumValueImplementors = []string{"__EnumValue"}
func (ec *executionContext) ___EnumValue(ctx context.Context, sel ast.SelectionSet, obj *introspection.EnumValue) graphql.Marshaler {
fields := graphql.CollectFields(ec.OperationContext, sel, __EnumValueImplementors)
+
out := graphql.NewFieldSet(fields)
- var invalids uint32
+ deferred := make(map[string]*graphql.FieldSet)
for i, field := range fields {
switch field.Name {
case "__typename":
out.Values[i] = graphql.MarshalString("__EnumValue")
case "name":
-
out.Values[i] = ec.___EnumValue_name(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "description":
-
out.Values[i] = ec.___EnumValue_description(ctx, field, obj)
-
case "isDeprecated":
-
out.Values[i] = ec.___EnumValue_isDeprecated(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "deprecationReason":
-
out.Values[i] = ec.___EnumValue_deprecationReason(ctx, field, obj)
-
default:
panic("unknown field " + strconv.Quote(field.Name))
}
}
- out.Dispatch()
- if invalids > 0 {
+ out.Dispatch(ctx)
+ if out.Invalids > 0 {
return graphql.Null
}
+
+ atomic.AddInt32(&ec.deferred, int32(len(deferred)))
+
+ for label, dfs := range deferred {
+ ec.processDeferredGroup(graphql.DeferredGroup{
+ Label: label,
+ Path: graphql.GetPath(ctx),
+ FieldSet: dfs,
+ Context: ctx,
+ })
+ }
+
return out
}
@@ -13547,56 +13572,57 @@ var __FieldImplementors = []string{"__Field"}
func (ec *executionContext) ___Field(ctx context.Context, sel ast.SelectionSet, obj *introspection.Field) graphql.Marshaler {
fields := graphql.CollectFields(ec.OperationContext, sel, __FieldImplementors)
+
out := graphql.NewFieldSet(fields)
- var invalids uint32
+ deferred := make(map[string]*graphql.FieldSet)
for i, field := range fields {
switch field.Name {
case "__typename":
out.Values[i] = graphql.MarshalString("__Field")
case "name":
-
out.Values[i] = ec.___Field_name(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "description":
-
out.Values[i] = ec.___Field_description(ctx, field, obj)
-
case "args":
-
out.Values[i] = ec.___Field_args(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "type":
-
out.Values[i] = ec.___Field_type(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "isDeprecated":
-
out.Values[i] = ec.___Field_isDeprecated(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "deprecationReason":
-
out.Values[i] = ec.___Field_deprecationReason(ctx, field, obj)
-
default:
panic("unknown field " + strconv.Quote(field.Name))
}
}
- out.Dispatch()
- if invalids > 0 {
+ out.Dispatch(ctx)
+ if out.Invalids > 0 {
return graphql.Null
}
+
+ atomic.AddInt32(&ec.deferred, int32(len(deferred)))
+
+ for label, dfs := range deferred {
+ ec.processDeferredGroup(graphql.DeferredGroup{
+ Label: label,
+ Path: graphql.GetPath(ctx),
+ FieldSet: dfs,
+ Context: ctx,
+ })
+ }
+
return out
}
@@ -13604,42 +13630,47 @@ var __InputValueImplementors = []string{"__InputValue"}
func (ec *executionContext) ___InputValue(ctx context.Context, sel ast.SelectionSet, obj *introspection.InputValue) graphql.Marshaler {
fields := graphql.CollectFields(ec.OperationContext, sel, __InputValueImplementors)
+
out := graphql.NewFieldSet(fields)
- var invalids uint32
+ deferred := make(map[string]*graphql.FieldSet)
for i, field := range fields {
switch field.Name {
case "__typename":
out.Values[i] = graphql.MarshalString("__InputValue")
case "name":
-
out.Values[i] = ec.___InputValue_name(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "description":
-
out.Values[i] = ec.___InputValue_description(ctx, field, obj)
-
case "type":
-
out.Values[i] = ec.___InputValue_type(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "defaultValue":
-
out.Values[i] = ec.___InputValue_defaultValue(ctx, field, obj)
-
default:
panic("unknown field " + strconv.Quote(field.Name))
}
}
- out.Dispatch()
- if invalids > 0 {
+ out.Dispatch(ctx)
+ if out.Invalids > 0 {
return graphql.Null
}
+
+ atomic.AddInt32(&ec.deferred, int32(len(deferred)))
+
+ for label, dfs := range deferred {
+ ec.processDeferredGroup(graphql.DeferredGroup{
+ Label: label,
+ Path: graphql.GetPath(ctx),
+ FieldSet: dfs,
+ Context: ctx,
+ })
+ }
+
return out
}
@@ -13647,53 +13678,54 @@ var __SchemaImplementors = []string{"__Schema"}
func (ec *executionContext) ___Schema(ctx context.Context, sel ast.SelectionSet, obj *introspection.Schema) graphql.Marshaler {
fields := graphql.CollectFields(ec.OperationContext, sel, __SchemaImplementors)
+
out := graphql.NewFieldSet(fields)
- var invalids uint32
+ deferred := make(map[string]*graphql.FieldSet)
for i, field := range fields {
switch field.Name {
case "__typename":
out.Values[i] = graphql.MarshalString("__Schema")
case "description":
-
out.Values[i] = ec.___Schema_description(ctx, field, obj)
-
case "types":
-
out.Values[i] = ec.___Schema_types(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "queryType":
-
out.Values[i] = ec.___Schema_queryType(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "mutationType":
-
out.Values[i] = ec.___Schema_mutationType(ctx, field, obj)
-
case "subscriptionType":
-
out.Values[i] = ec.___Schema_subscriptionType(ctx, field, obj)
-
case "directives":
-
out.Values[i] = ec.___Schema_directives(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
default:
panic("unknown field " + strconv.Quote(field.Name))
}
}
- out.Dispatch()
- if invalids > 0 {
+ out.Dispatch(ctx)
+ if out.Invalids > 0 {
return graphql.Null
}
+
+ atomic.AddInt32(&ec.deferred, int32(len(deferred)))
+
+ for label, dfs := range deferred {
+ ec.processDeferredGroup(graphql.DeferredGroup{
+ Label: label,
+ Path: graphql.GetPath(ctx),
+ FieldSet: dfs,
+ Context: ctx,
+ })
+ }
+
return out
}
@@ -13701,63 +13733,56 @@ var __TypeImplementors = []string{"__Type"}
func (ec *executionContext) ___Type(ctx context.Context, sel ast.SelectionSet, obj *introspection.Type) graphql.Marshaler {
fields := graphql.CollectFields(ec.OperationContext, sel, __TypeImplementors)
+
out := graphql.NewFieldSet(fields)
- var invalids uint32
+ deferred := make(map[string]*graphql.FieldSet)
for i, field := range fields {
switch field.Name {
case "__typename":
out.Values[i] = graphql.MarshalString("__Type")
case "kind":
-
out.Values[i] = ec.___Type_kind(ctx, field, obj)
-
if out.Values[i] == graphql.Null {
- invalids++
+ out.Invalids++
}
case "name":
-
out.Values[i] = ec.___Type_name(ctx, field, obj)
-
case "description":
-
out.Values[i] = ec.___Type_description(ctx, field, obj)
-
case "fields":
-
out.Values[i] = ec.___Type_fields(ctx, field, obj)
-
case "interfaces":
-
out.Values[i] = ec.___Type_interfaces(ctx, field, obj)
-
case "possibleTypes":
-
out.Values[i] = ec.___Type_possibleTypes(ctx, field, obj)
-
case "enumValues":
-
out.Values[i] = ec.___Type_enumValues(ctx, field, obj)
-
case "inputFields":
-
out.Values[i] = ec.___Type_inputFields(ctx, field, obj)
-
case "ofType":
-
out.Values[i] = ec.___Type_ofType(ctx, field, obj)
-
case "specifiedByURL":
-
out.Values[i] = ec.___Type_specifiedByURL(ctx, field, obj)
-
default:
panic("unknown field " + strconv.Quote(field.Name))
}
}
- out.Dispatch()
- if invalids > 0 {
+ out.Dispatch(ctx)
+ if out.Invalids > 0 {
return graphql.Null
}
+
+ atomic.AddInt32(&ec.deferred, int32(len(deferred)))
+
+ for label, dfs := range deferred {
+ ec.processDeferredGroup(graphql.DeferredGroup{
+ Label: label,
+ Path: graphql.GetPath(ctx),
+ FieldSet: dfs,
+ Context: ctx,
+ })
+ }
+
return out
}
diff --git a/http/graph/models/models_gen.go b/http/graph/models/models_gen.go
index 56bb286b..64fae4f7 100644
--- a/http/graph/models/models_gen.go
+++ b/http/graph/models/models_gen.go
@@ -58,24 +58,24 @@ type AboutVersion struct {
type Metric struct {
Name string `json:"name"`
- Labels map[string]interface{} `json:"labels"`
+ Labels map[string]interface{} `json:"labels,omitempty"`
Values []*scalars.MetricsResponseValue `json:"values"`
}
type MetricInput struct {
Name string `json:"name"`
- Labels map[string]interface{} `json:"labels"`
+ Labels map[string]interface{} `json:"labels,omitempty"`
}
type Metrics struct {
- TimerangeSeconds *int `json:"timerange_seconds"`
- IntervalSeconds *int `json:"interval_seconds"`
+ TimerangeSeconds *int `json:"timerange_seconds,omitempty"`
+ IntervalSeconds *int `json:"interval_seconds,omitempty"`
Metrics []*Metric `json:"metrics"`
}
type MetricsInput struct {
- TimerangeSeconds *int `json:"timerange_seconds"`
- IntervalSeconds *int `json:"interval_seconds"`
+ TimerangeSeconds *int `json:"timerange_seconds,omitempty"`
+ IntervalSeconds *int `json:"interval_seconds,omitempty"`
Metrics []*MetricInput `json:"metrics"`
}
@@ -113,7 +113,7 @@ type Process struct {
Config *ProcessConfig `json:"config"`
State *ProcessState `json:"state"`
Report *ProcessReport `json:"report"`
- Metadata map[string]interface{} `json:"metadata"`
+ Metadata map[string]interface{} `json:"metadata,omitempty"`
}
type ProcessConfig struct {
@@ -257,7 +257,7 @@ type ProgressIo struct {
Sampling scalars.Uint64 `json:"sampling"`
Layout string `json:"layout"`
Channels scalars.Uint64 `json:"channels"`
- Avstream *AVStream `json:"avstream"`
+ Avstream *AVStream `json:"avstream,omitempty"`
}
type RawAVstream struct {
@@ -272,7 +272,7 @@ type RawAVstream struct {
Looping bool `json:"looping"`
Duplicating bool `json:"duplicating"`
Gop string `json:"gop"`
- Debug interface{} `json:"debug"`
+ Debug interface{} `json:"debug,omitempty"`
Input *RawAVstreamIo `json:"input"`
Output *RawAVstreamIo `json:"output"`
Swap *RawAVstreamSwap `json:"swap"`
@@ -341,17 +341,17 @@ type State string
const (
StateRunning State = "RUNNING"
- StateIDLe State = "IDLE"
+ StateIdle State = "IDLE"
)
var AllState = []State{
StateRunning,
- StateIDLe,
+ StateIdle,
}
func (e State) IsValid() bool {
switch e {
- case StateRunning, StateIDLe:
+ case StateRunning, StateIdle:
return true
}
return false
diff --git a/http/graph/resolver/about.resolvers.go b/http/graph/resolver/about.resolvers.go
index d62771b5..266c7fab 100644
--- a/http/graph/resolver/about.resolvers.go
+++ b/http/graph/resolver/about.resolvers.go
@@ -2,6 +2,7 @@ package resolver
// This file will be automatically regenerated based on the schema, any resolver implementations
// will be copied through when generating and any unknown code will be moved to the end.
+// Code generated by github.com/99designs/gqlgen version v0.17.33
import (
"context"
diff --git a/http/graph/resolver/log.resolvers.go b/http/graph/resolver/log.resolvers.go
index 18aa2281..2e29633b 100644
--- a/http/graph/resolver/log.resolvers.go
+++ b/http/graph/resolver/log.resolvers.go
@@ -2,6 +2,7 @@ package resolver
// This file will be automatically regenerated based on the schema, any resolver implementations
// will be copied through when generating and any unknown code will be moved to the end.
+// Code generated by github.com/99designs/gqlgen version v0.17.33
import (
"context"
diff --git a/http/graph/resolver/metrics.resolvers.go b/http/graph/resolver/metrics.resolvers.go
index e9ae7d3e..704ba664 100644
--- a/http/graph/resolver/metrics.resolvers.go
+++ b/http/graph/resolver/metrics.resolvers.go
@@ -2,6 +2,7 @@ package resolver
// This file will be automatically regenerated based on the schema, any resolver implementations
// will be copied through when generating and any unknown code will be moved to the end.
+// Code generated by github.com/99designs/gqlgen version v0.17.33
import (
"context"
diff --git a/http/graph/resolver/playout.resolvers.go b/http/graph/resolver/playout.resolvers.go
index 6c93ed62..d0b77740 100644
--- a/http/graph/resolver/playout.resolvers.go
+++ b/http/graph/resolver/playout.resolvers.go
@@ -2,6 +2,7 @@ package resolver
// This file will be automatically regenerated based on the schema, any resolver implementations
// will be copied through when generating and any unknown code will be moved to the end.
+// Code generated by github.com/99designs/gqlgen version v0.17.33
import (
"context"
diff --git a/http/graph/resolver/process.resolvers.go b/http/graph/resolver/process.resolvers.go
index 2691eeaa..e71b51a0 100644
--- a/http/graph/resolver/process.resolvers.go
+++ b/http/graph/resolver/process.resolvers.go
@@ -2,6 +2,7 @@ package resolver
// This file will be automatically regenerated based on the schema, any resolver implementations
// will be copied through when generating and any unknown code will be moved to the end.
+// Code generated by github.com/99designs/gqlgen version v0.17.33
import (
"context"
diff --git a/http/graph/resolver/schema.resolvers.go b/http/graph/resolver/schema.resolvers.go
index 89a0b922..bb30e9e8 100644
--- a/http/graph/resolver/schema.resolvers.go
+++ b/http/graph/resolver/schema.resolvers.go
@@ -2,6 +2,7 @@ package resolver
// This file will be automatically regenerated based on the schema, any resolver implementations
// will be copied through when generating and any unknown code will be moved to the end.
+// Code generated by github.com/99designs/gqlgen version v0.17.33
import (
"context"
diff --git a/iam/identity/identity.go b/iam/identity/identity.go
index 4fadf4e7..57ba5710 100644
--- a/iam/identity/identity.go
+++ b/iam/identity/identity.go
@@ -50,7 +50,7 @@ func (u *User) validate() error {
return fmt.Errorf("a name is required")
}
- chars := `A-Za-z0-9:_-`
+ chars := `A-Za-z0-9._-`
re := regexp.MustCompile(`[^` + chars + `]`)
if re.MatchString(u.Name) {
diff --git a/rtmp/rtmp.go b/rtmp/rtmp.go
index cfdcc7d2..be349b16 100644
--- a/rtmp/rtmp.go
+++ b/rtmp/rtmp.go
@@ -196,13 +196,13 @@ func (s *server) Channels() []string {
return channels
}
-func (s *server) log(who, what, action, path, message string, client net.Addr) {
+func (s *server) log(who, handler, action, resource, message string, client net.Addr) {
s.logger.Info().WithFields(log.Fields{
- "who": who,
- "what": what,
- "action": action,
- "path": path,
- "client": client.String(),
+ "who": who,
+ "handler": handler,
+ "action": action,
+ "resource": resource,
+ "client": client.String(),
}).Log(message)
}
@@ -258,7 +258,7 @@ func (s *server) handlePlay(conn *rtmp.Conn) {
identity, err := s.findIdentityFromStreamKey(token)
if err != nil {
s.logger.Debug().WithError(err).Log("invalid streamkey")
- s.log(identity, "PLAY", "FORBIDDEN", playpath, "invalid streamkey ("+token+")", remote)
+ s.log("", "PLAY", "FORBIDDEN", playpath, "invalid streamkey ("+token+")", remote)
return
}
@@ -476,13 +476,13 @@ func (s *server) findIdentityFromStreamKey(key string) (string, error) {
var token string
- elements := strings.Split(key, ":")
- if len(elements) == 1 {
+ before, after, found := strings.Cut(key, ":")
+ if !found {
identity = s.iam.GetDefaultVerifier()
- token = elements[0]
+ token = before
} else {
- identity, err = s.iam.GetVerifier(elements[0])
- token = elements[1]
+ identity, err = s.iam.GetVerifier(before)
+ token = after
}
if err != nil {
@@ -490,7 +490,13 @@ func (s *server) findIdentityFromStreamKey(key string) (string, error) {
}
if ok, err := identity.VerifyServiceToken(token); !ok {
- return "$anon", fmt.Errorf("invalid token: %w", err)
+ if err != nil {
+ err = fmt.Errorf("invalid token: %w", err)
+ } else {
+ err = fmt.Errorf("invalid token")
+ }
+
+ return "$anon", err
}
return identity.Name(), nil
diff --git a/srt/srt.go b/srt/srt.go
index ad19b42f..78a69394 100644
--- a/srt/srt.go
+++ b/srt/srt.go
@@ -268,10 +268,11 @@ func (s *server) srtlogListener(ctx context.Context) {
}
}
-func (s *server) log(handler, action, resource, message string, client net.Addr) {
+func (s *server) log(who, handler, action, resource, message string, client net.Addr) {
s.logger.Info().WithFields(log.Fields{
+ "who": who,
"handler": handler,
- "status": action,
+ "action": action,
"resource": resource,
"client": client.String(),
}).Log(message)
@@ -282,14 +283,19 @@ func (s *server) handleConnect(req srt.ConnRequest) srt.ConnType {
client := req.RemoteAddr()
streamId := req.StreamId()
+ if req.Version() != 5 {
+ s.log("", "CONNECT", "INVALID", streamId, "unsupported version", client)
+ return srt.REJECT
+ }
+
si, err := url.ParseStreamId(streamId)
if err != nil {
- s.log("CONNECT", "INVALID", "", err.Error(), client)
+ s.log("", "CONNECT", "INVALID", streamId, err.Error(), client)
return srt.REJECT
}
if len(si.Resource) == 0 {
- s.log("CONNECT", "INVALID", "", "stream resource not provided", client)
+ s.log("", "CONNECT", "INVALID", streamId, "stream resource not provided", client)
return srt.REJECT
}
@@ -298,23 +304,23 @@ func (s *server) handleConnect(req srt.ConnRequest) srt.ConnType {
} else if si.Mode == "request" {
mode = srt.SUBSCRIBE
} else {
- s.log("CONNECT", "INVALID", si.Resource, "invalid connection mode", client)
+ s.log("", "CONNECT", "INVALID", si.Resource, "invalid connection mode", client)
return srt.REJECT
}
if len(s.passphrase) != 0 {
if !req.IsEncrypted() {
- s.log("CONNECT", "FORBIDDEN", si.Resource, "connection has to be encrypted", client)
+ s.log("", "CONNECT", "FORBIDDEN", si.Resource, "connection has to be encrypted", client)
return srt.REJECT
}
if err := req.SetPassphrase(s.passphrase); err != nil {
- s.log("CONNECT", "FORBIDDEN", si.Resource, err.Error(), client)
+ s.log("", "CONNECT", "FORBIDDEN", si.Resource, err.Error(), client)
return srt.REJECT
}
} else {
if req.IsEncrypted() {
- s.log("CONNECT", "INVALID", si.Resource, "connection must not be encrypted", client)
+ s.log("", "CONNECT", "INVALID", si.Resource, "connection must not be encrypted", client)
return srt.REJECT
}
}
@@ -322,7 +328,7 @@ func (s *server) handleConnect(req srt.ConnRequest) srt.ConnType {
identity, err := s.findIdentityFromToken(si.Token)
if err != nil {
s.logger.Debug().WithError(err).Log("invalid token")
- s.log("CONNECT", "FORBIDDEN", si.Resource, "invalid token", client)
+ s.log(identity, "CONNECT", "FORBIDDEN", si.Resource, "invalid token", client)
return srt.REJECT
}
@@ -334,7 +340,7 @@ func (s *server) handleConnect(req srt.ConnRequest) srt.ConnType {
}
if !s.iam.Enforce(identity, domain, resource, action) {
- s.log("CONNECT", "FORBIDDEN", si.Resource, "access denied", client)
+ s.log(identity, "CONNECT", "FORBIDDEN", si.Resource, "access denied", client)
return srt.REJECT
}
@@ -350,6 +356,7 @@ func (s *server) publish(conn srt.Conn, isProxy bool) error {
client := conn.RemoteAddr()
si, _ := url.ParseStreamId(streamId)
+ identity, _ := s.findIdentityFromToken(si.Token)
// Look for the stream
s.lock.Lock()
@@ -363,15 +370,15 @@ func (s *server) publish(conn srt.Conn, isProxy bool) error {
s.lock.Unlock()
if ch == nil {
- s.log("PUBLISH", "CONFLICT", si.Resource, "already publishing", client)
+ s.log(identity, "PUBLISH", "CONFLICT", si.Resource, "already publishing", client)
conn.Close()
return fmt.Errorf("already publishing this resource")
}
- s.log("PUBLISH", "START", si.Resource, "", client)
+ s.log(identity, "PUBLISH", "START", si.Resource, "", client)
// Blocks until connection closes
- ch.pubsub.Publish(conn)
+ err := ch.pubsub.Publish(conn)
s.lock.Lock()
delete(s.channels, si.Resource)
@@ -379,7 +386,7 @@ func (s *server) publish(conn srt.Conn, isProxy bool) error {
ch.Close()
- s.log("PUBLISH", "STOP", si.Resource, "", client)
+ s.log(identity, "PUBLISH", "STOP", si.Resource, err.Error(), client)
conn.Close()
@@ -393,6 +400,7 @@ func (s *server) handleSubscribe(conn srt.Conn) {
client := conn.RemoteAddr()
si, _ := url.ParseStreamId(streamId)
+ identity, _ := s.findIdentityFromToken(si.Token)
// Look for the stream locally
s.lock.RLock()
@@ -403,7 +411,7 @@ func (s *server) handleSubscribe(conn srt.Conn) {
// Check in the cluster for the stream and proxy it
srturl, err := s.proxy.GetURL("srt", si.Resource)
if err != nil {
- s.log("SUBSCRIBE", "NOTFOUND", si.Resource, "no publisher for this resource found", client)
+ s.log(identity, "PLAY", "NOTFOUND", si.Resource, "no publisher for this resource found", client)
return
}
@@ -412,16 +420,16 @@ func (s *server) handleSubscribe(conn srt.Conn) {
config := srt.DefaultConfig()
config.StreamId = streamId
config.Latency = 200 * time.Millisecond // This might be a value obtained from the cluster
- host, err := config.UnmarshalURL(peerurl)
+ host, port, err := config.UnmarshalURL(peerurl)
if err != nil {
s.logger.Error().WithField("address", peerurl).WithError(err).Log("Parsing proxy address failed")
- s.log("SUBSCRIBE", "NOTFOUND", si.Resource, "no publisher for this resource found", client)
+ s.log(identity, "PLAY", "NOTFOUND", si.Resource, "no publisher for this resource found", client)
return
}
- src, err := srt.Dial("srt", host, config)
+ src, err := srt.Dial("srt", host+":"+port, config)
if err != nil {
s.logger.Error().WithField("address", peerurl).WithError(err).Log("Proxying address failed")
- s.log("SUBSCRIBE", "NOTFOUND", si.Resource, "no publisher for this resource found", client)
+ s.log(identity, "PLAY", "NOTFOUND", si.Resource, "no publisher for this resource found", client)
return
}
@@ -429,13 +437,13 @@ func (s *server) handleSubscribe(conn srt.Conn) {
wg.Add(1)
go func() {
- s.log("SUBSCRIBE", "PROXYSTART", peerurl, "", client)
+ s.log(identity, "PLAY", "PROXYSTART", peerurl, "", client)
wg.Done()
err := s.publish(src, true)
if err != nil {
s.logger.Error().WithField("address", srturl).WithError(err).Log("Proxying address failed")
}
- s.log("SUBSCRIBE", "PROXYPUBLISHSTOP", peerurl, "", client)
+ s.log(identity, "PLAY", "PROXYSTOP", peerurl, "", client)
}()
// Wait for the goroutine to start
@@ -463,14 +471,14 @@ func (s *server) handleSubscribe(conn srt.Conn) {
}
if ch != nil {
- s.log("SUBSCRIBE", "START", si.Resource, "", client)
+ s.log(identity, "PLAY", "START", si.Resource, "", client)
id := ch.AddSubscriber(conn, si.Resource)
// Blocks until connection closes
- ch.pubsub.Subscribe(conn)
+ err := ch.pubsub.Subscribe(conn)
- s.log("SUBSCRIBE", "STOP", si.Resource, "", client)
+ s.log(identity, "PLAY", "STOP", si.Resource, err.Error(), client)
ch.RemoveSubscriber(id)
}
@@ -486,13 +494,13 @@ func (s *server) findIdentityFromToken(key string) (string, error) {
var token string
- elements := strings.Split(key, ":")
- if len(elements) == 1 {
+ before, after, found := strings.Cut(key, ":")
+ if !found {
identity = s.iam.GetDefaultVerifier()
- token = elements[0]
+ token = before
} else {
- identity, err = s.iam.GetVerifier(elements[0])
- token = elements[1]
+ identity, err = s.iam.GetVerifier(before)
+ token = after
}
if err != nil {
@@ -500,7 +508,13 @@ func (s *server) findIdentityFromToken(key string) (string, error) {
}
if ok, err := identity.VerifyServiceToken(token); !ok {
- return "$anon", fmt.Errorf("invalid token: %w", err)
+ if err != nil {
+ err = fmt.Errorf("invalid token: %w", err)
+ } else {
+ err = fmt.Errorf("invalid token")
+ }
+
+ return "$anon", err
}
return identity.Name(), nil
diff --git a/vendor/github.com/99designs/gqlgen/.golangci.yml b/vendor/github.com/99designs/gqlgen/.golangci.yml
index 21099b69..5966bf2c 100644
--- a/vendor/github.com/99designs/gqlgen/.golangci.yml
+++ b/vendor/github.com/99designs/gqlgen/.golangci.yml
@@ -11,8 +11,6 @@ linters:
disable-all: true
enable:
- bodyclose
- - deadcode
- - depguard
- dupl
- errcheck
- gocritic
@@ -25,11 +23,9 @@ linters:
- nakedret
- prealloc
- staticcheck
- - structcheck
- typecheck
- unconvert
- unused
- - varcheck
issues:
exclude-rules:
diff --git a/vendor/github.com/99designs/gqlgen/CHANGELOG.md b/vendor/github.com/99designs/gqlgen/CHANGELOG.md
index ee9cb3d8..73c93188 100644
--- a/vendor/github.com/99designs/gqlgen/CHANGELOG.md
+++ b/vendor/github.com/99designs/gqlgen/CHANGELOG.md
@@ -5,10 +5,186 @@ The format is based on [Keep a Changelog](https://keepachangelog.com/en/1.0.0/),
and this project adheres to [Semantic Versioning](https://semver.org/spec/v2.0.0.html).
-## [Unreleased](https://github.com/99designs/gqlgen/compare/v0.17.30...HEAD)
+## [Unreleased](https://github.com/99designs/gqlgen/compare/v0.17.32...HEAD)
+
+## [v0.17.32](https://github.com/99designs/gqlgen/compare/v0.17.31...v0.17.32) - 2023-06-06
+- 3a81a78b release v0.17.32
+
+- dbb61174 Added unit tests for defer (#2657)
+
+5c19c841 Addressing few issues in defer feature (#2656)
+
+And fixed hasNext to only appear in the payload when there is deferred usage
+
+* Regenerate
+
+* Use go 1.18 compatible atomic operations
+
+* Regenerate
+
+
+
+8e295024 Update extra fields type definition and plus docs about the feature (#2655)
+
+* Update extra fields type definition and plus docs about the feature
+
+* Update docs
+
+
+
+adf5da27 Make usage of omitempty tag optional (#2649)
+
+* Make usage of omitempty tag optional
+
+* adding probably good enough test
+
+* some kinda docs
+
+* lintersssssssssssssssssssssssssssss
+
+* removing unnecessary fields from config
+
+
+
+- 7ab33176 Extra fields (#2638)
+
+22deb8bd allow binding a GraphQL `Any` field to a struct method returning `*any` (#2644)
+
+* allow binding GQL `Any` field to struct method returning `*any`
+
+* add singlefile tests for binding to `*any` case
+
+* add followschema tests for binding to `*any` case
+
+* make ptr_to_any binding tests follow binding conventions better
+
+
+
+c313bf3d `[@defer](https://github.com/defer)` initial support (#2642)
+
+* support returning errors with deferred fragments.
+
+
+* update integration tests.
+
+* fix gotpl indent and pass the correct context to deferred .Dispatch().
+
+* Added hasNext in the tests
+
+* Added back root_.gotpl
+
+* Regenerate
+
+* Regenerate recursively
+
+* Updated schema-expected.graphql
+
+
+* Fixed starwars_test.go
+
+* Cleanup
+
+* Add graphql response hasnext omitempty and update tests to match
+
+
+---------
+
+
+
+4d945da2 feat(federation): update Apollo Federation v2 definitions (#2635)
+
+* feat(federation): update Apollo Federation v2 definitions
+
+Fix Apollo Federation v2 directive definitions:
+* `_FieldSet` was renamed `FieldSet`
+
+
+* regenerate examples
+
+
+
+- 9796f91d Generate entity resolvers for interfaces with [@key](https://github.com/key) defined (#2634)
+
+33fdd1b5 fix enum capitalization (#2630)
+
+* fix enum capitalization
+
+* apply suggestion: adding comment
+
+
+
+82a110ce Fix uint32 unmarshal (#2631)
+
+The string unmarshal for uint32 used ParseInt instead of ParseUint,
+which would parse the wrong range of valid numbers.
+
+
+
+- e62a0277 Add Changelog entries for v0.17.31
+
+- f707aa8d v0.17.31 postrelease bump
+
+
+
+
+
+
+## [v0.17.31](https://github.com/99designs/gqlgen/compare/v0.17.30...v0.17.31) - 2023-05-05
+- 37b26207 release v0.17.31
+
+- 4016b2bd fix (#2628)
+
+- 5a81c3e3 Remove other &&
+
+- fde269c0 Remove extraneous run
+
+- 47a5b333 Avoid && in command for retry
+
+- 4d8f850b Add timeout minutes
+
+- c839b6c1 Bandaid for flaky websocket tests
+
+395c362b New option to make comments on resolver optional (#2627)
+
+* remove 'foo' above resolver
+
+* regenerate after 6a3869707da1ffff7c196fcbcac44c92
+
+* omit resolver template comment
+
+* re-generate
+
+
+
+- 239b97ee Omittable input fields (#2585)
+
+2ad08fff Bugfix: add missing return statements in GRAPHQL and UrlEncodedForm transports. (#2625)
+
+Two transports (GRAPHQL and UrlEncodedForm) did not have return
+statement at the end of `if err` block. Instead of returning
+a 'could not cleanup body' error, we continued processing.
+
+User still got an error. But instead of early 'could not cleanup'
+error, user gor 'Internal system error' which happened a few
+lines after the if block.
+
+Tests are added.
+
+
+
+- a13eca12 update autogenerated gqlgen.yml with new options. (#2622)
+
+- f1f63b52 Post Release Changelog entry
+
+- 81f3469f v0.17.30 postrelease bump
+
+
+
+
+
## [v0.17.30](https://github.com/99designs/gqlgen/compare/v0.17.29...v0.17.30) - 2023-04-20
- 4754e2b3 release v0.17.30
diff --git a/vendor/github.com/99designs/gqlgen/codegen/args.go b/vendor/github.com/99designs/gqlgen/codegen/args.go
index 0fd30fff..c4cecea9 100644
--- a/vendor/github.com/99designs/gqlgen/codegen/args.go
+++ b/vendor/github.com/99designs/gqlgen/codegen/args.go
@@ -103,9 +103,9 @@ nextArg:
return newArgs, nil
}
-func (a *Data) Args() map[string][]*FieldArgument {
+func (d *Data) Args() map[string][]*FieldArgument {
ret := map[string][]*FieldArgument{}
- for _, o := range a.Objects {
+ for _, o := range d.Objects {
for _, f := range o.Fields {
if len(f.Args) > 0 {
ret[f.ArgsFunc()] = f.Args
@@ -113,9 +113,9 @@ func (a *Data) Args() map[string][]*FieldArgument {
}
}
- for _, d := range a.Directives() {
- if len(d.Args) > 0 {
- ret[d.ArgsFunc()] = d.Args
+ for _, directive := range d.Directives() {
+ if len(directive.Args) > 0 {
+ ret[directive.ArgsFunc()] = directive.Args
}
}
return ret
diff --git a/vendor/github.com/99designs/gqlgen/codegen/config/binder.go b/vendor/github.com/99designs/gqlgen/codegen/config/binder.go
index 51f23ede..e479417a 100644
--- a/vendor/github.com/99designs/gqlgen/codegen/config/binder.go
+++ b/vendor/github.com/99designs/gqlgen/codegen/config/binder.go
@@ -221,91 +221,99 @@ func (ref *TypeReference) Elem() *TypeReference {
return nil
}
-func (t *TypeReference) IsPtr() bool {
- _, isPtr := t.GO.(*types.Pointer)
+func (ref *TypeReference) IsPtr() bool {
+ _, isPtr := ref.GO.(*types.Pointer)
return isPtr
}
// fix for https://github.com/golang/go/issues/31103 may make it possible to remove this (may still be useful)
-func (t *TypeReference) IsPtrToPtr() bool {
- if p, isPtr := t.GO.(*types.Pointer); isPtr {
+func (ref *TypeReference) IsPtrToPtr() bool {
+ if p, isPtr := ref.GO.(*types.Pointer); isPtr {
_, isPtr := p.Elem().(*types.Pointer)
return isPtr
}
return false
}
-func (t *TypeReference) IsNilable() bool {
- return IsNilable(t.GO)
+func (ref *TypeReference) IsNilable() bool {
+ return IsNilable(ref.GO)
}
-func (t *TypeReference) IsSlice() bool {
- _, isSlice := t.GO.(*types.Slice)
- return t.GQL.Elem != nil && isSlice
+func (ref *TypeReference) IsSlice() bool {
+ _, isSlice := ref.GO.(*types.Slice)
+ return ref.GQL.Elem != nil && isSlice
}
-func (t *TypeReference) IsPtrToSlice() bool {
- if t.IsPtr() {
- _, isPointerToSlice := t.GO.(*types.Pointer).Elem().(*types.Slice)
+func (ref *TypeReference) IsPtrToSlice() bool {
+ if ref.IsPtr() {
+ _, isPointerToSlice := ref.GO.(*types.Pointer).Elem().(*types.Slice)
return isPointerToSlice
}
return false
}
-func (t *TypeReference) IsNamed() bool {
- _, isSlice := t.GO.(*types.Named)
+func (ref *TypeReference) IsPtrToIntf() bool {
+ if ref.IsPtr() {
+ _, isPointerToInterface := ref.GO.(*types.Pointer).Elem().(*types.Interface)
+ return isPointerToInterface
+ }
+ return false
+}
+
+func (ref *TypeReference) IsNamed() bool {
+ _, isSlice := ref.GO.(*types.Named)
return isSlice
}
-func (t *TypeReference) IsStruct() bool {
- _, isStruct := t.GO.Underlying().(*types.Struct)
+func (ref *TypeReference) IsStruct() bool {
+ _, isStruct := ref.GO.Underlying().(*types.Struct)
return isStruct
}
-func (t *TypeReference) IsScalar() bool {
- return t.Definition.Kind == ast.Scalar
+func (ref *TypeReference) IsScalar() bool {
+ return ref.Definition.Kind == ast.Scalar
}
-func (t *TypeReference) UniquenessKey() string {
+func (ref *TypeReference) UniquenessKey() string {
nullability := "O"
- if t.GQL.NonNull {
+ if ref.GQL.NonNull {
nullability = "N"
}
elemNullability := ""
- if t.GQL.Elem != nil && t.GQL.Elem.NonNull {
+ if ref.GQL.Elem != nil && ref.GQL.Elem.NonNull {
// Fix for #896
elemNullability = "ᚄ"
}
- return nullability + t.Definition.Name + "2" + templates.TypeIdentifier(t.GO) + elemNullability
+ return nullability + ref.Definition.Name + "2" + templates.TypeIdentifier(ref.GO) + elemNullability
}
-func (t *TypeReference) MarshalFunc() string {
- if t.Definition == nil {
- panic(errors.New("Definition missing for " + t.GQL.Name()))
+func (ref *TypeReference) MarshalFunc() string {
+ if ref.Definition == nil {
+ panic(errors.New("Definition missing for " + ref.GQL.Name()))
}
- if t.Definition.Kind == ast.InputObject {
+ if ref.Definition.Kind == ast.InputObject {
return ""
}
- return "marshal" + t.UniquenessKey()
+ return "marshal" + ref.UniquenessKey()
}
-func (t *TypeReference) UnmarshalFunc() string {
- if t.Definition == nil {
- panic(errors.New("Definition missing for " + t.GQL.Name()))
+func (ref *TypeReference) UnmarshalFunc() string {
+ if ref.Definition == nil {
+ panic(errors.New("Definition missing for " + ref.GQL.Name()))
}
- if !t.Definition.IsInputType() {
+ if !ref.Definition.IsInputType() {
return ""
}
- return "unmarshal" + t.UniquenessKey()
+ return "unmarshal" + ref.UniquenessKey()
}
-func (t *TypeReference) IsTargetNilable() bool {
- return IsNilable(t.Target)
+func (ref *TypeReference) IsTargetNilable() bool {
+ return IsNilable(ref.Target)
}
func (b *Binder) PushRef(ret *TypeReference) {
diff --git a/vendor/github.com/99designs/gqlgen/codegen/config/config.go b/vendor/github.com/99designs/gqlgen/codegen/config/config.go
index a4c3e47a..df4f6be3 100644
--- a/vendor/github.com/99designs/gqlgen/codegen/config/config.go
+++ b/vendor/github.com/99designs/gqlgen/codegen/config/config.go
@@ -35,6 +35,7 @@ type Config struct {
ReturnPointersInUmarshalInput bool `yaml:"return_pointers_in_unmarshalinput,omitempty"`
ResolversAlwaysReturnPointers bool `yaml:"resolvers_always_return_pointers,omitempty"`
NullableInputOmittable bool `yaml:"nullable_input_omittable,omitempty"`
+ EnableModelJsonOmitemptyTag *bool `yaml:"enable_model_json_omitempty_tag,omitempty"`
SkipValidation bool `yaml:"skip_validation,omitempty"`
SkipModTidy bool `yaml:"skip_mod_tidy,omitempty"`
Sources []*ast.Source `yaml:"-"`
@@ -324,6 +325,9 @@ func (c *Config) injectTypesFromSchema() error {
type TypeMapEntry struct {
Model StringList `yaml:"model"`
Fields map[string]TypeMapField `yaml:"fields,omitempty"`
+
+ // Key is the Go name of the field.
+ ExtraFields map[string]ModelExtraField `yaml:"extraFields,omitempty"`
}
type TypeMapField struct {
@@ -332,6 +336,32 @@ type TypeMapField struct {
GeneratedMethod string `yaml:"-"`
}
+type ModelExtraField struct {
+ // Type is the Go type of the field.
+ //
+ // It supports the builtin basic types (like string or int64), named types
+ // (qualified by the full package path), pointers to those types (prefixed
+ // with `*`), and slices of those types (prefixed with `[]`).
+ //
+ // For example, the following are valid types:
+ // string
+ // *github.com/author/package.Type
+ // []string
+ // []*github.com/author/package.Type
+ //
+ // Note that the type will be referenced from the generated/graphql, which
+ // means the package it lives in must not reference the generated/graphql
+ // package to avoid circular imports.
+ // restrictions.
+ Type string `yaml:"type"`
+
+ // OverrideTags is an optional override of the Go field tag.
+ OverrideTags string `yaml:"overrideTags"`
+
+ // Description is an optional the Go field doc-comment.
+ Description string `yaml:"description"`
+}
+
type StringList []string
func (a *StringList) UnmarshalYAML(unmarshal func(interface{}) error) error {
diff --git a/vendor/github.com/99designs/gqlgen/codegen/field.gotpl b/vendor/github.com/99designs/gqlgen/codegen/field.gotpl
index e47b958d..f974b597 100644
--- a/vendor/github.com/99designs/gqlgen/codegen/field.gotpl
+++ b/vendor/github.com/99designs/gqlgen/codegen/field.gotpl
@@ -94,7 +94,7 @@ func (ec *executionContext) {{ $field.FieldContextFunc }}(ctx context.Context, f
ctx = graphql.WithFieldContext(ctx, fc)
if fc.Args, err = ec.{{ $field.ArgsFunc }}(ctx, field.ArgumentMap(ec.Variables)); err != nil {
ec.Error(ctx, err)
- return
+ return fc, err
}
{{- end }}
return fc, nil
diff --git a/vendor/github.com/99designs/gqlgen/codegen/generated!.gotpl b/vendor/github.com/99designs/gqlgen/codegen/generated!.gotpl
index 647b0e46..42e84b65 100644
--- a/vendor/github.com/99designs/gqlgen/codegen/generated!.gotpl
+++ b/vendor/github.com/99designs/gqlgen/codegen/generated!.gotpl
@@ -14,7 +14,6 @@
{{ reserveImport "github.com/99designs/gqlgen/graphql" }}
{{ reserveImport "github.com/99designs/gqlgen/graphql/introspection" }}
-
{{ if eq .Config.Exec.Layout "single-file" }}
// NewExecutableSchema creates an ExecutableSchema from the ResolverRoot interface.
func NewExecutableSchema(cfg Config) graphql.ExecutableSchema {
@@ -104,7 +103,7 @@
}
func (e *executableSchema) Complexity(typeName, field string, childComplexity int, rawArgs map[string]interface{}) (int, bool) {
- ec := executionContext{nil, e}
+ ec := executionContext{nil, e, 0, 0, nil}
_ = ec
{{ if not .Config.OmitComplexity -}}
switch typeName + "." + field {
@@ -139,7 +138,7 @@
func (e *executableSchema) Exec(ctx context.Context) graphql.ResponseHandler {
rc := graphql.GetOperationContext(ctx)
- ec := executionContext{rc, e}
+ ec := executionContext{rc, e, 0, 0, make(chan graphql.DeferredResult)}
inputUnmarshalMap := graphql.BuildUnmarshalerMap(
{{- range $input := .Inputs -}}
{{ if not $input.HasUnmarshal }}
@@ -152,22 +151,39 @@
switch rc.Operation.Operation {
{{- if .QueryRoot }} case ast.Query:
return func(ctx context.Context) *graphql.Response {
- if !first { return nil }
- first = false
- ctx = graphql.WithUnmarshalerMap(ctx, inputUnmarshalMap)
- {{ if .Directives.LocationDirectives "QUERY" -}}
- data := ec._queryMiddleware(ctx, rc.Operation, func(ctx context.Context) (interface{}, error){
- return ec._{{.QueryRoot.Name}}(ctx, rc.Operation.SelectionSet), nil
- })
- {{- else -}}
- data := ec._{{.QueryRoot.Name}}(ctx, rc.Operation.SelectionSet)
- {{- end }}
+ var response graphql.Response
+ var data graphql.Marshaler
+ if first {
+ first = false
+ ctx = graphql.WithUnmarshalerMap(ctx, inputUnmarshalMap)
+ {{ if .Directives.LocationDirectives "QUERY" -}}
+ data = ec._queryMiddleware(ctx, rc.Operation, func(ctx context.Context) (interface{}, error){
+ return ec._{{.QueryRoot.Name}}(ctx, rc.Operation.SelectionSet), nil
+ })
+ {{- else -}}
+ data = ec._{{.QueryRoot.Name}}(ctx, rc.Operation.SelectionSet)
+ {{- end }}
+ } else {
+ if atomic.LoadInt32(&ec.pendingDeferred) > 0 {
+ result := <-ec.deferredResults
+ atomic.AddInt32(&ec.pendingDeferred, -1)
+ data = result.Result
+ response.Path = result.Path
+ response.Label = result.Label
+ response.Errors = result.Errors
+ } else {
+ return nil
+ }
+ }
var buf bytes.Buffer
data.MarshalGQL(&buf)
-
- return &graphql.Response{
- Data: buf.Bytes(),
+ response.Data = buf.Bytes()
+ if atomic.LoadInt32(&ec.deferred) > 0 {
+ hasNext := atomic.LoadInt32(&ec.pendingDeferred) > 0
+ response.HasNext = &hasNext
}
+
+ return &response
}
{{ end }}
@@ -224,6 +240,28 @@
type executionContext struct {
*graphql.OperationContext
*executableSchema
+ deferred int32
+ pendingDeferred int32
+ deferredResults chan graphql.DeferredResult
+ }
+
+ func (ec *executionContext) processDeferredGroup(dg graphql.DeferredGroup) {
+ atomic.AddInt32(&ec.pendingDeferred, 1)
+ go func () {
+ ctx := graphql.WithFreshResponseContext(dg.Context)
+ dg.FieldSet.Dispatch(ctx)
+ ds := graphql.DeferredResult{
+ Path: dg.Path,
+ Label: dg.Label,
+ Result: dg.FieldSet,
+ Errors: graphql.GetErrors(ctx),
+ }
+ // null fields should bubble up
+ if dg.FieldSet.Invalids > 0 {
+ ds.Result = graphql.Null
+ }
+ ec.deferredResults <- ds
+ }()
}
func (ec *executionContext) introspectSchema() (*introspection.Schema, error) {
diff --git a/vendor/github.com/99designs/gqlgen/codegen/object.gotpl b/vendor/github.com/99designs/gqlgen/codegen/object.gotpl
index 1fbdface..adb1df49 100644
--- a/vendor/github.com/99designs/gqlgen/codegen/object.gotpl
+++ b/vendor/github.com/99designs/gqlgen/codegen/object.gotpl
@@ -25,86 +25,121 @@ func (ec *executionContext) _{{$object.Name}}(ctx context.Context, sel ast.Selec
{{- else }}
func (ec *executionContext) _{{$object.Name}}(ctx context.Context, sel ast.SelectionSet{{ if not $object.Root }},obj {{$object.Reference | ref }}{{ end }}) graphql.Marshaler {
fields := graphql.CollectFields(ec.OperationContext, sel, {{$object.Name|lcFirst}}Implementors)
- {{- if $object.Root }}
- ctx = graphql.WithFieldContext(ctx, &graphql.FieldContext{
- Object: {{$object.Name|quote}},
- })
- {{end}}
+ {{- if $object.Root }}
+ ctx = graphql.WithFieldContext(ctx, &graphql.FieldContext{
+ Object: {{$object.Name|quote}},
+ })
+ {{end}}
+
out := graphql.NewFieldSet(fields)
- var invalids uint32
+ deferred := make(map[string]*graphql.FieldSet)
for i, field := range fields {
- {{- if $object.Root }}
- innerCtx := graphql.WithRootFieldContext(ctx, &graphql.RootFieldContext{
- Object: field.Name,
- Field: field,
- })
- {{end}}
- switch field.Name {
- case "__typename":
- out.Values[i] = graphql.MarshalString({{$object.Name|quote}})
- {{- range $field := $object.Fields }}
- case "{{$field.Name}}":
- {{- if $field.IsConcurrent }}
- field := field
+ {{- if $object.Root }}
+ innerCtx := graphql.WithRootFieldContext(ctx, &graphql.RootFieldContext{
+ Object: field.Name,
+ Field: field,
+ })
+ {{end}}
+ switch field.Name {
+ case "__typename":
+ out.Values[i] = graphql.MarshalString({{$object.Name|quote}})
+ {{- range $field := $object.Fields }}
+ case "{{$field.Name}}":
+ {{- if $field.IsConcurrent }}
+ field := field
- innerFunc := func(ctx context.Context) (res graphql.Marshaler) {
- defer func() {
- if r := recover(); r != nil {
- ec.Error(ctx, ec.Recover(ctx, r))
- }
- }()
- res = ec._{{$object.Name}}_{{$field.Name}}(ctx, field{{if not $object.Root}}, obj{{end}})
- {{- if $field.TypeReference.GQL.NonNull }}
- if res == graphql.Null {
- {{- if $object.IsConcurrent }}
- atomic.AddUint32(&invalids, 1)
- {{- else }}
- invalids++
- {{- end }}
- }
- {{- end }}
- return res
- }
+ innerFunc := func(ctx context.Context, fs *graphql.FieldSet) (res graphql.Marshaler) {
+ defer func() {
+ if r := recover(); r != nil {
+ ec.Error(ctx, ec.Recover(ctx, r))
+ }
+ }()
+ res = ec._{{$object.Name}}_{{$field.Name}}(ctx, field{{if not $object.Root}}, obj{{end}})
+ {{- if $field.TypeReference.GQL.NonNull }}
+ if res == graphql.Null {
+ {{- if $object.IsConcurrent }}
+ atomic.AddUint32(&fs.Invalids, 1)
+ {{- else }}
+ fs.Invalids++
+ {{- end }}
+ }
+ {{- end }}
+ return res
+ }
- {{if $object.Root}}
- rrm := func(ctx context.Context) graphql.Marshaler {
- return ec.OperationContext.RootResolverMiddleware(ctx, innerFunc)
- }
- {{end}}
+ {{if $object.Root}}
+ rrm := func(ctx context.Context) graphql.Marshaler {
+ return ec.OperationContext.RootResolverMiddleware(ctx,
+ func(ctx context.Context) graphql.Marshaler { return innerFunc(ctx, out) })
+ }
+ {{end}}
- out.Concurrently(i, func() graphql.Marshaler {
- {{- if $object.Root -}}
- return rrm(innerCtx)
- {{- else -}}
- return innerFunc(ctx)
- {{end}}
- })
- {{- else }}
- {{if $object.Root}}
- out.Values[i] = ec.OperationContext.RootResolverMiddleware(innerCtx, func(ctx context.Context) (res graphql.Marshaler) {
- return ec._{{$object.Name}}_{{$field.Name}}(ctx, field)
- })
- {{else}}
- out.Values[i] = ec._{{$object.Name}}_{{$field.Name}}(ctx, field, obj)
- {{end}}
+ {{if not $object.Root}}
+ if field.Deferrable != nil {
+ dfs, ok := deferred[field.Deferrable.Label]
+ di := 0
+ if ok {
+ dfs.AddField(field)
+ di = len(dfs.Values) - 1
+ } else {
+ dfs = graphql.NewFieldSet([]graphql.CollectedField{field})
+ deferred[field.Deferrable.Label] = dfs
+ }
+ dfs.Concurrently(di, func(ctx context.Context) graphql.Marshaler {
+ return innerFunc(ctx, dfs)
+ })
- {{- if $field.TypeReference.GQL.NonNull }}
- if out.Values[i] == graphql.Null {
- {{- if $object.IsConcurrent }}
- atomic.AddUint32(&invalids, 1)
- {{- else }}
- invalids++
- {{- end }}
- }
- {{- end }}
- {{- end }}
- {{- end }}
- default:
- panic("unknown field " + strconv.Quote(field.Name))
- }
+ // don't run the out.Concurrently() call below
+ out.Values[i] = graphql.Null
+ continue
+ }
+ {{end}}
+
+ out.Concurrently(i, func(ctx context.Context) graphql.Marshaler {
+ {{- if $object.Root -}}
+ return rrm(innerCtx)
+ {{- else -}}
+ return innerFunc(ctx, out)
+ {{- end -}}
+ })
+ {{- else }}
+ {{- if $object.Root -}}
+ out.Values[i] = ec.OperationContext.RootResolverMiddleware(innerCtx, func(ctx context.Context) (res graphql.Marshaler) {
+ return ec._{{$object.Name}}_{{$field.Name}}(ctx, field)
+ })
+ {{- else -}}
+ out.Values[i] = ec._{{$object.Name}}_{{$field.Name}}(ctx, field, obj)
+ {{- end -}}
+
+ {{- if $field.TypeReference.GQL.NonNull }}
+ if out.Values[i] == graphql.Null {
+ {{- if $object.IsConcurrent }}
+ atomic.AddUint32(&out.Invalids, 1)
+ {{- else }}
+ out.Invalids++
+ {{- end }}
+ }
+ {{- end }}
+ {{- end }}
+ {{- end }}
+ default:
+ panic("unknown field " + strconv.Quote(field.Name))
+ }
}
- out.Dispatch()
- if invalids > 0 { return graphql.Null }
+ out.Dispatch(ctx)
+ if out.Invalids > 0 { return graphql.Null }
+
+ atomic.AddInt32(&ec.deferred, int32(len(deferred)))
+
+ for label, dfs := range deferred {
+ ec.processDeferredGroup(graphql.DeferredGroup{
+ Label: label,
+ Path: graphql.GetPath(ctx),
+ FieldSet: dfs,
+ Context: ctx,
+ })
+ }
+
return out
}
{{- end }}
diff --git a/vendor/github.com/99designs/gqlgen/codegen/root_.gotpl b/vendor/github.com/99designs/gqlgen/codegen/root_.gotpl
index 5f97a574..dcfc84d0 100644
--- a/vendor/github.com/99designs/gqlgen/codegen/root_.gotpl
+++ b/vendor/github.com/99designs/gqlgen/codegen/root_.gotpl
@@ -76,7 +76,7 @@ func (e *executableSchema) Schema() *ast.Schema {
}
func (e *executableSchema) Complexity(typeName, field string, childComplexity int, rawArgs map[string]interface{}) (int, bool) {
- ec := executionContext{nil, e}
+ ec := executionContext{nil, e, 0, 0, nil}
_ = ec
{{- if not .Config.OmitComplexity }}
switch typeName + "." + field {
@@ -111,7 +111,7 @@ func (e *executableSchema) Complexity(typeName, field string, childComplexity in
func (e *executableSchema) Exec(ctx context.Context) graphql.ResponseHandler {
rc := graphql.GetOperationContext(ctx)
- ec := executionContext{rc, e}
+ ec := executionContext{rc, e, 0, 0, make(chan graphql.DeferredResult)}
inputUnmarshalMap := graphql.BuildUnmarshalerMap(
{{- range $input := .Inputs -}}
{{ if not $input.HasUnmarshal }}
@@ -124,22 +124,39 @@ func (e *executableSchema) Exec(ctx context.Context) graphql.ResponseHandler {
switch rc.Operation.Operation {
{{- if .QueryRoot }} case ast.Query:
return func(ctx context.Context) *graphql.Response {
- if !first { return nil }
- first = false
- ctx = graphql.WithUnmarshalerMap(ctx, inputUnmarshalMap)
- {{ if .Directives.LocationDirectives "QUERY" -}}
- data := ec._queryMiddleware(ctx, rc.Operation, func(ctx context.Context) (interface{}, error){
- return ec._{{.QueryRoot.Name}}(ctx, rc.Operation.SelectionSet), nil
- })
- {{- else -}}
- data := ec._{{.QueryRoot.Name}}(ctx, rc.Operation.SelectionSet)
- {{- end }}
+ var response graphql.Response
+ var data graphql.Marshaler
+ if first {
+ first = false
+ ctx = graphql.WithUnmarshalerMap(ctx, inputUnmarshalMap)
+ {{ if .Directives.LocationDirectives "QUERY" -}}
+ data = ec._queryMiddleware(ctx, rc.Operation, func(ctx context.Context) (interface{}, error){
+ return ec._{{.QueryRoot.Name}}(ctx, rc.Operation.SelectionSet), nil
+ })
+ {{- else -}}
+ data = ec._{{.QueryRoot.Name}}(ctx, rc.Operation.SelectionSet)
+ {{- end }}
+ } else {
+ if atomic.LoadInt32(&ec.pendingDeferred) > 0 {
+ result := <-ec.deferredResults
+ atomic.AddInt32(&ec.pendingDeferred, -1)
+ data = result.Result
+ response.Path = result.Path
+ response.Label = result.Label
+ response.Errors = result.Errors
+ } else {
+ return nil
+ }
+ }
var buf bytes.Buffer
data.MarshalGQL(&buf)
-
- return &graphql.Response{
- Data: buf.Bytes(),
+ response.Data = buf.Bytes()
+ if atomic.LoadInt32(&ec.deferred) > 0 {
+ hasNext := atomic.LoadInt32(&ec.pendingDeferred) > 0
+ response.HasNext = &hasNext
}
+
+ return &response
}
{{ end }}
@@ -196,6 +213,28 @@ func (e *executableSchema) Exec(ctx context.Context) graphql.ResponseHandler {
type executionContext struct {
*graphql.OperationContext
*executableSchema
+ deferred int32
+ pendingDeferred int32
+ deferredResults chan graphql.DeferredResult
+}
+
+func (ec *executionContext) processDeferredGroup(dg graphql.DeferredGroup) {
+ atomic.AddInt32(&ec.pendingDeferred, 1)
+ go func () {
+ ctx := graphql.WithFreshResponseContext(dg.Context)
+ dg.FieldSet.Dispatch(ctx)
+ ds := graphql.DeferredResult{
+ Path: dg.Path,
+ Label: dg.Label,
+ Result: dg.FieldSet,
+ Errors: graphql.GetErrors(ctx),
+ }
+ // null fields should bubble up
+ if dg.FieldSet.Invalids > 0 {
+ ds.Result = graphql.Null
+ }
+ ec.deferredResults <- ds
+ }()
}
func (ec *executionContext) introspectSchema() (*introspection.Schema, error) {
diff --git a/vendor/github.com/99designs/gqlgen/codegen/templates/templates.go b/vendor/github.com/99designs/gqlgen/codegen/templates/templates.go
index 159df77c..a3b3be0a 100644
--- a/vendor/github.com/99designs/gqlgen/codegen/templates/templates.go
+++ b/vendor/github.com/99designs/gqlgen/codegen/templates/templates.go
@@ -517,7 +517,25 @@ func wordWalker(str string, f func(*wordInfo)) {
}
matchCommonInitial := false
- if commonInitialisms[strings.ToUpper(word)] {
+ upperWord := strings.ToUpper(word)
+ if commonInitialisms[upperWord] {
+ // If the uppercase word (string(runes[w:i]) is "ID" or "IP"
+ // AND
+ // the word is the first two characters of the str
+ // AND
+ // that is not the end of the word
+ // AND
+ // the length of the string is greater than 3
+ // AND
+ // the third rune is an uppercase one
+ // THEN
+ // do NOT count this as an initialism.
+ switch upperWord {
+ case "ID", "IP":
+ if word == str[:2] && !eow && len(str) > 3 && unicode.IsUpper(runes[3]) {
+ continue
+ }
+ }
hasCommonInitial = true
matchCommonInitial = true
}
diff --git a/vendor/github.com/99designs/gqlgen/codegen/type.go b/vendor/github.com/99designs/gqlgen/codegen/type.go
index 20b09dc9..dcd9d291 100644
--- a/vendor/github.com/99designs/gqlgen/codegen/type.go
+++ b/vendor/github.com/99designs/gqlgen/codegen/type.go
@@ -26,7 +26,7 @@ func processType(ret map[string]*config.TypeReference, ref *config.TypeReference
}
ret[key] = ref
- if ref.IsSlice() || ref.IsPtrToSlice() || ref.IsPtrToPtr() {
+ if ref.IsSlice() || ref.IsPtrToSlice() || ref.IsPtrToPtr() || ref.IsPtrToIntf() {
processType(ret, ref.Elem())
}
}
diff --git a/vendor/github.com/99designs/gqlgen/codegen/type.gotpl b/vendor/github.com/99designs/gqlgen/codegen/type.gotpl
index eaa17184..5cbd737c 100644
--- a/vendor/github.com/99designs/gqlgen/codegen/type.gotpl
+++ b/vendor/github.com/99designs/gqlgen/codegen/type.gotpl
@@ -4,7 +4,7 @@
{{- if and $type.IsNilable (not $type.GQL.NonNull) (not $type.IsPtrToPtr) }}
if v == nil { return nil, nil }
{{- end }}
- {{- if $type.IsPtrToSlice }}
+ {{- if or $type.IsPtrToSlice $type.IsPtrToIntf }}
res, err := ec.{{ $type.Elem.UnmarshalFunc }}(ctx, v)
return &res, graphql.ErrorOnPath(ctx, err)
{{- else if $type.IsSlice }}
@@ -89,7 +89,7 @@
{{ with $type.MarshalFunc }}
func (ec *executionContext) {{ . }}(ctx context.Context, sel ast.SelectionSet, v {{ $type.GO | ref }}) graphql.Marshaler {
- {{- if $type.IsPtrToSlice }}
+ {{- if or $type.IsPtrToSlice $type.IsPtrToIntf }}
return ec.{{ $type.Elem.MarshalFunc }}(ctx, sel, *v)
{{- else if $type.IsSlice }}
{{- if not $type.GQL.NonNull }}
diff --git a/vendor/github.com/99designs/gqlgen/graphql/cache.go b/vendor/github.com/99designs/gqlgen/graphql/cache.go
index fe86ca35..e552ce67 100644
--- a/vendor/github.com/99designs/gqlgen/graphql/cache.go
+++ b/vendor/github.com/99designs/gqlgen/graphql/cache.go
@@ -15,15 +15,15 @@ type Cache interface {
type MapCache map[string]interface{}
// Get looks up a key's value from the cache.
-func (m MapCache) Get(ctx context.Context, key string) (value interface{}, ok bool) {
+func (m MapCache) Get(_ context.Context, key string) (value interface{}, ok bool) {
v, ok := m[key]
return v, ok
}
// Add adds a value to the cache.
-func (m MapCache) Add(ctx context.Context, key string, value interface{}) { m[key] = value }
+func (m MapCache) Add(_ context.Context, key string, value interface{}) { m[key] = value }
type NoCache struct{}
-func (n NoCache) Get(ctx context.Context, key string) (value interface{}, ok bool) { return nil, false }
-func (n NoCache) Add(ctx context.Context, key string, value interface{}) {}
+func (n NoCache) Get(_ context.Context, _ string) (value interface{}, ok bool) { return nil, false }
+func (n NoCache) Add(_ context.Context, _ string, _ interface{}) {}
diff --git a/vendor/github.com/99designs/gqlgen/graphql/context_response.go b/vendor/github.com/99designs/gqlgen/graphql/context_response.go
index c128fdb4..6d223c8a 100644
--- a/vendor/github.com/99designs/gqlgen/graphql/context_response.go
+++ b/vendor/github.com/99designs/gqlgen/graphql/context_response.go
@@ -36,6 +36,14 @@ func WithResponseContext(ctx context.Context, presenterFunc ErrorPresenterFunc,
})
}
+func WithFreshResponseContext(ctx context.Context) context.Context {
+ e := getResponseContext(ctx)
+ return context.WithValue(ctx, resultCtx, &responseContext{
+ errorPresenter: e.errorPresenter,
+ recover: e.recover,
+ })
+}
+
// AddErrorf writes a formatted error to the client, first passing it through the error presenter.
func AddErrorf(ctx context.Context, format string, args ...interface{}) {
AddError(ctx, fmt.Errorf(format, args...))
diff --git a/vendor/github.com/99designs/gqlgen/graphql/deferred.go b/vendor/github.com/99designs/gqlgen/graphql/deferred.go
new file mode 100644
index 00000000..1aeb48c1
--- /dev/null
+++ b/vendor/github.com/99designs/gqlgen/graphql/deferred.go
@@ -0,0 +1,26 @@
+package graphql
+
+import (
+ "context"
+
+ "github.com/vektah/gqlparser/v2/ast"
+ "github.com/vektah/gqlparser/v2/gqlerror"
+)
+
+type Deferrable struct {
+ Label string
+}
+
+type DeferredGroup struct {
+ Path ast.Path
+ Label string
+ FieldSet *FieldSet
+ Context context.Context
+}
+
+type DeferredResult struct {
+ Path ast.Path
+ Label string
+ Result Marshaler
+ Errors gqlerror.List
+}
diff --git a/vendor/github.com/99designs/gqlgen/graphql/executable_schema.go b/vendor/github.com/99designs/gqlgen/graphql/executable_schema.go
index 61891622..58f942a1 100644
--- a/vendor/github.com/99designs/gqlgen/graphql/executable_schema.go
+++ b/vendor/github.com/99designs/gqlgen/graphql/executable_schema.go
@@ -45,9 +45,19 @@ func collectFields(reqCtx *OperationContext, selSet ast.SelectionSet, satisfies
if len(satisfies) > 0 && !instanceOf(sel.TypeCondition, satisfies) {
continue
}
+
+ shouldDefer, label := deferrable(sel.Directives, reqCtx.Variables)
+
for _, childField := range collectFields(reqCtx, sel.SelectionSet, satisfies, visited) {
- f := getOrCreateAndAppendField(&groupedFields, childField.Name, childField.Alias, childField.ObjectDefinition, func() CollectedField { return childField })
+ f := getOrCreateAndAppendField(
+ &groupedFields, childField.Name, childField.Alias, childField.ObjectDefinition,
+ func() CollectedField { return childField })
f.Selections = append(f.Selections, childField.Selections...)
+ if shouldDefer {
+ f.Deferrable = &Deferrable{
+ Label: label,
+ }
+ }
}
case *ast.FragmentSpread:
@@ -70,9 +80,16 @@ func collectFields(reqCtx *OperationContext, selSet ast.SelectionSet, satisfies
continue
}
+ shouldDefer, label := deferrable(sel.Directives, reqCtx.Variables)
+
for _, childField := range collectFields(reqCtx, fragment.SelectionSet, satisfies, visited) {
- f := getOrCreateAndAppendField(&groupedFields, childField.Name, childField.Alias, childField.ObjectDefinition, func() CollectedField { return childField })
+ f := getOrCreateAndAppendField(&groupedFields,
+ childField.Name, childField.Alias, childField.ObjectDefinition,
+ func() CollectedField { return childField })
f.Selections = append(f.Selections, childField.Selections...)
+ if shouldDefer {
+ f.Deferrable = &Deferrable{Label: label}
+ }
}
default:
@@ -87,6 +104,7 @@ type CollectedField struct {
*ast.Field
Selections ast.SelectionSet
+ Deferrable *Deferrable
}
func instanceOf(val string, satisfies []string) bool {
@@ -150,6 +168,32 @@ func shouldIncludeNode(directives ast.DirectiveList, variables map[string]interf
return !skip && include
}
+func deferrable(directives ast.DirectiveList, variables map[string]interface{}) (shouldDefer bool, label string) {
+ d := directives.ForName("defer")
+ if d == nil {
+ return false, ""
+ }
+
+ shouldDefer = true
+
+ for _, arg := range d.Arguments {
+ switch arg.Name {
+ case "if":
+ if value, err := arg.Value.Value(variables); err == nil {
+ shouldDefer, _ = value.(bool)
+ }
+ case "label":
+ if value, err := arg.Value.Value(variables); err == nil {
+ label, _ = value.(string)
+ }
+ default:
+ panic(fmt.Sprintf("defer: argument '%s' not supported", arg.Name))
+ }
+ }
+
+ return shouldDefer, label
+}
+
func resolveIfArgument(d *ast.Directive, variables map[string]interface{}) bool {
arg := d.Arguments.ForName("if")
if arg == nil {
diff --git a/vendor/github.com/99designs/gqlgen/graphql/fieldset.go b/vendor/github.com/99designs/gqlgen/graphql/fieldset.go
index 351e266f..3ba28582 100644
--- a/vendor/github.com/99designs/gqlgen/graphql/fieldset.go
+++ b/vendor/github.com/99designs/gqlgen/graphql/fieldset.go
@@ -1,19 +1,21 @@
package graphql
import (
+ "context"
"io"
"sync"
)
type FieldSet struct {
- fields []CollectedField
- Values []Marshaler
- delayed []delayedResult
+ fields []CollectedField
+ Values []Marshaler
+ Invalids uint32
+ delayed []delayedResult
}
type delayedResult struct {
i int
- f func() Marshaler
+ f func(context.Context) Marshaler
}
func NewFieldSet(fields []CollectedField) *FieldSet {
@@ -23,15 +25,20 @@ func NewFieldSet(fields []CollectedField) *FieldSet {
}
}
-func (m *FieldSet) Concurrently(i int, f func() Marshaler) {
+func (m *FieldSet) AddField(field CollectedField) {
+ m.fields = append(m.fields, field)
+ m.Values = append(m.Values, nil)
+}
+
+func (m *FieldSet) Concurrently(i int, f func(context.Context) Marshaler) {
m.delayed = append(m.delayed, delayedResult{i: i, f: f})
}
-func (m *FieldSet) Dispatch() {
+func (m *FieldSet) Dispatch(ctx context.Context) {
if len(m.delayed) == 1 {
// only one concurrent task, no need to spawn a goroutine or deal create waitgroups
d := m.delayed[0]
- m.Values[d.i] = d.f()
+ m.Values[d.i] = d.f(ctx)
} else if len(m.delayed) > 1 {
// more than one concurrent task, use the main goroutine to do one, only spawn goroutines for the others
@@ -39,12 +46,12 @@ func (m *FieldSet) Dispatch() {
for _, d := range m.delayed[1:] {
wg.Add(1)
go func(d delayedResult) {
- m.Values[d.i] = d.f()
+ m.Values[d.i] = d.f(ctx)
wg.Done()
}(d)
}
- m.Values[m.delayed[0].i] = m.delayed[0].f()
+ m.Values[m.delayed[0].i] = m.delayed[0].f(ctx)
wg.Wait()
}
}
diff --git a/vendor/github.com/99designs/gqlgen/graphql/handler/extension/complexity.go b/vendor/github.com/99designs/gqlgen/graphql/handler/extension/complexity.go
index 2d853802..e88848d1 100644
--- a/vendor/github.com/99designs/gqlgen/graphql/handler/extension/complexity.go
+++ b/vendor/github.com/99designs/gqlgen/graphql/handler/extension/complexity.go
@@ -59,17 +59,17 @@ func (c *ComplexityLimit) Validate(schema graphql.ExecutableSchema) error {
func (c ComplexityLimit) MutateOperationContext(ctx context.Context, rc *graphql.OperationContext) *gqlerror.Error {
op := rc.Doc.Operations.ForName(rc.OperationName)
- complexity := complexity.Calculate(c.es, op, rc.Variables)
+ complexityCalcs := complexity.Calculate(c.es, op, rc.Variables)
limit := c.Func(ctx, rc)
rc.Stats.SetExtension(complexityExtension, &ComplexityStats{
- Complexity: complexity,
+ Complexity: complexityCalcs,
ComplexityLimit: limit,
})
- if complexity > limit {
- err := gqlerror.Errorf("operation has complexity %d, which exceeds the limit of %d", complexity, limit)
+ if complexityCalcs > limit {
+ err := gqlerror.Errorf("operation has complexity %d, which exceeds the limit of %d", complexityCalcs, limit)
errcode.Set(err, errComplexityLimit)
return err
}
diff --git a/vendor/github.com/99designs/gqlgen/graphql/response.go b/vendor/github.com/99designs/gqlgen/graphql/response.go
index 0d36049a..a82f27e2 100644
--- a/vendor/github.com/99designs/gqlgen/graphql/response.go
+++ b/vendor/github.com/99designs/gqlgen/graphql/response.go
@@ -5,6 +5,7 @@ import (
"encoding/json"
"fmt"
+ "github.com/vektah/gqlparser/v2/ast"
"github.com/vektah/gqlparser/v2/gqlerror"
)
@@ -14,6 +15,9 @@ import (
type Response struct {
Errors gqlerror.List `json:"errors,omitempty"`
Data json.RawMessage `json:"data"`
+ Label string `json:"label,omitempty"`
+ Path ast.Path `json:"path,omitempty"`
+ HasNext *bool `json:"hasNext,omitempty"`
Extensions map[string]interface{} `json:"extensions,omitempty"`
}
diff --git a/vendor/github.com/99designs/gqlgen/graphql/uint.go b/vendor/github.com/99designs/gqlgen/graphql/uint.go
index 9349c2f4..26e6aa6b 100644
--- a/vendor/github.com/99designs/gqlgen/graphql/uint.go
+++ b/vendor/github.com/99designs/gqlgen/graphql/uint.go
@@ -60,7 +60,7 @@ func MarshalUint32(i uint32) Marshaler {
func UnmarshalUint32(v interface{}) (uint32, error) {
switch v := v.(type) {
case string:
- iv, err := strconv.ParseInt(v, 10, 32)
+ iv, err := strconv.ParseUint(v, 10, 32)
if err != nil {
return 0, err
}
diff --git a/vendor/github.com/99designs/gqlgen/graphql/version.go b/vendor/github.com/99designs/gqlgen/graphql/version.go
index 0a63293a..0fc1e9f2 100644
--- a/vendor/github.com/99designs/gqlgen/graphql/version.go
+++ b/vendor/github.com/99designs/gqlgen/graphql/version.go
@@ -1,3 +1,3 @@
package graphql
-const Version = "v0.17.31"
+const Version = "v0.17.33"
diff --git a/vendor/github.com/99designs/gqlgen/internal/code/compare.go b/vendor/github.com/99designs/gqlgen/internal/code/compare.go
index 1150a24e..e521d31e 100644
--- a/vendor/github.com/99designs/gqlgen/internal/code/compare.go
+++ b/vendor/github.com/99designs/gqlgen/internal/code/compare.go
@@ -6,7 +6,7 @@ import (
)
// CompatibleTypes isnt a strict comparison, it allows for pointer differences
-func CompatibleTypes(expected types.Type, actual types.Type) error {
+func CompatibleTypes(expected, actual types.Type) error {
// Special case to deal with pointer mismatches
{
expectedPtr, expectedIsPtr := expected.(*types.Pointer)
@@ -84,11 +84,8 @@ func CompatibleTypes(expected types.Type, actual types.Type) error {
if err := CompatibleTypes(expected.Params(), actual.Params()); err != nil {
return err
}
- if err := CompatibleTypes(expected.Results(), actual.Results()); err != nil {
- return err
- }
-
- return nil
+ err := CompatibleTypes(expected.Results(), actual.Results())
+ return err
}
case *types.Interface:
if actual, ok := actual.(*types.Interface); ok {
@@ -114,11 +111,8 @@ func CompatibleTypes(expected types.Type, actual types.Type) error {
return err
}
- if err := CompatibleTypes(expected.Elem(), actual.Elem()); err != nil {
- return err
- }
-
- return nil
+ err := CompatibleTypes(expected.Elem(), actual.Elem())
+ return err
}
case *types.Chan:
diff --git a/vendor/github.com/99designs/gqlgen/internal/code/imports.go b/vendor/github.com/99designs/gqlgen/internal/code/imports.go
index 0e499a17..89ebab96 100644
--- a/vendor/github.com/99designs/gqlgen/internal/code/imports.go
+++ b/vendor/github.com/99designs/gqlgen/internal/code/imports.go
@@ -138,7 +138,7 @@ func extractModuleName(content []byte) string {
break
}
s := strings.Trim(string(tkn), " \t")
- if len(s) != 0 && !strings.HasPrefix(s, "//") {
+ if s != "" && !strings.HasPrefix(s, "//") {
break
}
if advance <= len(content) {
@@ -171,4 +171,4 @@ func ImportPathForDir(dir string) (res string) {
return ""
}
-var modregex = regexp.MustCompile(`module ([^\s]*)`)
+var modregex = regexp.MustCompile(`module (\S*)`)
diff --git a/vendor/github.com/99designs/gqlgen/internal/code/packages.go b/vendor/github.com/99designs/gqlgen/internal/code/packages.go
index 0b25750a..6cb6ef23 100644
--- a/vendor/github.com/99designs/gqlgen/internal/code/packages.go
+++ b/vendor/github.com/99designs/gqlgen/internal/code/packages.go
@@ -14,8 +14,10 @@ import (
"golang.org/x/tools/go/packages"
)
-var once = sync.Once{}
-var modInfo *debug.BuildInfo
+var (
+ once = sync.Once{}
+ modInfo *debug.BuildInfo
+)
var mode = packages.NeedName |
packages.NeedFiles |
diff --git a/vendor/github.com/99designs/gqlgen/internal/code/util.go b/vendor/github.com/99designs/gqlgen/internal/code/util.go
index cbe40858..96c6e03f 100644
--- a/vendor/github.com/99designs/gqlgen/internal/code/util.go
+++ b/vendor/github.com/99designs/gqlgen/internal/code/util.go
@@ -54,7 +54,7 @@ func QualifyPackagePath(importPath string) string {
return pkg.ImportPath
}
-var invalidPackageNameChar = regexp.MustCompile(`[^\w]`)
+var invalidPackageNameChar = regexp.MustCompile(`\W`)
func SanitizePackageName(pkg string) string {
return invalidPackageNameChar.ReplaceAllLiteralString(filepath.Base(pkg), "_")
diff --git a/vendor/github.com/99designs/gqlgen/internal/rewrite/rewriter.go b/vendor/github.com/99designs/gqlgen/internal/rewrite/rewriter.go
index 07a5f042..1ca722dc 100644
--- a/vendor/github.com/99designs/gqlgen/internal/rewrite/rewriter.go
+++ b/vendor/github.com/99designs/gqlgen/internal/rewrite/rewriter.go
@@ -68,7 +68,7 @@ func (r *Rewriter) getFile(filename string) string {
return r.files[filename]
}
-func (r *Rewriter) GetPrevDecl(structname string, methodname string) *ast.FuncDecl {
+func (r *Rewriter) GetPrevDecl(structname, methodname string) *ast.FuncDecl {
for _, f := range r.pkg.Syntax {
for _, d := range f.Decls {
d, isFunc := d.(*ast.FuncDecl)
@@ -99,7 +99,7 @@ func (r *Rewriter) GetPrevDecl(structname string, methodname string) *ast.FuncDe
return nil
}
-func (r *Rewriter) GetMethodComment(structname string, methodname string) string {
+func (r *Rewriter) GetMethodComment(structname, methodname string) string {
d := r.GetPrevDecl(structname, methodname)
if d != nil {
return d.Doc.Text()
@@ -107,7 +107,7 @@ func (r *Rewriter) GetMethodComment(structname string, methodname string) string
return ""
}
-func (r *Rewriter) GetMethodBody(structname string, methodname string) string {
+func (r *Rewriter) GetMethodBody(structname, methodname string) string {
d := r.GetPrevDecl(structname, methodname)
if d != nil {
return r.getSource(d.Body.Pos()+1, d.Body.End()-1)
diff --git a/vendor/github.com/99designs/gqlgen/lint.txt b/vendor/github.com/99designs/gqlgen/lint.txt
deleted file mode 100644
index 308c732e..00000000
--- a/vendor/github.com/99designs/gqlgen/lint.txt
+++ /dev/null
@@ -1,1167 +0,0 @@
-api/generate.go:17:2: Error return value of `syscall.Unlink` is not checked (errcheck)
-api/generate.go:19:3: Error return value of `syscall.Unlink` is not checked (errcheck)
-api/generate.go:35:8: weakCond: suspicious `urlString != nil && urlString[1] == "https://specs.apollo.dev/federation/v2.0"`; nil check may not be enough, check for len (gocritic)
-api/generate.go:86:2: ST1003: should not use underscores in Go names; var data_plugins should be dataPlugins (stylecheck)
-api/generate.go:86:2: var-naming: don't use underscores in Go names; var data_plugins should be dataPlugins (revive)
-api/generate_test.go:21:6: Error return value of `os.Getwd` is not checked (errcheck)
-api/generate_test.go:49:5: Error return value of `os.Chdir` is not checked (errcheck)
-api/generate_test.go:51:4: Error return value of `os.Chdir` is not checked (errcheck)
-api/option.go:22:54: Comment should end in a period (godot)
-api/option.go:29:74: Comment should end in a period (godot)
-api/option_test.go:16:32: Comment should end in a period (godot)
-api/option_test.go:21:42: Comment should end in a period (godot)
-client/client.go:29:51: Comment should end in a period (godot)
-client/client.go:33:40: json(snake): got 'operationName' want 'operation_name' (tagliatelle)
-client/client.go:47:83: Comment should end in a period (godot)
-client/client.go:57:84: Comment should end in a period (godot)
-client/client.go:128:7: ST1017: don't use Yoda conditions (stylecheck)
-client/client.go:128:7: yodaStyleExpr: consider to change order in expression to contentType == "application/json" (gocritic)
-client/client.go:141:1: paramTypeCombine: func(data interface{}, into interface{}) error could be replaced with func(data, into interface{}) error (gocritic)
-client/client_test.go:57:10: Error return value of `w.Write` is not checked (errcheck)
-client/client_test.go:67:25: Error return value of `bodyWriter.WriteField` is not checked (errcheck)
-client/client_test.go:68:25: Error return value of `bodyWriter.WriteField` is not checked (errcheck)
-client/client_test.go:73:8: Error return value of `bodyWriter.CreatePart` is not checked (errcheck)
-client/client_test.go:74:12: Error return value of `ff.Write` is not checked (errcheck)
-client/client_test.go:87:10: Error return value of `w.Write` is not checked (errcheck)
-client/client_test.go:102:10: Error return value of `w.Write` is not checked (errcheck)
-client/client_test.go:118:10: Error return value of `w.Write` is not checked (errcheck)
-client/client_test.go:135:10: Error return value of `w.Write` is not checked (errcheck)
-client/errors.go:6:6: var-naming: type RawJsonError should be RawJSONError (revive)
-client/errors.go:6:6: ST1003: type RawJsonError should be RawJSONError (stylecheck)
-client/options.go:5:49: Comment should end in a period (godot)
-client/options.go:16:62: Comment should end in a period (godot)
-client/options.go:23:71: Comment should end in a period (godot)
-client/options.go:39:1: paramTypeCombine: func(key string, value string) Option could be replaced with func(key, value string) Option (gocritic)
-client/options.go:52:51: Comment should end in a period (godot)
-client/websocket.go:47:55: Comment should end in a period (godot)
-client/websocket.go:50:18: Error return value is not checked (errcheck)
-client/websocket.go:54: File is not `gofumpt`-ed (gofumpt)
-client/websocket.go:130:13: dynamicFmtString: use errors.New(string(op.Payload)) or fmt.Errorf("%s", string(op.Payload)) instead (gocritic)
-client/withfilesoption.go:23:3: typeAssertChain: rewrite if-else to type switch statement (gocritic)
-client/withfilesoption.go:47:89: Comment should end in a period (godot)
-client/withfilesoption.go:57:16: Error return value of `json.Marshal` is not checked (errcheck)
-client/withfilesoption.go:58:24: Error return value of `bodyWriter.WriteField` is not checked (errcheck)
-client/withfilesoption.go:76:9: Error return value of `fd.file.Stat` is not checked (errcheck)
-client/withfilesoption.go:77:9: Error return value of `.Stat` is not checked (errcheck)
-client/withfilesoption.go:100:24: Error return value of `bodyWriter.WriteField` is not checked (errcheck)
-client/withfilesoption.go:110:33: sprintfQuotedString: use %q instead of "%s" for quoted strings (gocritic)
-client/withfilesoption.go:111:7: Error return value of `os.ReadFile` is not checked (errcheck)
-client/withfilesoption.go:113:8: Error return value of `bodyWriter.CreatePart` is not checked (errcheck)
-client/withfilesoption.go:114:12: Error return value of `ff.Write` is not checked (errcheck)
-client/withfilesoption.go:132:9: sprintfQuotedString: use %q instead of "%s" for quoted strings (gocritic)
-client/withfilesoption_test.go:18:13: Error return value of `os.CreateTemp` is not checked (errcheck)
-client/withfilesoption_test.go:19:13: Error return value of `os.CreateTemp` is not checked (errcheck)
-client/withfilesoption_test.go:20:13: Error return value of `os.CreateTemp` is not checked (errcheck)
-client/withfilesoption_test.go:24:23: Error return value of `tempFile1.WriteString` is not checked (errcheck)
-client/withfilesoption_test.go:25:23: Error return value of `tempFile2.WriteString` is not checked (errcheck)
-client/withfilesoption_test.go:26:23: Error return value of `tempFile3.WriteString` is not checked (errcheck)
-client/withfilesoption_test.go:37:8: comparing with == will fail on wrapped errors. Use errors.Is to check for a specific error (errorlint)
-client/withfilesoption_test.go:58:11: Error return value of `w.Write` is not checked (errcheck)
-client/withfilesoption_test.go:79:8: comparing with == will fail on wrapped errors. Use errors.Is to check for a specific error (errorlint)
-client/withfilesoption_test.go:109:11: Error return value of `w.Write` is not checked (errcheck)
-client/withfilesoption_test.go:132:8: comparing with == will fail on wrapped errors. Use errors.Is to check for a specific error (errorlint)
-client/withfilesoption_test.go:156:27: badRegexp: `,` is duplicated in [0,1,2] (gocritic)
-client/withfilesoption_test.go:165:11: Error return value of `w.Write` is not checked (errcheck)
-client/withfilesoption_test.go:191:8: comparing with == will fail on wrapped errors. Use errors.Is to check for a specific error (errorlint)
-client/withfilesoption_test.go:225:11: Error return value of `w.Write` is not checked (errcheck)
-codegen/args.go:28:77: Comment should end in a period (godot)
-codegen/args.go:87:4: nestingReduce: invert if cond, replace body with `continue`, move old body after the statement (gocritic)
-codegen/args.go:106:16: ST1016: methods on the same type should have the same receiver name (seen 1x "a", 2x "d") (stylecheck)
-codegen/config/binder.go:18:71: Comment should end in a period (godot)
-codegen/config/binder.go:62:1: paramTypeCombine: func(pkgName string, typeName string) (types.Type, error) could be replaced with func(pkgName, typeName string) (types.Type, error) (gocritic)
-codegen/config/binder.go:92:15: dynamicFmtString: use errors.New(name + " not found in typemap") or fmt.Errorf("%s", name + " not found in typemap") instead (gocritic)
-codegen/config/binder.go:116:1: paramTypeCombine: func(pkgName string, typeName string) (types.Object, error) could be replaced with func(pkgName, typeName string) (types.Object, error) (gocritic)
-codegen/config/binder.go:198:27: ST1016: methods on the same type should have the same receiver name (seen 12x "t", 1x "ref") (stylecheck)
-codegen/config/binder.go:214:1: receiver-naming: receiver name t should be consistent with previous receiver name ref for TypeReference (revive)
-codegen/config/binder.go:219:111: Comment should end in a period (godot)
-codegen/config/binder.go:220:1: receiver-naming: receiver name t should be consistent with previous receiver name ref for TypeReference (revive)
-codegen/config/binder.go:228:1: receiver-naming: receiver name t should be consistent with previous receiver name ref for TypeReference (revive)
-codegen/config/binder.go:232:1: receiver-naming: receiver name t should be consistent with previous receiver name ref for TypeReference (revive)
-codegen/config/binder.go:237:1: receiver-naming: receiver name t should be consistent with previous receiver name ref for TypeReference (revive)
-codegen/config/binder.go:245:1: receiver-naming: receiver name t should be consistent with previous receiver name ref for TypeReference (revive)
-codegen/config/binder.go:250:1: receiver-naming: receiver name t should be consistent with previous receiver name ref for TypeReference (revive)
-codegen/config/binder.go:255:1: receiver-naming: receiver name t should be consistent with previous receiver name ref for TypeReference (revive)
-codegen/config/binder.go:259:1: receiver-naming: receiver name t should be consistent with previous receiver name ref for TypeReference (revive)
-codegen/config/binder.go:273:1: receiver-naming: receiver name t should be consistent with previous receiver name ref for TypeReference (revive)
-codegen/config/binder.go:285:1: receiver-naming: receiver name t should be consistent with previous receiver name ref for TypeReference (revive)
-codegen/config/binder.go:297:1: receiver-naming: receiver name t should be consistent with previous receiver name ref for TypeReference (revive)
-codegen/config/config.go:46:54: Comment should end in a period (godot)
-codegen/config/config.go:60:77: Comment should end in a period (godot)
-codegen/config/config.go:101:47: Comment should end in a period (godot)
-codegen/config/config.go:280:5: nestingReduce: invert if cond, replace body with `continue`, move old body after the statement (gocritic)
-codegen/config/config.go:286:24: Error return value is not checked (errcheck)
-codegen/config/config.go:292:20: Error return value is not checked (errcheck)
-codegen/config/config.go:322:25: yaml(snake): got 'fieldName' want 'field_name' (tagliatelle)
-codegen/config/config.go:481:1: paramTypeCombine: func(name string, goType string) could be replaced with func(name, goType string) (gocritic)
-codegen/config/config.go:502:33: Comment should end in a period (godot)
-codegen/data.go:16:63: Comment should end in a period (godot)
-codegen/data.go:50:130: Comment should end in a period (godot)
-codegen/data.go:210:2: var-naming: don't use underscores in Go names; var __type should be _Type (revive)
-codegen/data.go:210:2: ST1003: should not use underscores in Go names; var __type should be _Type (stylecheck)
-codegen/data.go:224:2: ST1003: should not use underscores in Go names; var __schema should be _Schema (stylecheck)
-codegen/data.go:224:2: var-naming: don't use underscores in Go names; var __schema should be _Schema (revive)
-codegen/directive.go:14:52: Comment should end in a period (godot)
-codegen/directive.go:26:39: Comment should end in a period (godot)
-codegen/field.go:165:10: Error return value is not checked (errcheck)
-codegen/field.go:229:43: Comment should end in a period (godot)
-codegen/field.go:556:10: redundantSprint: use f.TypeReference.GO.String() instead (gocritic)
-codegen/field_test.go:44:9: Error return value is not checked (errcheck)
-codegen/field_test.go:45:10: Error return value is not checked (errcheck)
-codegen/field_test.go:46:10: Error return value is not checked (errcheck)
-codegen/field_test.go:47:9: Error return value is not checked (errcheck)
-codegen/field_test.go:48:11: Error return value is not checked (errcheck)
-codegen/generate.go:100:32: importShadow: shadow of imported from 'github.com/99designs/gqlgen/codegen/config' package 'config' (gocritic)
-codegen/generate.go:116:61: ptrToRefParam: consider `builds' to be of non-pointer type (gocritic)
-codegen/generate.go:158:29: ptrToRefParam: consider `builds' to be of non-pointer type (gocritic)
-codegen/generate.go:170:28: ptrToRefParam: consider `builds' to be of non-pointer type (gocritic)
-codegen/generate.go:182:32: ptrToRefParam: consider `builds' to be of non-pointer type (gocritic)
-codegen/generate.go:202:37: ptrToRefParam: consider `builds' to be of non-pointer type (gocritic)
-codegen/templates/import_test.go:85:6: Error return value of `a.Reserve` is not checked (errcheck)
-codegen/templates/import_test.go:86:6: Error return value of `a.Reserve` is not checked (errcheck)
-codegen/templates/templates.go:188:1: paramTypeCombine: func(width int, pad string, s string) string could be replaced with func(width int, pad, s string) string (gocritic)
-codegen/templates/templates.go:508:68: empty-block: this block is empty, you can remove it (revive)
-codegen/templates/templates.go:566:93: Comment should end in a period (godot)
-codegen/templates/templates.go:734:8: G306: Expect WriteFile permissions to be 0600 or less (gosec)
-codegen/templates/templates_test.go:318: File is not `gofumpt`-ed (gofumpt)
-codegen/templates/templates_test.go:323:2: Error return value of `os.Mkdir` is not checked (errcheck)
-codegen/templates/templates_test.go:337:18: Error return value of `os.ReadFile` is not checked (errcheck)
-codegen/testserver/followschema/complexity_test.go:33:16: json(snake): got 'oneFoo' want 'one_foo' (tagliatelle)
-codegen/testserver/followschema/complexity_test.go:34:16: json(snake): got 'twoFoo' want 'two_foo' (tagliatelle)
-codegen/testserver/followschema/complexity_test.go:35:16: json(snake): got 'oldFoo' want 'old_foo' (tagliatelle)
-codegen/testserver/followschema/complexity_test.go:36:16: json(snake): got 'newFoo' want 'new_foo' (tagliatelle)
-codegen/testserver/followschema/complexity_test.go:37:4: ST1003: should not use underscores in Go names; struct field New_foo should be NewFoo (stylecheck)
-codegen/testserver/followschema/complexity_test.go:37:4: var-naming: don't use underscores in Go names; struct field New_foo should be NewFoo (revive)
-codegen/testserver/followschema/defaults_test.go:12:6: test helper function should start from t.Helper() (thelper)
-codegen/testserver/followschema/directive_test.go:57:3: return both the `nil` error and invalid value: use a sentinel error instead (nilnil)
-codegen/testserver/followschema/directive_test.go:68:36: TestDirectives$11 - result 1 (error) is always nil (unparam)
-codegen/testserver/followschema/directive_test.go:96:14: dynamicFmtString: use errors.New(msg) or fmt.Errorf("%s", msg) instead (gocritic)
-codegen/testserver/followschema/directive_test.go:98:13: dynamicFmtString: use errors.New(*message) or fmt.Errorf("%s", *message) instead (gocritic)
-codegen/testserver/followschema/directive_test.go:105:10: Error return value is not checked (errcheck)
-codegen/testserver/followschema/directive_test.go:157:5: return both the `nil` error and invalid value: use a sentinel error instead (nilnil)
-codegen/testserver/followschema/directive_test.go:171:11: Error return value is not checked (errcheck)
-codegen/testserver/followschema/directive_test.go:178:11: Error return value is not checked (errcheck)
-codegen/testserver/followschema/directive_test.go:187:9: Error return value is not checked (errcheck)
-codegen/testserver/followschema/directive_test.go:192:9: Error return value is not checked (errcheck)
-codegen/testserver/followschema/embedded.go:3:23: Comment should end in a period (godot)
-codegen/testserver/followschema/embedded.go:9:19: Comment should end in a period (godot)
-codegen/testserver/followschema/embedded.go:12:47: Comment should end in a period (godot)
-codegen/testserver/followschema/embedded.go:15:48: Comment should end in a period (godot)
-codegen/testserver/followschema/embedded.go:20:23: Comment should end in a period (godot)
-codegen/testserver/followschema/embedded.go:27:50: Comment should end in a period (godot)
-codegen/testserver/followschema/embedded.go:32:23: Comment should end in a period (godot)
-codegen/testserver/followschema/fields_order.go:4:21: json(snake): got 'firstField' want 'first_field' (tagliatelle)
-codegen/testserver/followschema/fields_order_test.go:14:27: json(snake): got 'firstFieldValue' want 'first_field_value' (tagliatelle)
-codegen/testserver/followschema/fields_order_test.go:15:4: json(snake): got 'overrideValueViaInput' want 'override_value_via_input' (tagliatelle)
-codegen/testserver/followschema/interfaces.go:52:56: Comment should end in a period (godot)
-codegen/testserver/followschema/interfaces_test.go:60:4: return both the `nil` error and invalid value: use a sentinel error instead (nilnil)
-codegen/testserver/followschema/interfaces_test.go:68:7: return both the `nil` error and invalid value: use a sentinel error instead (nilnil)
-codegen/testserver/followschema/introspection_test.go:55:7: json(snake): got '__type' want 'type' (tagliatelle)
-codegen/testserver/followschema/invalid-packagename/invalid-identifier.go:1:1: ST1003: should not use underscores in package names (stylecheck)
-codegen/testserver/followschema/invalid-packagename/invalid-identifier.go:1:9: var-naming: don't use an underscore in package name (revive)
-codegen/testserver/followschema/maps_test.go:19:4: return both the `nil` error and invalid value: use a sentinel error instead (nilnil)
-codegen/testserver/followschema/middleware_test.go:41:9: Error return value is not checked (errcheck)
-codegen/testserver/followschema/middleware_test.go:46:9: Error return value is not checked (errcheck)
-codegen/testserver/followschema/models.go:52:37: unused-parameter: parameter 'v' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/models.go:56:34: unused-parameter: parameter 'w' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/models.go:62:35: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/models.go:62:56: unused-parameter: parameter 'u' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/models.go:71:2: ST1003: struct field IdStr should be IDStr (stylecheck)
-codegen/testserver/followschema/models.go:71:2: var-naming: struct field IdStr should be IDStr (revive)
-codegen/testserver/followschema/models.go:72:2: ST1003: struct field IdInt should be IDInt (stylecheck)
-codegen/testserver/followschema/models.go:72:2: var-naming: struct field IdInt should be IDInt (revive)
-codegen/testserver/followschema/mutation_with_custom_scalar.go:27:10: Error return value of `json.Marshal` is not checked (errcheck)
-codegen/testserver/followschema/mutation_with_custom_scalar.go:28:9: Error return value of `w.Write` is not checked (errcheck)
-codegen/testserver/followschema/nulls_test.go:40:5: var-naming: struct field Id should be ID (revive)
-codegen/testserver/followschema/nulls_test.go:40:5: ST1003: struct field Id should be ID (stylecheck)
-codegen/testserver/followschema/nulls_test.go:122:93: return both the `nil` error and invalid value: use a sentinel error instead (nilnil)
-codegen/testserver/followschema/nulls_test.go:123:93: return both the `nil` error and invalid value: use a sentinel error instead (nilnil)
-codegen/testserver/followschema/nulls_test.go:124:93: return both the `nil` error and invalid value: use a sentinel error instead (nilnil)
-codegen/testserver/followschema/nulls_test.go:125:93: return both the `nil` error and invalid value: use a sentinel error instead (nilnil)
-codegen/testserver/followschema/nulls_test.go:126:93: return both the `nil` error and invalid value: use a sentinel error instead (nilnil)
-codegen/testserver/followschema/ptr_to_ptr_input_test.go:13:32: json(snake): got 'updatePtrToPtr' want 'update_ptr_to_ptr' (tagliatelle)
-codegen/testserver/followschema/resolver.go:15:10: Comment should end in a period (godot)
-codegen/testserver/followschema/resolver.go:16:40: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:16:61: unused-parameter: parameter 'obj' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:20:10: Comment should end in a period (godot)
-codegen/testserver/followschema/resolver.go:21:28: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:21:49: unused-parameter: parameter 'obj' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:25:10: Comment should end in a period (godot)
-codegen/testserver/followschema/resolver.go:26:28: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:26:49: unused-parameter: parameter 'obj' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:30:10: Comment should end in a period (godot)
-codegen/testserver/followschema/resolver.go:31:28: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:31:49: unused-parameter: parameter 'obj' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:35:10: Comment should end in a period (godot)
-codegen/testserver/followschema/resolver.go:36:28: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:36:49: unused-parameter: parameter 'obj' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:40:10: Comment should end in a period (godot)
-codegen/testserver/followschema/resolver.go:41:28: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:41:49: unused-parameter: parameter 'obj' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:45:10: Comment should end in a period (godot)
-codegen/testserver/followschema/resolver.go:46:40: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:46:61: unused-parameter: parameter 'obj' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:50:10: Comment should end in a period (godot)
-codegen/testserver/followschema/resolver.go:51:46: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:51:67: unused-parameter: parameter 'obj' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:55:10: Comment should end in a period (godot)
-codegen/testserver/followschema/resolver.go:56:41: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:56:62: unused-parameter: parameter 'input' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:60:10: Comment should end in a period (godot)
-codegen/testserver/followschema/resolver.go:61:50: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:61:71: unused-parameter: parameter 'input' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:65:10: Comment should end in a period (godot)
-codegen/testserver/followschema/resolver.go:66:44: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:66:65: unused-parameter: parameter 'input' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:70:10: Comment should end in a period (godot)
-codegen/testserver/followschema/resolver.go:71:43: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:71:64: unused-parameter: parameter 'input' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:75:10: Comment should end in a period (godot)
-codegen/testserver/followschema/resolver.go:76:44: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:76:65: unused-parameter: parameter 'obj' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:80:10: Comment should end in a period (godot)
-codegen/testserver/followschema/resolver.go:81:45: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:81:66: unused-parameter: parameter 'obj' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:85:10: Comment should end in a period (godot)
-codegen/testserver/followschema/resolver.go:86:39: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:86:60: unused-parameter: parameter 'obj' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:86:73: unused-parameter: parameter 'u' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:90:10: Comment should end in a period (godot)
-codegen/testserver/followschema/resolver.go:91:31: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:91:52: unused-parameter: parameter 'obj' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:91:62: unused-parameter: parameter 'limit' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:95:10: Comment should end in a period (godot)
-codegen/testserver/followschema/resolver.go:96:35: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:96:56: unused-parameter: parameter 'obj' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:100:10: Comment should end in a period (godot)
-codegen/testserver/followschema/resolver.go:101:41: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:101:62: unused-parameter: parameter 'obj' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:105:10: Comment should end in a period (godot)
-codegen/testserver/followschema/resolver.go:106:39: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:106:60: unused-parameter: parameter 'obj' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:110:10: Comment should end in a period (godot)
-codegen/testserver/followschema/resolver.go:111:43: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:115:10: Comment should end in a period (godot)
-codegen/testserver/followschema/resolver.go:116:35: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:120:10: Comment should end in a period (godot)
-codegen/testserver/followschema/resolver.go:121:34: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:121:55: unused-parameter: parameter 'input' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:125:10: Comment should end in a period (godot)
-codegen/testserver/followschema/resolver.go:126:35: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:126:56: unused-parameter: parameter 'input' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:130:10: Comment should end in a period (godot)
-codegen/testserver/followschema/resolver.go:131:38: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:131:59: unused-parameter: parameter 'input' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:135:10: Comment should end in a period (godot)
-codegen/testserver/followschema/resolver.go:136:39: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:140:10: Comment should end in a period (godot)
-codegen/testserver/followschema/resolver.go:141:38: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:145:10: Comment should end in a period (godot)
-codegen/testserver/followschema/resolver.go:146:30: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:146:51: unused-parameter: parameter 'id' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:150:10: Comment should end in a period (godot)
-codegen/testserver/followschema/resolver.go:151:37: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:151:58: unused-parameter: parameter 'arg' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:155:10: Comment should end in a period (godot)
-codegen/testserver/followschema/resolver.go:156:36: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:156:57: unused-parameter: parameter 'arg' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:160:10: Comment should end in a period (godot)
-codegen/testserver/followschema/resolver.go:161:44: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:161:65: unused-parameter: parameter 'arg' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:165:10: Comment should end in a period (godot)
-codegen/testserver/followschema/resolver.go:166:36: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:170:10: Comment should end in a period (godot)
-codegen/testserver/followschema/resolver.go:171:34: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:175:10: Comment should end in a period (godot)
-codegen/testserver/followschema/resolver.go:176:41: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:180:10: Comment should end in a period (godot)
-codegen/testserver/followschema/resolver.go:181:37: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:185:10: Comment should end in a period (godot)
-codegen/testserver/followschema/resolver.go:186:1: paramTypeCombine: func(ctx context.Context, falsyBoolean *bool, truthyBoolean *bool) (*DefaultParametersMirror, error) could be replaced with func(ctx context.Context, falsyBoolean, truthyBoolean *bool) (*DefaultParametersMirror, error) (gocritic)
-codegen/testserver/followschema/resolver.go:186:43: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:186:64: unused-parameter: parameter 'falsyBoolean' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:186:84: unused-parameter: parameter 'truthyBoolean' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:190:10: Comment should end in a period (godot)
-codegen/testserver/followschema/resolver.go:191:38: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:191:59: unused-parameter: parameter 'arg' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:195:10: Comment should end in a period (godot)
-codegen/testserver/followschema/resolver.go:196:1: paramTypeCombine: func(ctx context.Context, arg *int, arg2 *int, arg3 *string) (*string, error) could be replaced with func(ctx context.Context, arg, arg2 *int, arg3 *string) (*string, error) (gocritic)
-codegen/testserver/followschema/resolver.go:196:46: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:196:67: unused-parameter: parameter 'arg' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:196:77: unused-parameter: parameter 'arg2' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:196:88: unused-parameter: parameter 'arg3' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:200:10: Comment should end in a period (godot)
-codegen/testserver/followschema/resolver.go:201:48: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:201:69: unused-parameter: parameter 'arg' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:205:10: Comment should end in a period (godot)
-codegen/testserver/followschema/resolver.go:206:40: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:206:61: unused-parameter: parameter 'arg' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:210:10: Comment should end in a period (godot)
-codegen/testserver/followschema/resolver.go:211:44: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:211:65: unused-parameter: parameter 'arg' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:215:10: Comment should end in a period (godot)
-codegen/testserver/followschema/resolver.go:216:41: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:220:10: Comment should end in a period (godot)
-codegen/testserver/followschema/resolver.go:221:58: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:225:10: Comment should end in a period (godot)
-codegen/testserver/followschema/resolver.go:226:43: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:226:64: unused-parameter: parameter 'ret' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:230:10: Comment should end in a period (godot)
-codegen/testserver/followschema/resolver.go:231:40: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:235:10: Comment should end in a period (godot)
-codegen/testserver/followschema/resolver.go:236:41: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:240:10: Comment should end in a period (godot)
-codegen/testserver/followschema/resolver.go:241:48: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:245:10: Comment should end in a period (godot)
-codegen/testserver/followschema/resolver.go:246:39: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:250:10: Comment should end in a period (godot)
-codegen/testserver/followschema/resolver.go:251:39: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:255:10: Comment should end in a period (godot)
-codegen/testserver/followschema/resolver.go:256:39: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:260:10: Comment should end in a period (godot)
-codegen/testserver/followschema/resolver.go:261:37: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:261:58: unused-parameter: parameter 'input' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:265:10: Comment should end in a period (godot)
-codegen/testserver/followschema/resolver.go:266:32: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:270:10: Comment should end in a period (godot)
-codegen/testserver/followschema/resolver.go:271:33: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:275:10: Comment should end in a period (godot)
-codegen/testserver/followschema/resolver.go:276:30: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:280:10: Comment should end in a period (godot)
-codegen/testserver/followschema/resolver.go:281:41: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:285:10: Comment should end in a period (godot)
-codegen/testserver/followschema/resolver.go:286:32: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:290:10: Comment should end in a period (godot)
-codegen/testserver/followschema/resolver.go:291:40: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:295:10: Comment should end in a period (godot)
-codegen/testserver/followschema/resolver.go:296:29: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:300:10: Comment should end in a period (godot)
-codegen/testserver/followschema/resolver.go:301:35: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:305:10: Comment should end in a period (godot)
-codegen/testserver/followschema/resolver.go:306:44: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:306:65: unused-parameter: parameter 'in' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:310:10: Comment should end in a period (godot)
-codegen/testserver/followschema/resolver.go:311:50: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:311:71: unused-parameter: parameter 'in' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:315:10: Comment should end in a period (godot)
-codegen/testserver/followschema/resolver.go:316:37: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:320:10: Comment should end in a period (godot)
-codegen/testserver/followschema/resolver.go:321:41: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:325:10: Comment should end in a period (godot)
-codegen/testserver/followschema/resolver.go:326:35: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:330:10: Comment should end in a period (godot)
-codegen/testserver/followschema/resolver.go:331:32: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:335:10: Comment should end in a period (godot)
-codegen/testserver/followschema/resolver.go:336:31: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:340:10: Comment should end in a period (godot)
-codegen/testserver/followschema/resolver.go:341:33: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:345:10: Comment should end in a period (godot)
-codegen/testserver/followschema/resolver.go:346:32: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:350:10: Comment should end in a period (godot)
-codegen/testserver/followschema/resolver.go:351:41: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:355:10: Comment should end in a period (godot)
-codegen/testserver/followschema/resolver.go:356:47: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:360:10: Comment should end in a period (godot)
-codegen/testserver/followschema/resolver.go:361:45: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:365:10: Comment should end in a period (godot)
-codegen/testserver/followschema/resolver.go:366:34: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:370:10: Comment should end in a period (godot)
-codegen/testserver/followschema/resolver.go:371:52: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:375:10: Comment should end in a period (godot)
-codegen/testserver/followschema/resolver.go:376:51: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:380:10: Comment should end in a period (godot)
-codegen/testserver/followschema/resolver.go:381:39: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:381:60: unused-parameter: parameter 'arg' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:385:10: Comment should end in a period (godot)
-codegen/testserver/followschema/resolver.go:386:32: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:390:10: Comment should end in a period (godot)
-codegen/testserver/followschema/resolver.go:391:37: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:395:10: Comment should end in a period (godot)
-codegen/testserver/followschema/resolver.go:396:34: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:396:55: unused-parameter: parameter 'arg' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:400:10: Comment should end in a period (godot)
-codegen/testserver/followschema/resolver.go:401:39: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:405:10: Comment should end in a period (godot)
-codegen/testserver/followschema/resolver.go:406:38: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:410:10: Comment should end in a period (godot)
-codegen/testserver/followschema/resolver.go:411:36: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:415:10: Comment should end in a period (godot)
-codegen/testserver/followschema/resolver.go:416:35: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:420:10: Comment should end in a period (godot)
-codegen/testserver/followschema/resolver.go:421:39: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:425:10: Comment should end in a period (godot)
-codegen/testserver/followschema/resolver.go:426:39: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:430:10: Comment should end in a period (godot)
-codegen/testserver/followschema/resolver.go:431:39: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:435:10: Comment should end in a period (godot)
-codegen/testserver/followschema/resolver.go:436:36: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:440:10: Comment should end in a period (godot)
-codegen/testserver/followschema/resolver.go:441:38: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:445:10: Comment should end in a period (godot)
-codegen/testserver/followschema/resolver.go:446:40: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:450:10: Comment should end in a period (godot)
-codegen/testserver/followschema/resolver.go:451:44: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:455:10: Comment should end in a period (godot)
-codegen/testserver/followschema/resolver.go:456:45: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:456:66: unused-parameter: parameter 'arg' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:460:10: Comment should end in a period (godot)
-codegen/testserver/followschema/resolver.go:461:1: paramTypeCombine: func(ctx context.Context, arg *int, arg2 *int, arg3 *string) (<-chan *string, error) could be replaced with func(ctx context.Context, arg, arg2 *int, arg3 *string) (<-chan *string, error) (gocritic)
-codegen/testserver/followschema/resolver.go:461:53: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:461:74: unused-parameter: parameter 'arg' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:461:84: unused-parameter: parameter 'arg2' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:461:95: unused-parameter: parameter 'arg3' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:465:10: Comment should end in a period (godot)
-codegen/testserver/followschema/resolver.go:466:48: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:470:10: Comment should end in a period (godot)
-codegen/testserver/followschema/resolver.go:471:55: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:475:10: Comment should end in a period (godot)
-codegen/testserver/followschema/resolver.go:476:42: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:480:10: Comment should end in a period (godot)
-codegen/testserver/followschema/resolver.go:481:46: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:485:10: Comment should end in a period (godot)
-codegen/testserver/followschema/resolver.go:486:32: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:486:53: unused-parameter: parameter 'obj' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:490:10: Comment should end in a period (godot)
-codegen/testserver/followschema/resolver.go:491:29: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:491:50: unused-parameter: parameter 'obj' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:491:61: unused-parameter: parameter 'limit' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:495:10: Comment should end in a period (godot)
-codegen/testserver/followschema/resolver.go:496:34: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:496:55: unused-parameter: parameter 'obj' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:496:71: unused-parameter: parameter 'key' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:500:10: Comment should end in a period (godot)
-codegen/testserver/followschema/resolver.go:501:36: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:501:57: unused-parameter: parameter 'obj' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:501:75: unused-parameter: parameter 'idx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/resolver.go:554: File is not `gofumpt`-ed (gofumpt)
-codegen/testserver/followschema/resolver.go:554:1: typeDefFirst: definition of type 'backedByInterfaceResolver' should appear before its methods (gocritic)
-codegen/testserver/followschema/resolver.go:555:1: typeDefFirst: definition of type 'errorsResolver' should appear before its methods (gocritic)
-codegen/testserver/followschema/resolver.go:556:1: typeDefFirst: definition of type 'forcedResolverResolver' should appear before its methods (gocritic)
-codegen/testserver/followschema/resolver.go:557:1: typeDefFirst: definition of type 'modelMethodsResolver' should appear before its methods (gocritic)
-codegen/testserver/followschema/resolver.go:558:1: typeDefFirst: definition of type 'mutationResolver' should appear before its methods (gocritic)
-codegen/testserver/followschema/resolver.go:559:1: typeDefFirst: definition of type 'overlappingFieldsResolver' should appear before its methods (gocritic)
-codegen/testserver/followschema/resolver.go:560:1: typeDefFirst: definition of type 'panicsResolver' should appear before its methods (gocritic)
-codegen/testserver/followschema/resolver.go:561:1: typeDefFirst: definition of type 'petResolver' should appear before its methods (gocritic)
-codegen/testserver/followschema/resolver.go:562:1: typeDefFirst: definition of type 'primitiveResolver' should appear before its methods (gocritic)
-codegen/testserver/followschema/resolver.go:563:1: typeDefFirst: definition of type 'primitiveStringResolver' should appear before its methods (gocritic)
-codegen/testserver/followschema/resolver.go:564:1: typeDefFirst: definition of type 'queryResolver' should appear before its methods (gocritic)
-codegen/testserver/followschema/resolver.go:565:1: typeDefFirst: definition of type 'subscriptionResolver' should appear before its methods (gocritic)
-codegen/testserver/followschema/resolver.go:566:1: typeDefFirst: definition of type 'userResolver' should appear before its methods (gocritic)
-codegen/testserver/followschema/resolver.go:567:1: typeDefFirst: definition of type 'wrappedMapResolver' should appear before its methods (gocritic)
-codegen/testserver/followschema/resolver.go:568:1: typeDefFirst: definition of type 'wrappedSliceResolver' should appear before its methods (gocritic)
-codegen/testserver/followschema/response_extension_test.go:31:7: Error return value of `c.RawPost` is not checked (errcheck)
-codegen/testserver/followschema/scalar_context.go:21:16: Error return value of `io.WriteString` is not checked (errcheck)
-codegen/testserver/followschema/scalar_context.go:25:79: unused-parameter: parameter 'v' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/scalar_context.go:30:39: unused-parameter: parameter 'v' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/scalar_context.go:32:17: Error return value of `io.WriteString` is not checked (errcheck)
-codegen/testserver/followschema/scalar_context.go:37:62: unused-parameter: parameter 'v' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/subscription_test.go:93:9: Error return value is not checked (errcheck)
-codegen/testserver/followschema/subscription_test.go:98:9: Error return value is not checked (errcheck)
-codegen/testserver/followschema/subscription_test.go:121:12: Error return value is not checked (errcheck)
-codegen/testserver/followschema/subscription_test.go:157:12: Error return value is not checked (errcheck)
-codegen/testserver/followschema/subscription_test.go:171:6: var-naming: struct field Id should be ID (revive)
-codegen/testserver/followschema/subscription_test.go:171:6: ST1003: struct field Id should be ID (stylecheck)
-codegen/testserver/followschema/subscription_test.go:184:12: Error return value is not checked (errcheck)
-codegen/testserver/followschema/v-ok.go:3:22: Comment should end in a period (godot)
-codegen/testserver/followschema/v-ok.go:10:20: Comment should end in a period (godot)
-codegen/testserver/followschema/validtypes_test.go:26:16: json(snake): got 'differentCase' want 'different_case' (tagliatelle)
-codegen/testserver/followschema/variadic.go:12:30: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/followschema/variadic.go:12:61: unused-parameter: parameter 'opts' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/complexity_test.go:33:16: json(snake): got 'oneFoo' want 'one_foo' (tagliatelle)
-codegen/testserver/singlefile/complexity_test.go:34:16: json(snake): got 'twoFoo' want 'two_foo' (tagliatelle)
-codegen/testserver/singlefile/complexity_test.go:35:16: json(snake): got 'oldFoo' want 'old_foo' (tagliatelle)
-codegen/testserver/singlefile/complexity_test.go:36:16: json(snake): got 'newFoo' want 'new_foo' (tagliatelle)
-codegen/testserver/singlefile/complexity_test.go:37:4: var-naming: don't use underscores in Go names; struct field New_foo should be NewFoo (revive)
-codegen/testserver/singlefile/complexity_test.go:37:4: ST1003: should not use underscores in Go names; struct field New_foo should be NewFoo (stylecheck)
-codegen/testserver/singlefile/defaults_test.go:12:6: test helper function should start from t.Helper() (thelper)
-codegen/testserver/singlefile/directive_test.go:57:3: return both the `nil` error and invalid value: use a sentinel error instead (nilnil)
-codegen/testserver/singlefile/directive_test.go:68:36: TestDirectives$11 - result 1 (error) is always nil (unparam)
-codegen/testserver/singlefile/directive_test.go:96:14: dynamicFmtString: use errors.New(msg) or fmt.Errorf("%s", msg) instead (gocritic)
-codegen/testserver/singlefile/directive_test.go:98:13: dynamicFmtString: use errors.New(*message) or fmt.Errorf("%s", *message) instead (gocritic)
-codegen/testserver/singlefile/directive_test.go:105:10: Error return value is not checked (errcheck)
-codegen/testserver/singlefile/directive_test.go:157:5: return both the `nil` error and invalid value: use a sentinel error instead (nilnil)
-codegen/testserver/singlefile/directive_test.go:171:11: Error return value is not checked (errcheck)
-codegen/testserver/singlefile/directive_test.go:178:11: Error return value is not checked (errcheck)
-codegen/testserver/singlefile/directive_test.go:187:9: Error return value is not checked (errcheck)
-codegen/testserver/singlefile/directive_test.go:192:9: Error return value is not checked (errcheck)
-codegen/testserver/singlefile/embedded.go:3:23: Comment should end in a period (godot)
-codegen/testserver/singlefile/embedded.go:9:19: Comment should end in a period (godot)
-codegen/testserver/singlefile/embedded.go:12:47: Comment should end in a period (godot)
-codegen/testserver/singlefile/embedded.go:15:48: Comment should end in a period (godot)
-codegen/testserver/singlefile/embedded.go:20:23: Comment should end in a period (godot)
-codegen/testserver/singlefile/embedded.go:27:50: Comment should end in a period (godot)
-codegen/testserver/singlefile/embedded.go:32:23: Comment should end in a period (godot)
-codegen/testserver/singlefile/fields_order.go:4:21: json(snake): got 'firstField' want 'first_field' (tagliatelle)
-codegen/testserver/singlefile/fields_order_test.go:14:27: json(snake): got 'firstFieldValue' want 'first_field_value' (tagliatelle)
-codegen/testserver/singlefile/fields_order_test.go:15:4: json(snake): got 'overrideValueViaInput' want 'override_value_via_input' (tagliatelle)
-codegen/testserver/singlefile/interfaces.go:52:56: Comment should end in a period (godot)
-codegen/testserver/singlefile/interfaces_test.go:60:4: return both the `nil` error and invalid value: use a sentinel error instead (nilnil)
-codegen/testserver/singlefile/interfaces_test.go:68:7: return both the `nil` error and invalid value: use a sentinel error instead (nilnil)
-codegen/testserver/singlefile/introspection_test.go:55:7: json(snake): got '__type' want 'type' (tagliatelle)
-codegen/testserver/singlefile/invalid-packagename/invalid-identifier.go:1:1: ST1003: should not use underscores in package names (stylecheck)
-codegen/testserver/singlefile/invalid-packagename/invalid-identifier.go:1:9: var-naming: don't use an underscore in package name (revive)
-codegen/testserver/singlefile/maps_test.go:19:4: return both the `nil` error and invalid value: use a sentinel error instead (nilnil)
-codegen/testserver/singlefile/middleware_test.go:49:9: Error return value is not checked (errcheck)
-codegen/testserver/singlefile/middleware_test.go:54:9: Error return value is not checked (errcheck)
-codegen/testserver/singlefile/models.go:52:37: unused-parameter: parameter 'v' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/models.go:56:34: unused-parameter: parameter 'w' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/models.go:62:35: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/models.go:62:56: unused-parameter: parameter 'u' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/models.go:71:2: ST1003: struct field IdStr should be IDStr (stylecheck)
-codegen/testserver/singlefile/models.go:71:2: var-naming: struct field IdStr should be IDStr (revive)
-codegen/testserver/singlefile/models.go:72:2: var-naming: struct field IdInt should be IDInt (revive)
-codegen/testserver/singlefile/models.go:72:2: ST1003: struct field IdInt should be IDInt (stylecheck)
-codegen/testserver/singlefile/mutation_with_custom_scalar.go:27:10: Error return value of `json.Marshal` is not checked (errcheck)
-codegen/testserver/singlefile/mutation_with_custom_scalar.go:28:9: Error return value of `w.Write` is not checked (errcheck)
-codegen/testserver/singlefile/nulls_test.go:40:5: var-naming: struct field Id should be ID (revive)
-codegen/testserver/singlefile/nulls_test.go:40:5: ST1003: struct field Id should be ID (stylecheck)
-codegen/testserver/singlefile/nulls_test.go:122:93: return both the `nil` error and invalid value: use a sentinel error instead (nilnil)
-codegen/testserver/singlefile/nulls_test.go:123:93: return both the `nil` error and invalid value: use a sentinel error instead (nilnil)
-codegen/testserver/singlefile/nulls_test.go:124:93: return both the `nil` error and invalid value: use a sentinel error instead (nilnil)
-codegen/testserver/singlefile/nulls_test.go:125:93: return both the `nil` error and invalid value: use a sentinel error instead (nilnil)
-codegen/testserver/singlefile/nulls_test.go:126:93: return both the `nil` error and invalid value: use a sentinel error instead (nilnil)
-codegen/testserver/singlefile/ptr_to_ptr_input_test.go:13:32: json(snake): got 'updatePtrToPtr' want 'update_ptr_to_ptr' (tagliatelle)
-codegen/testserver/singlefile/resolver.go:15:10: Comment should end in a period (godot)
-codegen/testserver/singlefile/resolver.go:16:40: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:16:61: unused-parameter: parameter 'obj' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:20:10: Comment should end in a period (godot)
-codegen/testserver/singlefile/resolver.go:21:28: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:21:49: unused-parameter: parameter 'obj' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:25:10: Comment should end in a period (godot)
-codegen/testserver/singlefile/resolver.go:26:28: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:26:49: unused-parameter: parameter 'obj' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:30:10: Comment should end in a period (godot)
-codegen/testserver/singlefile/resolver.go:31:28: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:31:49: unused-parameter: parameter 'obj' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:35:10: Comment should end in a period (godot)
-codegen/testserver/singlefile/resolver.go:36:28: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:36:49: unused-parameter: parameter 'obj' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:40:10: Comment should end in a period (godot)
-codegen/testserver/singlefile/resolver.go:41:28: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:41:49: unused-parameter: parameter 'obj' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:45:10: Comment should end in a period (godot)
-codegen/testserver/singlefile/resolver.go:46:40: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:46:61: unused-parameter: parameter 'obj' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:50:10: Comment should end in a period (godot)
-codegen/testserver/singlefile/resolver.go:51:46: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:51:67: unused-parameter: parameter 'obj' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:55:10: Comment should end in a period (godot)
-codegen/testserver/singlefile/resolver.go:56:41: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:56:62: unused-parameter: parameter 'input' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:60:10: Comment should end in a period (godot)
-codegen/testserver/singlefile/resolver.go:61:50: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:61:71: unused-parameter: parameter 'input' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:65:10: Comment should end in a period (godot)
-codegen/testserver/singlefile/resolver.go:66:44: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:66:65: unused-parameter: parameter 'input' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:70:10: Comment should end in a period (godot)
-codegen/testserver/singlefile/resolver.go:71:43: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:71:64: unused-parameter: parameter 'input' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:75:10: Comment should end in a period (godot)
-codegen/testserver/singlefile/resolver.go:76:44: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:76:65: unused-parameter: parameter 'obj' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:80:10: Comment should end in a period (godot)
-codegen/testserver/singlefile/resolver.go:81:45: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:81:66: unused-parameter: parameter 'obj' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:85:10: Comment should end in a period (godot)
-codegen/testserver/singlefile/resolver.go:86:39: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:86:60: unused-parameter: parameter 'obj' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:86:73: unused-parameter: parameter 'u' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:90:10: Comment should end in a period (godot)
-codegen/testserver/singlefile/resolver.go:91:31: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:91:52: unused-parameter: parameter 'obj' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:91:62: unused-parameter: parameter 'limit' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:95:10: Comment should end in a period (godot)
-codegen/testserver/singlefile/resolver.go:96:35: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:96:56: unused-parameter: parameter 'obj' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:100:10: Comment should end in a period (godot)
-codegen/testserver/singlefile/resolver.go:101:41: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:101:62: unused-parameter: parameter 'obj' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:105:10: Comment should end in a period (godot)
-codegen/testserver/singlefile/resolver.go:106:39: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:106:60: unused-parameter: parameter 'obj' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:110:10: Comment should end in a period (godot)
-codegen/testserver/singlefile/resolver.go:111:43: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:115:10: Comment should end in a period (godot)
-codegen/testserver/singlefile/resolver.go:116:35: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:120:10: Comment should end in a period (godot)
-codegen/testserver/singlefile/resolver.go:121:34: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:121:55: unused-parameter: parameter 'input' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:125:10: Comment should end in a period (godot)
-codegen/testserver/singlefile/resolver.go:126:35: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:126:56: unused-parameter: parameter 'input' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:130:10: Comment should end in a period (godot)
-codegen/testserver/singlefile/resolver.go:131:38: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:131:59: unused-parameter: parameter 'input' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:135:10: Comment should end in a period (godot)
-codegen/testserver/singlefile/resolver.go:136:39: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:140:10: Comment should end in a period (godot)
-codegen/testserver/singlefile/resolver.go:141:38: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:145:10: Comment should end in a period (godot)
-codegen/testserver/singlefile/resolver.go:146:30: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:146:51: unused-parameter: parameter 'id' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:150:10: Comment should end in a period (godot)
-codegen/testserver/singlefile/resolver.go:151:37: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:151:58: unused-parameter: parameter 'arg' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:155:10: Comment should end in a period (godot)
-codegen/testserver/singlefile/resolver.go:156:36: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:156:57: unused-parameter: parameter 'arg' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:160:10: Comment should end in a period (godot)
-codegen/testserver/singlefile/resolver.go:161:44: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:161:65: unused-parameter: parameter 'arg' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:165:10: Comment should end in a period (godot)
-codegen/testserver/singlefile/resolver.go:166:36: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:170:10: Comment should end in a period (godot)
-codegen/testserver/singlefile/resolver.go:171:34: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:175:10: Comment should end in a period (godot)
-codegen/testserver/singlefile/resolver.go:176:41: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:180:10: Comment should end in a period (godot)
-codegen/testserver/singlefile/resolver.go:181:37: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:185:10: Comment should end in a period (godot)
-codegen/testserver/singlefile/resolver.go:186:1: paramTypeCombine: func(ctx context.Context, falsyBoolean *bool, truthyBoolean *bool) (*DefaultParametersMirror, error) could be replaced with func(ctx context.Context, falsyBoolean, truthyBoolean *bool) (*DefaultParametersMirror, error) (gocritic)
-codegen/testserver/singlefile/resolver.go:186:43: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:186:64: unused-parameter: parameter 'falsyBoolean' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:186:84: unused-parameter: parameter 'truthyBoolean' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:190:10: Comment should end in a period (godot)
-codegen/testserver/singlefile/resolver.go:191:38: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:191:59: unused-parameter: parameter 'arg' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:195:10: Comment should end in a period (godot)
-codegen/testserver/singlefile/resolver.go:196:1: paramTypeCombine: func(ctx context.Context, arg *int, arg2 *int, arg3 *string) (*string, error) could be replaced with func(ctx context.Context, arg, arg2 *int, arg3 *string) (*string, error) (gocritic)
-codegen/testserver/singlefile/resolver.go:196:46: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:196:67: unused-parameter: parameter 'arg' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:196:77: unused-parameter: parameter 'arg2' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:196:88: unused-parameter: parameter 'arg3' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:200:10: Comment should end in a period (godot)
-codegen/testserver/singlefile/resolver.go:201:48: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:201:69: unused-parameter: parameter 'arg' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:205:10: Comment should end in a period (godot)
-codegen/testserver/singlefile/resolver.go:206:40: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:206:61: unused-parameter: parameter 'arg' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:210:10: Comment should end in a period (godot)
-codegen/testserver/singlefile/resolver.go:211:44: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:211:65: unused-parameter: parameter 'arg' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:215:10: Comment should end in a period (godot)
-codegen/testserver/singlefile/resolver.go:216:41: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:220:10: Comment should end in a period (godot)
-codegen/testserver/singlefile/resolver.go:221:58: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:225:10: Comment should end in a period (godot)
-codegen/testserver/singlefile/resolver.go:226:43: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:226:64: unused-parameter: parameter 'ret' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:230:10: Comment should end in a period (godot)
-codegen/testserver/singlefile/resolver.go:231:40: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:235:10: Comment should end in a period (godot)
-codegen/testserver/singlefile/resolver.go:236:41: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:240:10: Comment should end in a period (godot)
-codegen/testserver/singlefile/resolver.go:241:48: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:245:10: Comment should end in a period (godot)
-codegen/testserver/singlefile/resolver.go:246:39: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:250:10: Comment should end in a period (godot)
-codegen/testserver/singlefile/resolver.go:251:39: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:255:10: Comment should end in a period (godot)
-codegen/testserver/singlefile/resolver.go:256:39: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:260:10: Comment should end in a period (godot)
-codegen/testserver/singlefile/resolver.go:261:37: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:261:58: unused-parameter: parameter 'input' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:265:10: Comment should end in a period (godot)
-codegen/testserver/singlefile/resolver.go:266:32: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:270:10: Comment should end in a period (godot)
-codegen/testserver/singlefile/resolver.go:271:33: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:275:10: Comment should end in a period (godot)
-codegen/testserver/singlefile/resolver.go:276:30: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:280:10: Comment should end in a period (godot)
-codegen/testserver/singlefile/resolver.go:281:41: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:285:10: Comment should end in a period (godot)
-codegen/testserver/singlefile/resolver.go:286:32: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:290:10: Comment should end in a period (godot)
-codegen/testserver/singlefile/resolver.go:291:40: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:295:10: Comment should end in a period (godot)
-codegen/testserver/singlefile/resolver.go:296:29: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:300:10: Comment should end in a period (godot)
-codegen/testserver/singlefile/resolver.go:301:35: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:305:10: Comment should end in a period (godot)
-codegen/testserver/singlefile/resolver.go:306:44: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:306:65: unused-parameter: parameter 'in' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:310:10: Comment should end in a period (godot)
-codegen/testserver/singlefile/resolver.go:311:50: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:311:71: unused-parameter: parameter 'in' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:315:10: Comment should end in a period (godot)
-codegen/testserver/singlefile/resolver.go:316:37: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:320:10: Comment should end in a period (godot)
-codegen/testserver/singlefile/resolver.go:321:41: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:325:10: Comment should end in a period (godot)
-codegen/testserver/singlefile/resolver.go:326:35: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:330:10: Comment should end in a period (godot)
-codegen/testserver/singlefile/resolver.go:331:32: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:335:10: Comment should end in a period (godot)
-codegen/testserver/singlefile/resolver.go:336:31: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:340:10: Comment should end in a period (godot)
-codegen/testserver/singlefile/resolver.go:341:33: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:345:10: Comment should end in a period (godot)
-codegen/testserver/singlefile/resolver.go:346:32: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:350:10: Comment should end in a period (godot)
-codegen/testserver/singlefile/resolver.go:351:41: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:355:10: Comment should end in a period (godot)
-codegen/testserver/singlefile/resolver.go:356:47: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:360:10: Comment should end in a period (godot)
-codegen/testserver/singlefile/resolver.go:361:45: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:365:10: Comment should end in a period (godot)
-codegen/testserver/singlefile/resolver.go:366:34: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:370:10: Comment should end in a period (godot)
-codegen/testserver/singlefile/resolver.go:371:52: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:375:10: Comment should end in a period (godot)
-codegen/testserver/singlefile/resolver.go:376:51: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:380:10: Comment should end in a period (godot)
-codegen/testserver/singlefile/resolver.go:381:39: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:381:60: unused-parameter: parameter 'arg' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:385:10: Comment should end in a period (godot)
-codegen/testserver/singlefile/resolver.go:386:32: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:390:10: Comment should end in a period (godot)
-codegen/testserver/singlefile/resolver.go:391:37: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:395:10: Comment should end in a period (godot)
-codegen/testserver/singlefile/resolver.go:396:34: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:396:55: unused-parameter: parameter 'arg' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:400:10: Comment should end in a period (godot)
-codegen/testserver/singlefile/resolver.go:401:39: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:405:10: Comment should end in a period (godot)
-codegen/testserver/singlefile/resolver.go:406:38: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:410:10: Comment should end in a period (godot)
-codegen/testserver/singlefile/resolver.go:411:36: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:415:10: Comment should end in a period (godot)
-codegen/testserver/singlefile/resolver.go:416:35: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:420:10: Comment should end in a period (godot)
-codegen/testserver/singlefile/resolver.go:421:39: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:425:10: Comment should end in a period (godot)
-codegen/testserver/singlefile/resolver.go:426:39: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:430:10: Comment should end in a period (godot)
-codegen/testserver/singlefile/resolver.go:431:39: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:435:10: Comment should end in a period (godot)
-codegen/testserver/singlefile/resolver.go:436:36: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:440:10: Comment should end in a period (godot)
-codegen/testserver/singlefile/resolver.go:441:38: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:445:10: Comment should end in a period (godot)
-codegen/testserver/singlefile/resolver.go:446:40: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:450:10: Comment should end in a period (godot)
-codegen/testserver/singlefile/resolver.go:451:44: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:455:10: Comment should end in a period (godot)
-codegen/testserver/singlefile/resolver.go:456:45: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:456:66: unused-parameter: parameter 'arg' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:460:10: Comment should end in a period (godot)
-codegen/testserver/singlefile/resolver.go:461:1: paramTypeCombine: func(ctx context.Context, arg *int, arg2 *int, arg3 *string) (<-chan *string, error) could be replaced with func(ctx context.Context, arg, arg2 *int, arg3 *string) (<-chan *string, error) (gocritic)
-codegen/testserver/singlefile/resolver.go:461:53: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:461:74: unused-parameter: parameter 'arg' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:461:84: unused-parameter: parameter 'arg2' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:461:95: unused-parameter: parameter 'arg3' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:465:10: Comment should end in a period (godot)
-codegen/testserver/singlefile/resolver.go:466:48: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:470:10: Comment should end in a period (godot)
-codegen/testserver/singlefile/resolver.go:471:55: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:475:10: Comment should end in a period (godot)
-codegen/testserver/singlefile/resolver.go:476:42: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:480:10: Comment should end in a period (godot)
-codegen/testserver/singlefile/resolver.go:481:46: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:485:10: Comment should end in a period (godot)
-codegen/testserver/singlefile/resolver.go:486:32: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:486:53: unused-parameter: parameter 'obj' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:490:10: Comment should end in a period (godot)
-codegen/testserver/singlefile/resolver.go:491:29: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:491:50: unused-parameter: parameter 'obj' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:491:61: unused-parameter: parameter 'limit' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:495:10: Comment should end in a period (godot)
-codegen/testserver/singlefile/resolver.go:496:34: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:496:55: unused-parameter: parameter 'obj' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:496:71: unused-parameter: parameter 'key' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:500:10: Comment should end in a period (godot)
-codegen/testserver/singlefile/resolver.go:501:36: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:501:57: unused-parameter: parameter 'obj' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:501:75: unused-parameter: parameter 'idx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/resolver.go:554: File is not `gofumpt`-ed (gofumpt)
-codegen/testserver/singlefile/resolver.go:554:1: typeDefFirst: definition of type 'backedByInterfaceResolver' should appear before its methods (gocritic)
-codegen/testserver/singlefile/resolver.go:555:1: typeDefFirst: definition of type 'errorsResolver' should appear before its methods (gocritic)
-codegen/testserver/singlefile/resolver.go:556:1: typeDefFirst: definition of type 'forcedResolverResolver' should appear before its methods (gocritic)
-codegen/testserver/singlefile/resolver.go:557:1: typeDefFirst: definition of type 'modelMethodsResolver' should appear before its methods (gocritic)
-codegen/testserver/singlefile/resolver.go:558:1: typeDefFirst: definition of type 'mutationResolver' should appear before its methods (gocritic)
-codegen/testserver/singlefile/resolver.go:559:1: typeDefFirst: definition of type 'overlappingFieldsResolver' should appear before its methods (gocritic)
-codegen/testserver/singlefile/resolver.go:560:1: typeDefFirst: definition of type 'panicsResolver' should appear before its methods (gocritic)
-codegen/testserver/singlefile/resolver.go:561:1: typeDefFirst: definition of type 'petResolver' should appear before its methods (gocritic)
-codegen/testserver/singlefile/resolver.go:562:1: typeDefFirst: definition of type 'primitiveResolver' should appear before its methods (gocritic)
-codegen/testserver/singlefile/resolver.go:563:1: typeDefFirst: definition of type 'primitiveStringResolver' should appear before its methods (gocritic)
-codegen/testserver/singlefile/resolver.go:564:1: typeDefFirst: definition of type 'queryResolver' should appear before its methods (gocritic)
-codegen/testserver/singlefile/resolver.go:565:1: typeDefFirst: definition of type 'subscriptionResolver' should appear before its methods (gocritic)
-codegen/testserver/singlefile/resolver.go:566:1: typeDefFirst: definition of type 'userResolver' should appear before its methods (gocritic)
-codegen/testserver/singlefile/resolver.go:567:1: typeDefFirst: definition of type 'wrappedMapResolver' should appear before its methods (gocritic)
-codegen/testserver/singlefile/resolver.go:568:1: typeDefFirst: definition of type 'wrappedSliceResolver' should appear before its methods (gocritic)
-codegen/testserver/singlefile/response_extension_test.go:31:7: Error return value of `c.RawPost` is not checked (errcheck)
-codegen/testserver/singlefile/scalar_context.go:21:16: Error return value of `io.WriteString` is not checked (errcheck)
-codegen/testserver/singlefile/scalar_context.go:25:79: unused-parameter: parameter 'v' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/scalar_context.go:30:39: unused-parameter: parameter 'v' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/scalar_context.go:32:17: Error return value of `io.WriteString` is not checked (errcheck)
-codegen/testserver/singlefile/scalar_context.go:37:62: unused-parameter: parameter 'v' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/subscription_test.go:93:9: Error return value is not checked (errcheck)
-codegen/testserver/singlefile/subscription_test.go:98:9: Error return value is not checked (errcheck)
-codegen/testserver/singlefile/subscription_test.go:121:12: Error return value is not checked (errcheck)
-codegen/testserver/singlefile/subscription_test.go:157:12: Error return value is not checked (errcheck)
-codegen/testserver/singlefile/subscription_test.go:171:6: var-naming: struct field Id should be ID (revive)
-codegen/testserver/singlefile/subscription_test.go:171:6: ST1003: struct field Id should be ID (stylecheck)
-codegen/testserver/singlefile/subscription_test.go:184:12: Error return value is not checked (errcheck)
-codegen/testserver/singlefile/v-ok.go:3:22: Comment should end in a period (godot)
-codegen/testserver/singlefile/v-ok.go:10:20: Comment should end in a period (godot)
-codegen/testserver/singlefile/validtypes_test.go:26:16: json(snake): got 'differentCase' want 'different_case' (tagliatelle)
-codegen/testserver/singlefile/variadic.go:12:30: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/testserver/singlefile/variadic.go:12:61: unused-parameter: parameter 'opts' seems to be unused, consider removing or renaming it as _ (revive)
-codegen/type.go:21:18: redundantSprint: use existing.GQL.String() instead (gocritic)
-codegen/type.go:22:13: redundantSprint: use ref.GQL.String() instead (gocritic)
-codegen/type.go:24:10: sprintfQuotedString: use %q instead of "%s" for quoted strings (gocritic)
-codegen/util.go:11:3: return both the `nil` error and invalid value: use a sentinel error instead (nilnil)
-codegen/util.go:16:15: ST1005: error strings should not end with punctuation or newlines (stylecheck)
-codegen/util.go:16:26: error-strings: error strings should not be capitalized or end with punctuation or a newline (revive)
-codegen/util.go:24:3: return both the `nil` error and invalid value: use a sentinel error instead (nilnil)
-codegen/util.go:31:3: return both the `nil` error and invalid value: use a sentinel error instead (nilnil)
-graphql/bool.go:11:48: Error return value of `w.Write` is not checked (errcheck)
-graphql/bool.go:13:47: Error return value of `w.Write` is not checked (errcheck)
-graphql/bool.go:19:10: equalFold: consider replacing with strings.EqualFold(v, "true") (gocritic)
-graphql/cache.go:5:57: Comment should end in a period (godot)
-graphql/cache.go:14:112: Comment should end in a period (godot)
-graphql/cache.go:18:23: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-graphql/cache.go:24:23: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-graphql/cache.go:28:22: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-graphql/cache.go:28:43: unused-parameter: parameter 'key' seems to be unused, consider removing or renaming it as _ (revive)
-graphql/cache.go:29:22: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-graphql/cache.go:29:43: unused-parameter: parameter 'key' seems to be unused, consider removing or renaming it as _ (revive)
-graphql/cache.go:29:55: unused-parameter: parameter 'value' seems to be unused, consider removing or renaming it as _ (revive)
-graphql/coercion_test.go:11: File is not `gofumpt`-ed (gofumpt)
-graphql/coercion_test.go:37: File is not `gofumpt`-ed (gofumpt)
-graphql/context_field.go:14:40: Comment should end in a period (godot)
-graphql/context_field.go:84:43: Comment should end in a period (godot)
-graphql/context_field.go:101:1: paramTypeCombine: func(a ast.Path, b ast.Path) bool could be replaced with func(a, b ast.Path) bool (gocritic)
-graphql/context_operation.go:12:72: Comment should end in a period (godot)
-graphql/context_operation.go:31:37: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-graphql/context_operation.go:56:75: Comment should end in a period (godot)
-graphql/context_operation.go:80:62: Comment should end in a period (godot)
-graphql/context_operation.go:105:55: Comment should end in a period (godot)
-graphql/context_operation.go:113:20: type assertion on error will fail on wrapped errors. Use errors.As to check for specific errors (errorlint)
-graphql/context_response.go:60:69: Comment should end in a period (godot)
-graphql/context_response.go:80:76: Comment should end in a period (godot)
-graphql/context_response.go:119:81: Comment should end in a period (godot)
-graphql/context_response.go:136:81: Comment should end in a period (godot)
-graphql/errcode/codes.go:15:85: Comment should end in a period (godot)
-graphql/errcode/codes.go:17:53: Comment should end in a period (godot)
-graphql/errcode/codes.go:27:22: Comment should end in a period (godot)
-graphql/errcode/codes.go:32:57: Comment should end in a period (godot)
-graphql/errcode/codes.go:37:16: type assertion on error will fail on wrapped errors. Use errors.As to check for specific errors (errorlint)
-graphql/errcode/codes.go:49:99: Comment should end in a period (godot)
-graphql/executable_schema.go:101:1: paramTypeCombine: func(c *[]CollectedField, name string, alias string, objectDefinition *ast.Definition, creator func() CollectedField) *CollectedField could be replaced with func(c *[]CollectedField, name, alias string, objectDefinition *ast.Definition, creator func() CollectedField) *CollectedField (gocritic)
-graphql/executable_schema.go:103:3: nestingReduce: invert if cond, replace body with `continue`, move old body after the statement (gocritic)
-graphql/executor/executor.go:83:17: type assertion on error will fail on wrapped errors. Use errors.As to check for specific errors (errorlint)
-graphql/executor/executor.go:193:17: type assertion on error will fail on wrapped errors. Use errors.As to check for specific errors (errorlint)
-graphql/executor/executor.go:205:11: Error return value is not checked (errcheck)
-graphql/executor/executor.go:205:16: type assertion on error will fail on wrapped errors. Use errors.As to check for specific errors (errorlint)
-graphql/executor/executor_test.go:148:17: Function `query` should pass the context parameter (contextcheck)
-graphql/executor/executor_test.go:161:17: Function `query` should pass the context parameter (contextcheck)
-graphql/executor/executor_test.go:179:37: unused-parameter: parameter 's' seems to be unused, consider removing or renaming it as _ (revive)
-graphql/executor/executor_test.go:195:35: unused-parameter: parameter 's' seems to be unused, consider removing or renaming it as _ (revive)
-graphql/executor/extensions.go:31:104: Comment should end in a period (godot)
-graphql/executor/extensions.go:36:113: Comment should end in a period (godot)
-graphql/executor/extensions.go:41:112: Comment should end in a period (godot)
-graphql/executor/extensions.go:46:110: Comment should end in a period (godot)
-graphql/executor/extensions.go:135:32: unused-parameter: parameter 'schema' seems to be unused, consider removing or renaming it as _ (revive)
-graphql/executor/extensions.go:152:34: unused-parameter: parameter 'schema' seems to be unused, consider removing or renaming it as _ (revive)
-graphql/executor/extensions.go:169:35: unused-parameter: parameter 'schema' seems to be unused, consider removing or renaming it as _ (revive)
-graphql/executor/extensions.go:186:39: unused-parameter: parameter 'schema' seems to be unused, consider removing or renaming it as _ (revive)
-graphql/executor/testexecutor/testexecutor.go:21:38: unused-parameter: parameter 'v' seems to be unused, consider removing or renaming it as _ (revive)
-graphql/executor/testexecutor/testexecutor.go:83:8: commentedOutCode: may want to remove commented-out code (gocritic)
-graphql/fieldset.go:53:14: Error return value of `writer.Write` is not checked (errcheck)
-graphql/fieldset.go:56:16: Error return value of `writer.Write` is not checked (errcheck)
-graphql/fieldset.go:59:15: Error return value of `writer.Write` is not checked (errcheck)
-graphql/fieldset.go:62:14: Error return value of `writer.Write` is not checked (errcheck)
-graphql/float.go:14:3: preferFprint: suggestion: fmt.Fprintf(w, "%g", f) (gocritic)
-graphql/float.go:14:17: Error return value of `io.WriteString` is not checked (errcheck)
-graphql/float.go:40:3: preferFprint: suggestion: fmt.Fprintf(w, "%g", f) (gocritic)
-graphql/float.go:40:17: Error return value of `io.WriteString` is not checked (errcheck)
-graphql/float.go:45:28: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-graphql/handler.go:27:40: json(snake): got 'operationName' want 'operation_name' (tagliatelle)
-graphql/handler.go:87:46: Comment should end in a period (godot)
-graphql/handler.go:92:117: Comment should end in a period (godot)
-graphql/handler/apollofederatedtracingv1/tracing.go:33:51: Comment should end in a period (godot)
-graphql/handler/apollofederatedtracingv1/tracing.go:38:111: Comment should end in a period (godot)
-graphql/handler/apollofederatedtracingv1/tracing.go:58:131: Comment should end in a period (godot)
-graphql/handler/apollofederatedtracingv1/tracing.go:67:97: Comment should end in a period (godot)
-graphql/handler/apollofederatedtracingv1/tracing.go:80:74: Comment should end in a period (godot)
-graphql/handler/apollofederatedtracingv1/tracing_test.go:127:34: unused-parameter: parameter 'schema' seems to be unused, consider removing or renaming it as _ (revive)
-graphql/handler/apollofederatedtracingv1/tree_builder.go:29:119: Comment should end in a period (godot)
-graphql/handler/apollofederatedtracingv1/tree_builder.go:46:92: Comment should end in a period (godot)
-graphql/handler/apollofederatedtracingv1/tree_builder.go:62:110: Comment should end in a period (godot)
-graphql/handler/apollofederatedtracingv1/tree_builder.go:63:34: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-graphql/handler/apollofederatedtracingv1/tree_builder.go:78:113: Comment should end in a period (godot)
-graphql/handler/apollofederatedtracingv1/tree_builder.go:100:133: Comment should end in a period (godot)
-graphql/handler/apollofederatedtracingv1/tree_builder.go:132:52: Comment should end in a period (godot)
-graphql/handler/apollotracing/tracer.go:18:28: json(snake): got 'startTime' want 'start_time' (tagliatelle)
-graphql/handler/apollotracing/tracer.go:19:28: json(snake): got 'endTime' want 'end_time' (tagliatelle)
-graphql/handler/apollotracing/tracer.go:29:29: json(snake): got 'startOffset' want 'start_offset' (tagliatelle)
-graphql/handler/apollotracing/tracer.go:35:29: json(snake): got 'parentType' want 'parent_type' (tagliatelle)
-graphql/handler/apollotracing/tracer.go:36:29: json(snake): got 'fieldName' want 'field_name' (tagliatelle)
-graphql/handler/apollotracing/tracer.go:37:29: json(snake): got 'returnType' want 'return_type' (tagliatelle)
-graphql/handler/apollotracing/tracer.go:38:29: json(snake): got 'startOffset' want 'start_offset' (tagliatelle)
-graphql/handler/debug/tracer.go:11:2: dot-imports: should not use dot imports (revive)
-graphql/handler/debug/tracer.go:11:2: ST1001: should not use dot imports (stylecheck)
-graphql/handler/debug/tracer.go:33:27: unused-parameter: parameter 'schema' seems to be unused, consider removing or renaming it as _ (revive)
-graphql/handler/debug/tracer.go:43:2: ST1003: var valueJson should be valueJSON (stylecheck)
-graphql/handler/debug/tracer.go:43:2: var-naming: var valueJson should be valueJSON (revive)
-graphql/handler/extension/apq.go:49:43: unused-parameter: parameter 'schema' seems to be unused, consider removing or renaming it as _ (revive)
-graphql/handler/extension/apq.go:62:18: mapstructure(kebab): got 'sha256Hash' want 'sha256-hash' (tagliatelle)
-graphql/handler/extension/apq.go:83:21: Error return value is not checked (errcheck)
-graphql/handler/extension/apq.go:107:5: Error return value is not checked (errcheck)
-graphql/handler/extension/complexity.go:39:69: Comment should end in a period (godot)
-graphql/handler/extension/complexity.go:62:2: importShadow: shadow of imported from 'github.com/99designs/gqlgen/complexity' package 'complexity' (gocritic)
-graphql/handler/extension/complexity.go:86:5: Error return value is not checked (errcheck)
-graphql/handler/extension/complexity_test.go:110:1: paramTypeCombine: func(handler http.Handler, method string, target string, body string) *httptest.ResponseRecorder could be replaced with func(handler http.Handler, method, target, body string) *httptest.ResponseRecorder (gocritic)
-graphql/handler/extension/complexity_test.go:110:38: `doRequest` - `method` always receives `"POST"` (unparam)
-graphql/handler/extension/complexity_test.go:110:53: `doRequest` - `target` always receives `"/graphql"` (unparam)
-graphql/handler/extension/introspection.go:22:33: unused-parameter: parameter 'schema' seems to be unused, consider removing or renaming it as _ (revive)
-graphql/handler/extension/introspection.go:26:47: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-graphql/handler/lru/lru.go:26:18: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-graphql/handler/lru/lru.go:30:18: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-graphql/handler/server.go:52:31: importShadow: shadow of imported from 'github.com/99designs/gqlgen/graphql/handler/transport' package 'transport' (gocritic)
-graphql/handler/server.go:68:22: importShadow: shadow of imported from 'github.com/99designs/gqlgen/graphql/handler/extension' package 'extension' (gocritic)
-graphql/handler/server.go:72:104: Comment should end in a period (godot)
-graphql/handler/server.go:77:108: Comment should end in a period (godot)
-graphql/handler/server.go:82:112: Comment should end in a period (godot)
-graphql/handler/server.go:87:110: Comment should end in a period (godot)
-graphql/handler/server.go:105:12: Error return value is not checked (errcheck)
-graphql/handler/server.go:105:17: type assertion on error will fail on wrapped errors. Use errors.As to check for specific errors (errorlint)
-graphql/handler/server.go:107:7: Error return value of `json.Marshal` is not checked (errcheck)
-graphql/handler/server.go:109:11: Error return value of `w.Write` is not checked (errcheck)
-graphql/handler/server.go:115:2: importShadow: shadow of imported from 'github.com/99designs/gqlgen/graphql/handler/transport' package 'transport' (gocritic)
-graphql/handler/server.go:130:9: Error return value of `w.Write` is not checked (errcheck)
-graphql/handler/server.go:143:33: unused-parameter: parameter 'schema' seems to be unused, consider removing or renaming it as _ (revive)
-graphql/handler/server.go:160:32: unused-parameter: parameter 'schema' seems to be unused, consider removing or renaming it as _ (revive)
-graphql/handler/server.go:177:29: unused-parameter: parameter 'schema' seems to be unused, consider removing or renaming it as _ (revive)
-graphql/handler/server_test.go:168:34: unused-parameter: parameter 'r' seems to be unused, consider removing or renaming it as _ (revive)
-graphql/handler/server_test.go:172:1: receiver-naming: receiver name h should be consistent with previous receiver name t for panicTransport (revive)
-graphql/handler/server_test.go:172:25: ST1016: methods on the same type should have the same receiver name (seen 1x "h", 1x "t") (stylecheck)
-graphql/handler/server_test.go:172:28: unused-parameter: parameter 'w' seems to be unused, consider removing or renaming it as _ (revive)
-graphql/handler/server_test.go:172:51: unused-parameter: parameter 'r' seems to be unused, consider removing or renaming it as _ (revive)
-graphql/handler/server_test.go:172:68: unused-parameter: parameter 'exec' seems to be unused, consider removing or renaming it as _ (revive)
-graphql/handler/server_test.go:188:27: "GET" can be replaced by http.MethodGet (usestdlibvars)
-graphql/handler/server_test.go:196:27: "POST" can be replaced by http.MethodPost (usestdlibvars)
-graphql/handler/transport/error.go:13:23: Comment should end in a period (godot)
-graphql/handler/transport/error.go:20:9: Error return value of `w.Write` is not checked (errcheck)
-graphql/handler/transport/error.go:23:56: Comment should end in a period (godot)
-graphql/handler/transport/http_form.go:108:6: comparing with == will fail on wrapped errors. Use errors.Is to check for a specific error (errorlint)
-graphql/handler/transport/http_form.go:158:4: deferInLoop: Possible resource leak, 'defer' is called in the 'for' loop (gocritic)
-graphql/handler/transport/http_form.go:183:5: deferInLoop: Possible resource leak, 'defer' is called in the 'for' loop (gocritic)
-graphql/handler/transport/http_form_test.go:211:12: "POST" can be replaced by http.MethodPost (usestdlibvars)
-graphql/handler/transport/http_form_test.go:279:6: test helper function should start from t.Helper() (thelper)
-graphql/handler/transport/http_form_test.go:291:32: sprintfQuotedString: use %q instead of "%s" for quoted strings (gocritic)
-graphql/handler/transport/http_form_test.go:301:29: should rewrite http.NewRequestWithContext or add (*Request).WithContext (noctx)
-graphql/handler/transport/http_form_test.go:301:30: "POST" can be replaced by http.MethodPost (usestdlibvars)
-graphql/handler/transport/http_post_test.go:98:21: sprintfQuotedString: use %q instead of "%s" for quoted strings (gocritic)
-graphql/handler/transport/http_post_test.go:104:1: paramTypeCombine: func(handler http.Handler, method string, target string, body string) *httptest.ResponseRecorder could be replaced with func(handler http.Handler, method, target, body string) *httptest.ResponseRecorder (gocritic)
-graphql/handler/transport/options.go:10:54: Comment should end in a period (godot)
-graphql/handler/transport/options.go:22:61: unused-parameter: parameter 'exec' seems to be unused, consider removing or renaming it as _ (revive)
-graphql/handler/transport/reader.go:22:2: naked return in func `Read` with 10 lines of code (nakedret)
-graphql/handler/transport/reader_test.go:23:11: Error return value of `r.Read` is not checked (errcheck)
-graphql/handler/transport/reader_test.go:27:11: Error return value of `r.Read` is not checked (errcheck)
-graphql/handler/transport/reader_test.go:53:8: comparing with == will fail on wrapped errors. Use errors.Is to check for a specific error (errorlint)
-graphql/handler/transport/reader_test.go:77:8: comparing with == will fail on wrapped errors. Use errors.Is to check for a specific error (errorlint)
-graphql/handler/transport/reader_test.go:99:8: comparing with == will fail on wrapped errors. Use errors.Is to check for a specific error (errorlint)
-graphql/handler/transport/reader_test.go:119:8: comparing with == will fail on wrapped errors. Use errors.Is to check for a specific error (errorlint)
-graphql/handler/transport/sse.go:104:6: var-naming: func writeJsonWithSSE should be writeJSONWithSSE (revive)
-graphql/handler/transport/sse.go:104:6: ST1003: func writeJsonWithSSE should be writeJSONWithSSE (stylecheck)
-graphql/handler/transport/sse_test.go:39:30: should rewrite http.NewRequestWithContext or add (*Request).WithContext (noctx)
-graphql/handler/transport/sse_test.go:39:31: "POST" can be replaced by http.MethodPost (usestdlibvars)
-graphql/handler/transport/sse_test.go:92: File is not `gofumpt`-ed (gofumpt)
-graphql/handler/transport/util.go:12:6: var-naming: func writeJson should be writeJSON (revive)
-graphql/handler/transport/util.go:12:6: ST1003: func writeJson should be writeJSON (stylecheck)
-graphql/handler/transport/util.go:17:9: Error return value of `w.Write` is not checked (errcheck)
-graphql/handler/transport/util.go:20:6: var-naming: func writeJsonError should be writeJSONError (revive)
-graphql/handler/transport/util.go:20:6: ST1003: func writeJsonError should be writeJSONError (stylecheck)
-graphql/handler/transport/util.go:24:6: var-naming: func writeJsonErrorf should be writeJSONErrorf (revive)
-graphql/handler/transport/util.go:24:6: ST1003: func writeJsonErrorf should be writeJSONErrorf (stylecheck)
-graphql/handler/transport/util.go:28:6: var-naming: func writeJsonGraphqlError should be writeJSONGraphqlError (revive)
-graphql/handler/transport/util.go:28:6: ST1003: func writeJsonGraphqlError should be writeJSONGraphqlError (stylecheck)
-graphql/handler/transport/websocket.go:88:18: Error return value of `ws.WriteMessage` is not checked (errcheck)
-graphql/handler/transport/websocket.go:111:10: Function `run->subscribe` should pass the context parameter (contextcheck)
-graphql/handler/transport/websocket.go:155:6: comparing with == will fail on wrapped errors. Use errors.Is to check for a specific error (errorlint)
-graphql/handler/transport/websocket.go:160:6: comparing with == will fail on wrapped errors. Use errors.Is to check for a specific error (errorlint)
-graphql/handler/transport/websocket.go:236:25: Error return value of `c.conn.SetReadDeadline` is not checked (errcheck)
-graphql/handler/transport/websocket.go:271:26: Error return value of `c.conn.SetReadDeadline` is not checked (errcheck)
-graphql/handler/transport/websocket.go:407:45: importShadow: shadow of imported package 'errors' (gocritic)
-graphql/handler/transport/websocket.go:430:2: Error return value of `c.conn.WriteMessage` is not checked (errcheck)
-graphql/handler/transport/websocket_close_reason.go:8:56: Comment should end in a period (godot)
-graphql/handler/transport/websocket_close_reason.go:20:10: Error return value is not checked (errcheck)
-graphql/handler/transport/websocket_init.go:23:8: Error return value is not checked (errcheck)
-graphql/handler/transport/websocket_resolver_error.go:10:56: Comment should end in a period (godot)
-graphql/handler/transport/websocket_resolver_error.go:52:70: Comment should end in a period (godot)
-graphql/handler/transport/websocket_resolver_error.go:63:5: Error return value is not checked (errcheck)
-graphql/handler/transport/websocket_test.go:28:2: importShadow: shadow of imported from 'github.com/99designs/gqlgen/graphql/handler' package 'handler' (gocritic)
-graphql/handler/transport/websocket_test.go:52:49: type assertion on error will fail on wrapped errors. Use errors.As to check for specific errors (errorlint)
-graphql/handler/transport/websocket_test.go:87:49: type assertion on error will fail on wrapped errors. Use errors.As to check for specific errors (errorlint)
-graphql/handler/transport/websocket_test.go:142:20: Error return value of `c.SetReadDeadline` is not checked (errcheck)
-graphql/handler/transport/websocket_test.go:152: File is not `gofumpt`-ed (gofumpt)
-graphql/handler/transport/websocket_test.go:273:21: Error return value is not checked (errcheck)
-graphql/handler/transport/websocket_test.go:339:4: Error return value of `c.ReadJSON` is not checked (errcheck)
-graphql/handler/transport/websocket_test.go:361:20: type assertion on error will fail on wrapped errors. Use errors.As to check for specific errors (errorlint)
-graphql/handler/transport/websocket_test.go:469:3: importShadow: shadow of imported from 'github.com/99designs/gqlgen/graphql/handler' package 'handler' (gocritic)
-graphql/handler/transport/websocket_test.go:514:20: Error return value of `c.SetReadDeadline` is not checked (errcheck)
-graphql/handler/transport/websocket_test.go:523:46: TestWebsocketWithPingPongInterval$1 - result 0 (*github.com/99designs/gqlgen/graphql/handler/testserver.TestServer) is never used (unparam)
-graphql/handler_test.go:14:9: Error return value of `os.Open` is not checked (errcheck)
-graphql/handler_test.go:30:9: Error return value of `os.Open` is not checked (errcheck)
-graphql/handler_test.go:58:9: Error return value of `os.Open` is not checked (errcheck)
-graphql/id.go:29:10: indent-error-flow: if block ends with a return statement, so drop this else and outdent its block (revive)
-graphql/int.go:12:17: Error return value of `io.WriteString` is not checked (errcheck)
-graphql/int.go:33:17: Error return value of `io.WriteString` is not checked (errcheck)
-graphql/int.go:54:17: Error return value of `io.WriteString` is not checked (errcheck)
-graphql/introspection/query.go:3:74: Comment should end in a period (godot)
-graphql/jsonw.go:74:14: Error return value of `writer.Write` is not checked (errcheck)
-graphql/jsonw.go:77:16: Error return value of `writer.Write` is not checked (errcheck)
-graphql/jsonw.go:81:14: Error return value of `writer.Write` is not checked (errcheck)
-graphql/jsonw.go:87:9: Error return value of `w.Write` is not checked (errcheck)
-graphql/jsonw.go:90:32: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-graphql/jsonw.go:91:9: Error return value of `w.Write` is not checked (errcheck)
-graphql/playground/altair_playground.go:66:66: Comment should end in a period (godot)
-graphql/playground/apollo_sandbox_playground.go:49:73: Comment should end in a period (godot)
-graphql/playground/playground.go:76:53: Comment should end in a period (godot)
-graphql/playground/playground.go:77:1: paramTypeCombine: func(title string, endpoint string) http.HandlerFunc could be replaced with func(title, endpoint string) http.HandlerFunc (gocritic)
-graphql/playground/playground_test.go:29:29: regexpSimplify: can re-write `(?m)^.*url\s*=\s*['"]https:\/\/example\.org\/query["'].*$` as `(?m)^.*url\s*=\s*['"]https://example\.org/query["'].*$` (gocritic)
-graphql/playground/playground_test.go:39:47: regexpSimplify: can re-write `\n\s{0,}\n\s{0,}.*` as `<head>\n\s*<meta charset="utf-8">\n\s*.*<title>` (gocritic)
-graphql/recovery.go:14:21: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-graphql/response.go:20:20: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-graphql/stats.go:36:18: Comment should end in a period (godot)
-graphql/string.go:20:16: Error return value of `io.WriteString` is not checked (errcheck)
-graphql/string.go:24:18: Error return value of `io.WriteString` is not checked (errcheck)
-graphql/string.go:28:19: Error return value of `io.WriteString` is not checked (errcheck)
-graphql/string.go:30:19: Error return value of `io.WriteString` is not checked (errcheck)
-graphql/string.go:32:19: Error return value of `io.WriteString` is not checked (errcheck)
-graphql/string.go:34:19: Error return value of `io.WriteString` is not checked (errcheck)
-graphql/string.go:36:19: Error return value of `io.WriteString` is not checked (errcheck)
-graphql/string.go:38:19: Error return value of `io.WriteString` is not checked (errcheck)
-graphql/string.go:39:12: Error return value of `w.Write` is not checked (errcheck)
-graphql/string.go:46:16: Error return value of `io.WriteString` is not checked (errcheck)
-graphql/string.go:47:16: Error return value of `io.WriteString` is not checked (errcheck)
-graphql/string.go:65:10: indent-error-flow: if block ends with a return statement, so drop this else and outdent its block (revive)
-graphql/time.go:16:17: Error return value of `io.WriteString` is not checked (errcheck)
-graphql/uint.go:12:6: Error return value of `io.WriteString` is not checked (errcheck)
-graphql/uint.go:35:6: Error return value of `io.WriteString` is not checked (errcheck)
-graphql/uint.go:56:6: Error return value of `io.WriteString` is not checked (errcheck)
-graphql/upload.go:17:10: Error return value of `io.Copy` is not checked (errcheck)
-handler/handler.go:17:45: Comment should end in a period (godot)
-handler/handler.go:75:45: Comment should end in a period (godot)
-handler/handler.go:94:45: Comment should end in a period (godot)
-handler/handler.go:97:45: Comment should end in a period (godot)
-handler/handler.go:104:45: Comment should end in a period (godot)
-handler/handler.go:105:18: param recover has same name as predeclared identifier (predeclared)
-handler/handler.go:105:18: builtinShadow: shadowing of predeclared identifier: recover (gocritic)
-handler/handler.go:114:45: Comment should end in a period (godot)
-handler/handler.go:123:45: Comment should end in a period (godot)
-handler/handler.go:132:45: Comment should end in a period (godot)
-handler/handler.go:142:45: Comment should end in a period (godot)
-handler/handler.go:151:45: Comment should end in a period (godot)
-handler/handler.go:160:45: Comment should end in a period (godot)
-handler/handler.go:169:45: Comment should end in a period (godot)
-handler/handler.go:178:45: Comment should end in a period (godot)
-handler/handler.go:187:45: Comment should end in a period (godot)
-handler/handler.go:197:45: Comment should end in a period (godot)
-handler/handler.go:208:45: Comment should end in a period (godot)
-handler/handler.go:222:45: Comment should end in a period (godot)
-handler/handler.go:250:46: Comment should end in a period (godot)
-handler/handler.go:251:1: paramTypeCombine: func(title string, endpoint string) http.HandlerFunc could be replaced with func(title, endpoint string) http.HandlerFunc (gocritic)
-handler/handler.go:255:49: Comment should end in a period (godot)
-integration/remote_api/user.go:1:1: ST1003: should not use underscores in package names (stylecheck)
-integration/remote_api/user.go:1:9: var-naming: don't use an underscore in package name (revive)
-integration/resolver.go:39:33: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-integration/resolver.go:46:38: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-integration/resolver.go:46:59: unused-parameter: parameter 'obj' seems to be unused, consider removing or renaming it as _ (revive)
-integration/resolver.go:50:33: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-integration/resolver.go:56:31: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-integration/resolver.go:64:30: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-integration/resolver.go:68:34: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-integration/resolver.go:68:55: unused-parameter: parameter 'input' seems to be unused, consider removing or renaming it as _ (revive)
-integration/resolver.go:72:30: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-integration/resolver.go:88:32: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-integration/resolver.go:94:38: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-integration/resolver.go:98:36: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-integration/resolver.go:98:57: unused-parameter: parameter 'value' seems to be unused, consider removing or renaming it as _ (revive)
-integration/resolver.go:104:30: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive)
-integration/server/server.go:50:12: G114: Use of net/http serve function that has no support for setting timeouts (gosec)
-integration/testomitempty/testmodel.go:4:21: json(snake): got 'newDesc' want 'new_desc' (tagliatelle)
-internal/code/compare.go:8:79: Comment should end in a period (godot)
-internal/code/compare.go:9:1: paramTypeCombine: func(expected types.Type, actual types.Type) error could be replaced with func(expected, actual types.Type) error (gocritic)
-internal/code/compare.go:87:4: if-return: redundant if ...; err != nil check, just return error instead. (revive)
-internal/code/compare.go:117:4: if-return: redundant if ...; err != nil check, just return error instead. (revive)
-internal/code/imports.go:59:28: Comment should end in a period (godot)
-internal/code/imports.go:141:6: emptyStringTest: replace `len(s) != 0` with `s != ""` (gocritic)
-internal/code/imports.go:152:82: Comment should end in a period (godot)
-internal/code/imports.go:174:35: regexpSimplify: can re-write `module ([^\s]*)` as `module (\S*)` (gocritic)
-internal/code/packages.go:35:55: Comment should end in a period (godot)
-internal/code/packages.go:184:18: whyNoLint: include an explanation for nolint directive (gocritic)
-internal/code/packages.go:184:18: directive `//nolint:prealloc` is unused for linter "prealloc" (nolintlint)
-internal/code/packages_test.go:53:6: test helper function should start from t.Helper() (thelper)
-internal/code/util.go:11:93: Comment should end in a period (godot)
-internal/code/util.go:12:1: unnamedResult: consider giving a name to these results (gocritic)
-internal/code/util.go:26:39: Comment should end in a period (godot)
-internal/code/util.go:42:6: Error return value of `os.Getwd` is not checked (errcheck)
-internal/code/util.go:57:49: regexpSimplify: can re-write `[^\w]` as `\W` (gocritic)
-internal/imports/prune.go:26:36: Comment should end in a period (godot)
-internal/rewrite/rewriter.go:71:1: paramTypeCombine: func(structname string, methodname string) *ast.FuncDecl could be replaced with func(structname, methodname string) *ast.FuncDecl (gocritic)
-internal/rewrite/rewriter.go:102:1: paramTypeCombine: func(structname string, methodname string) string could be replaced with func(structname, methodname string) string (gocritic)
-internal/rewrite/rewriter.go:110:1: paramTypeCombine: func(structname string, methodname string) string could be replaced with func(structname, methodname string) string (gocritic)
-main.go:66:10: ST1005: error strings should not end with punctuation or newlines (stylecheck)
-main.go:66:21: error-strings: error strings should not be capitalized or end with punctuation or a newline (revive)
-main.go:68:12: G306: Expect WriteFile permissions to be 0600 or less (gosec)
-main.go:69:10: ST1005: error strings should not end with punctuation or newlines (stylecheck)
-main.go:69:21: error-strings: error strings should not be capitalized or end with punctuation or a newline (revive)
-main.go:110:11: ST1005: error strings should not end with punctuation or newlines (stylecheck)
-main.go:110:22: error-strings: error strings should not be capitalized or end with punctuation or a newline (revive)
-main.go:121:11: ST1005: error strings should not end with punctuation or newlines (stylecheck)
-main.go:121:22: error-strings: error strings should not be capitalized or end with punctuation or a newline (revive)
-main.go:187:3: if-return: redundant if ...; err != nil check, just return error instead. (revive)
-plugin/federation/entity.go:39:43: Comment should end in a period (godot)
-plugin/federation/federation.go:27:50: Comment should end in a period (godot)
-plugin/federation/federation.go:36:32: Comment should end in a period (godot)
-plugin/federation/federation.go:41:42: Comment should end in a period (godot)
-plugin/federation/federation.go:121:42: Comment should end in a period (godot)
-plugin/federation/federation.go:282:16: Error return value is not checked (errcheck)
-plugin/federation/federation_entityresolver_test.go:39:6: json(snake): got '_entities' want 'entities' (tagliatelle)
-plugin/federation/federation_entityresolver_test.go:78:6: json(snake): got '_entities' want 'entities' (tagliatelle)
-plugin/federation/federation_entityresolver_test.go:132:6: json(snake): got '_entities' want 'entities' (tagliatelle)
-plugin/federation/federation_entityresolver_test.go:171:6: json(snake): got '_entities' want 'entities' (tagliatelle)
-plugin/federation/federation_entityresolver_test.go:215:6: json(snake): got '_entities' want 'entities' (tagliatelle)
-plugin/federation/federation_entityresolver_test.go:256:6: json(snake): got '_entities' want 'entities' (tagliatelle)
-plugin/federation/federation_entityresolver_test.go:294:6: json(snake): got '_entities' want 'entities' (tagliatelle)
-plugin/federation/federation_entityresolver_test.go:337:6: json(snake): got '_entities' want 'entities' (tagliatelle)
-plugin/federation/federation_entityresolver_test.go:377:6: json(snake): got '_entities' want 'entities' (tagliatelle)
-plugin/federation/federation_entityresolver_test.go:418:6: json(snake): got '_entities' want 'entities' (tagliatelle)
-plugin/federation/federation_entityresolver_test.go:455:6: json(snake): got '_entities' want 'entities' (tagliatelle)
-plugin/federation/federation_entityresolver_test.go:490:6: json(snake): got '_entities' want 'entities' (tagliatelle)
-plugin/federation/federation_entityresolver_test.go:528:6: json(snake): got '_entities' want 'entities' (tagliatelle)
-plugin/federation/federation_entityresolver_test.go:571:6: json(snake): got '_entities' want 'entities' (tagliatelle)
-plugin/federation/fedruntime/runtime.go:5:9: Comment should end in a period (godot)
-plugin/federation/fedruntime/runtime.go:10:42: Comment should end in a period (godot)
-plugin/federation/fedruntime/runtime.go:15:31: Comment should end in a period (godot)
-plugin/federation/fieldset/fieldset.go:16:49: Comment should end in a period (godot)
-plugin/federation/fieldset/fieldset.go:54:10: sprintfQuotedString: use %q instead of "%s" for quoted strings (gocritic)
-plugin/federation/fieldset/fieldset.go:143:1: unnamedResult: consider giving a name to these results (gocritic)
-plugin/federation/test_data/model/federation.go:3:23: whyNoLint: include an explanation for nolint directive (gocritic)
-plugin/modelgen/models.go:265:10: indent-error-flow: if block ends with a return statement, so drop this else and outdent its block (revive)
-plugin/modelgen/models.go:401:21: unused-parameter: parameter 'td' seems to be unused, consider removing or renaming it as _ (revive)
-plugin/modelgen/models.go:409:11: Error return value is not checked (errcheck)
-plugin/modelgen/models.go:415:13: Error return value is not checked (errcheck)
-plugin/modelgen/models.go:458:18: unused-parameter: parameter 'td' seems to be unused, consider removing or renaming it as _ (revive)
-plugin/modelgen/models.go:464:16: Error return value is not checked (errcheck)
-plugin/modelgen/models_test.go:346:2: importShadow: shadow of imported from 'github.com/99designs/gqlgen/plugin/modelgen/out' package 'out' (gocritic)
-plugin/modelgen/out_struct_pointers/existing.go:1:1: ST1003: should not use underscores in package names (stylecheck)
-plugin/modelgen/out_struct_pointers/existing.go:1:9: var-naming: don't use an underscore in package name (revive)
-plugin/plugin.go:33:57: Comment should end in a period (godot)
-plugin/resolvergen/resolver.go:131:9: var-naming: don't use underscores in Go names; var resolver_implementer should be resolverImplementer (revive)
-plugin/resolvergen/resolver.go:131:9: ST1003: should not use underscores in Go names; var resolver_implementer should be resolverImplementer (stylecheck)
-plugin/resolvergen/resolver.go:134:9: var-naming: don't use underscores in Go names; var p_cast should be pCast (revive)
-plugin/resolvergen/resolver.go:134:9: ST1003: should not use underscores in Go names; var p_cast should be pCast (stylecheck)
-plugin/resolvergen/resolver.go:225:7: Error return value of `templates.CurrentImports.Reserve` is not checked (errcheck)
-plugin/resolvergen/resolver.go:227:7: Error return value of `templates.CurrentImports.Reserve` is not checked (errcheck)
-plugin/resolvergen/resolver.go:241:1: paramTypeCombine: func(base string, gqlname, filenameTmpl string) string could be replaced with func(base, gqlname, filenameTmpl string) string (gocritic)
-plugin/resolvergen/resolver_test.go:16:2: Error return value of `syscall.Unlink` is not checked (errcheck)
-plugin/resolvergen/resolver_test.go:68:6: test helper function should start from t.Helper() (thelper)
-plugin/resolvergen/resolver_test.go:69:2: Error return value of `syscall.Unlink` is not checked (errcheck)
-plugin/resolvergen/resolver_test.go:86:6: test helper function should start from t.Helper() (thelper)
-plugin/stubgen/stubs.go:19:1: paramTypeCombine: func(filename string, typename string) plugin.Plugin could be replaced with func(filename, typename string) plugin.Plugin (gocritic)
-plugin/stubgen/stubs.go:37:31: unused-parameter: parameter 'cfg' seems to be unused, consider removing or renaming it as _ (revive)
-plugin/stubgen/stubs.go:38:2: Error return value of `syscall.Unlink` is not checked (errcheck)
diff --git a/vendor/github.com/99designs/gqlgen/plugin/federation/federation.go b/vendor/github.com/99designs/gqlgen/plugin/federation/federation.go
index 27d0fe68..4cc8708d 100644
--- a/vendor/github.com/99designs/gqlgen/plugin/federation/federation.go
+++ b/vendor/github.com/99designs/gqlgen/plugin/federation/federation.go
@@ -86,28 +86,55 @@ func (f *federation) MutateConfig(cfg *config.Config) error {
}
func (f *federation) InjectSourceEarly() *ast.Source {
- input := `
- scalar _Any
- scalar _FieldSet
- directive @requires(fields: _FieldSet!) on FIELD_DEFINITION
- directive @provides(fields: _FieldSet!) on FIELD_DEFINITION
- directive @extends on OBJECT | INTERFACE
-`
+ input := ``
+
// add version-specific changes on key directive, as well as adding the new directives for federation 2
if f.Version == 1 {
input += `
directive @key(fields: _FieldSet!) repeatable on OBJECT | INTERFACE
+ directive @requires(fields: _FieldSet!) on FIELD_DEFINITION
+ directive @provides(fields: _FieldSet!) on FIELD_DEFINITION
+ directive @extends on OBJECT | INTERFACE
directive @external on FIELD_DEFINITION
+ scalar _Any
+ scalar _FieldSet
`
} else if f.Version == 2 {
input += `
- directive @key(fields: _FieldSet!, resolvable: Boolean = true) repeatable on OBJECT | INTERFACE
- directive @external on FIELD_DEFINITION | OBJECT
+ directive @composeDirective(name: String!) repeatable on SCHEMA
+ directive @extends on OBJECT | INTERFACE
+ directive @external on OBJECT | FIELD_DEFINITION
+ directive @key(fields: FieldSet!, resolvable: Boolean = true) repeatable on OBJECT | INTERFACE
+ directive @inaccessible on
+ | ARGUMENT_DEFINITION
+ | ENUM
+ | ENUM_VALUE
+ | FIELD_DEFINITION
+ | INPUT_FIELD_DEFINITION
+ | INPUT_OBJECT
+ | INTERFACE
+ | OBJECT
+ | SCALAR
+ | UNION
+ directive @interfaceObject on OBJECT
directive @link(import: [String!], url: String!) repeatable on SCHEMA
- directive @shareable on OBJECT | FIELD_DEFINITION
- directive @tag(name: String!) repeatable on FIELD_DEFINITION | INTERFACE | OBJECT | UNION | ARGUMENT_DEFINITION | SCALAR | ENUM | ENUM_VALUE | INPUT_OBJECT | INPUT_FIELD_DEFINITION
directive @override(from: String!) on FIELD_DEFINITION
- directive @inaccessible on SCALAR | OBJECT | FIELD_DEFINITION | ARGUMENT_DEFINITION | INTERFACE | UNION | ENUM | ENUM_VALUE | INPUT_OBJECT | INPUT_FIELD_DEFINITION
+ directive @provides(fields: FieldSet!) on FIELD_DEFINITION
+ directive @requires(fields: FieldSet!) on FIELD_DEFINITION
+ directive @shareable repeatable on FIELD_DEFINITION | OBJECT
+ directive @tag(name: String!) repeatable on
+ | ARGUMENT_DEFINITION
+ | ENUM
+ | ENUM_VALUE
+ | FIELD_DEFINITION
+ | INPUT_FIELD_DEFINITION
+ | INPUT_OBJECT
+ | INTERFACE
+ | OBJECT
+ | SCALAR
+ | UNION
+ scalar _Any
+ scalar FieldSet
`
}
return &ast.Source{
@@ -123,11 +150,18 @@ func (f *federation) InjectSourceLate(schema *ast.Schema) *ast.Source {
f.setEntities(schema)
var entities, resolvers, entityResolverInputDefinitions string
- for i, e := range f.Entities {
- if i != 0 {
- entities += " | "
+ for _, e := range f.Entities {
+
+ if e.Def.Kind != ast.Interface {
+ if entities != "" {
+ entities += " | "
+ }
+ entities += e.Name
+ } else if len(schema.GetPossibleTypes(e.Def)) == 0 {
+ fmt.Println(
+ "skipping @key field on interface " + e.Def.Name + " as no types implement it",
+ )
}
- entities += e.Name
for _, r := range e.Resolvers {
if e.Multi {
@@ -206,6 +240,16 @@ func (f *federation) GenerateCode(data *codegen.Data) error {
for _, e := range f.Entities {
obj := data.Objects.ByName(e.Def.Name)
+ if e.Def.Kind == ast.Interface {
+ if len(data.Interfaces[e.Def.Name].Implementors) == 0 {
+ fmt.Println(
+ "skipping @key field on interface " + e.Def.Name + " as no types implement it",
+ )
+ continue
+ }
+ obj = data.Objects.ByName(data.Interfaces[e.Def.Name].Implementors[0].Name)
+ }
+
for _, r := range e.Resolvers {
// fill in types for key fields
//
@@ -267,6 +311,12 @@ func (f *federation) setEntities(schema *ast.Schema) {
if !ok {
continue
}
+
+ if (schemaType.Kind == ast.Interface) && (len(schema.GetPossibleTypes(schemaType)) == 0) {
+ fmt.Printf("@key directive found on unused \"interface %s\". Will be ignored.\n", schemaType.Name)
+ continue
+ }
+
e := &Entity{
Name: schemaType.Name,
Def: schemaType,
@@ -385,10 +435,12 @@ func isFederatedEntity(schemaType *ast.Definition) ([]*ast.Directive, bool) {
return keys, true
}
case ast.Interface:
- // TODO: support @key and @extends for interfaces
- if dir := schemaType.Directives.ForName("key"); dir != nil {
- fmt.Printf("@key directive found on \"interface %s\". Will be ignored.\n", schemaType.Name)
+ keys := schemaType.Directives.ForNames("key")
+ if len(keys) > 0 {
+ return keys, true
}
+
+ // TODO: support @extends for interfaces
if dir := schemaType.Directives.ForName("extends"); dir != nil {
panic(
fmt.Sprintf(
diff --git a/vendor/github.com/99designs/gqlgen/plugin/modelgen/models.go b/vendor/github.com/99designs/gqlgen/plugin/modelgen/models.go
index 44ae557c..a649a237 100644
--- a/vendor/github.com/99designs/gqlgen/plugin/modelgen/models.go
+++ b/vendor/github.com/99designs/gqlgen/plugin/modelgen/models.go
@@ -374,7 +374,7 @@ func (m *Plugin) generateFields(cfg *config.Config, schemaType *ast.Definition)
GoName: name,
Type: typ,
Description: field.Description,
- Tag: getStructTagFromField(field),
+ Tag: getStructTagFromField(cfg, field),
Omittable: cfg.NullableInputOmittable && schemaType.Kind == ast.InputObject && !field.Type.NonNull,
}
@@ -409,11 +409,40 @@ func (m *Plugin) generateFields(cfg *config.Config, schemaType *ast.Definition)
fields = append(fields, f)
}
+ // appending extra fields at the end of the fields list.
+ modelcfg := cfg.Models[schemaType.Name]
+ if len(modelcfg.ExtraFields) > 0 {
+ ff := make([]*Field, 0, len(modelcfg.ExtraFields))
+ for fname, fspec := range modelcfg.ExtraFields {
+ ftype := buildType(fspec.Type)
+
+ tag := `json:"-"`
+ if fspec.OverrideTags != "" {
+ tag = fspec.OverrideTags
+ }
+
+ ff = append(ff,
+ &Field{
+ Name: fname,
+ GoName: fname,
+ Type: ftype,
+ Description: fspec.Description,
+ Tag: tag,
+ })
+ }
+
+ sort.Slice(ff, func(i, j int) bool {
+ return ff[i].Name < ff[j].Name
+ })
+
+ fields = append(fields, ff...)
+ }
+
return fields, nil
}
-func getStructTagFromField(field *ast.FieldDefinition) string {
- if !field.Type.NonNull {
+func getStructTagFromField(cfg *config.Config, field *ast.FieldDefinition) string {
+ if !field.Type.NonNull && (cfg.EnableModelJsonOmitemptyTag == nil || *cfg.EnableModelJsonOmitemptyTag) {
return `json:"` + field.Name + `,omitempty"`
}
return `json:"` + field.Name + `"`
diff --git a/vendor/github.com/99designs/gqlgen/plugin/modelgen/types.go b/vendor/github.com/99designs/gqlgen/plugin/modelgen/types.go
new file mode 100644
index 00000000..32926934
--- /dev/null
+++ b/vendor/github.com/99designs/gqlgen/plugin/modelgen/types.go
@@ -0,0 +1,47 @@
+package modelgen
+
+import (
+ "go/types"
+ "strings"
+)
+
+// buildType constructs a types.Type for the given string (using the syntax
+// from the extra field config Type field).
+func buildType(typeString string) types.Type {
+ switch {
+ case typeString[0] == '*':
+ return types.NewPointer(buildType(typeString[1:]))
+ case strings.HasPrefix(typeString, "[]"):
+ return types.NewSlice(buildType(typeString[2:]))
+ default:
+ return buildNamedType(typeString)
+ }
+}
+
+// buildNamedType returns the specified named or builtin type.
+//
+// Note that we don't look up the full types.Type object from the appropriate
+// package -- gqlgen doesn't give us the package-map we'd need to do so.
+// Instead we construct a placeholder type that has all the fields gqlgen
+// wants. This is roughly what gqlgen itself does, anyway:
+// https://github.com/99designs/gqlgen/blob/master/plugin/modelgen/models.go#L119
+func buildNamedType(fullName string) types.Type {
+ dotIndex := strings.LastIndex(fullName, ".")
+ if dotIndex == -1 { // builtinType
+ return types.Universe.Lookup(fullName).Type()
+ }
+
+ // type is pkg.Name
+ pkgPath := fullName[:dotIndex]
+ typeName := fullName[dotIndex+1:]
+
+ pkgName := pkgPath
+ slashIndex := strings.LastIndex(pkgPath, "/")
+ if slashIndex != -1 {
+ pkgName = pkgPath[slashIndex+1:]
+ }
+
+ pkg := types.NewPackage(pkgPath, pkgName)
+ // gqlgen doesn't use some of the fields, so we leave them 0/nil
+ return types.NewNamed(types.NewTypeName(0, pkg, typeName, nil), nil, nil)
+}
diff --git a/vendor/github.com/adhocore/gronx/.gitignore b/vendor/github.com/adhocore/gronx/.gitignore
index b085b1d8..12ae865c 100644
--- a/vendor/github.com/adhocore/gronx/.gitignore
+++ b/vendor/github.com/adhocore/gronx/.gitignore
@@ -5,3 +5,7 @@
vendor/
dist/
.env
+bin/
+*.php
+test/*.go
+*.txt
diff --git a/vendor/github.com/adhocore/gronx/.goreleaser.yml b/vendor/github.com/adhocore/gronx/.goreleaser.yml
new file mode 100644
index 00000000..b52f6d99
--- /dev/null
+++ b/vendor/github.com/adhocore/gronx/.goreleaser.yml
@@ -0,0 +1,67 @@
+project_name: tasker
+
+release:
+ prerelease: auto
+ name_template: "Version v{{.Version}}"
+ # draft: true
+ mode: "keep-existing"
+
+before:
+ hooks:
+ - go mod tidy
+
+builds:
+ - <<: &build_defaults
+ binary: bin/tasker
+ main: ./cmd/tasker
+ ldflags:
+ - -X main.Version={{.Version}}
+ env:
+ - CGO_ENABLED=0
+ id: macOS
+ goos: [darwin]
+ goarch: [amd64, arm64]
+
+ - <<: *build_defaults
+ id: linux
+ goos: [linux]
+ goarch: [386, arm, amd64, arm64]
+
+ - <<: *build_defaults
+ id: windows
+ goos: [windows]
+ goarch: [amd64]
+
+archives:
+ - id: nix
+ builds: [macOS, linux]
+ <<: &archive_defaults
+ name_template: "{{ .ProjectName }}_{{ .Version }}_{{ .Os }}_{{ .Arch }}{{ if .Arm }}v{{ .Arm }}{{ end }}"
+ wrap_in_directory: true
+ rlcp: true
+ format: tar.gz
+ files:
+ - LICENSE
+
+ - id: windows
+ builds: [windows]
+ <<: *archive_defaults
+ wrap_in_directory: false
+ format: zip
+ files:
+ - LICENSE
+
+checksum:
+ name_template: 'checksums.txt'
+ algorithm: sha256
+
+changelog:
+ skip: true
+ use: github
+ sort: desc
+ filters:
+ exclude:
+ - '^doc:'
+ - '^dev:'
+ - '^build:'
+ - '^ci:'
diff --git a/vendor/github.com/adhocore/gronx/README.md b/vendor/github.com/adhocore/gronx/README.md
index 59edd0aa..6093eb44 100644
--- a/vendor/github.com/adhocore/gronx/README.md
+++ b/vendor/github.com/adhocore/gronx/README.md
@@ -6,16 +6,16 @@
[](https://github.com/adhocore/gronx/actions/workflows/test-action.yml)
[](https://github.com/adhocore/gronx/actions/workflows/lint-action.yml)
[](https://codecov.io/gh/adhocore/gronx)
-[](https://www.paypal.me/ji10/15usd)
-[](https://www.paypal.me/ji10/25usd)
-[](https://www.paypal.me/ji10/50usd)
+[](https://github.com/sponsors/adhocore)
[](https://twitter.com/intent/tweet?text=Lightweight+fast+and+deps+free+cron+expression+parser+for+Golang&url=https://github.com/adhocore/gronx&hashtags=go,golang,parser,cron,cronexpr,cronparser)
-`gronx` is Golang cron expression parser ported from [adhocore/cron-expr](https://github.com/adhocore/php-cron-expr) with task runner
+`gronx` is Golang [cron expression](#cron-expression) parser ported from [adhocore/cron-expr](https://github.com/adhocore/php-cron-expr) with task runner
and daemon that supports crontab like task list file. Use it programatically in Golang or as standalone binary instead of crond.
- Zero dependency.
- Very **fast** because it bails early in case a segment doesn't match.
+- Built in crontab like daemon.
+- Supports time granularity of Seconds.
Find gronx in [pkg.go.dev](https://pkg.go.dev/github.com/adhocore/gronx).
@@ -47,9 +47,32 @@ gron.IsDue(expr) // true|false, nil
gron.IsDue(expr, time.Date(2021, time.April, 1, 1, 1, 0, 0, time.UTC)) // true|false, nil
```
+### Batch Due Check
+
+If you have multiple cron expressions to check due on same reference time use `BatchDue()`:
+```go
+gron := gronx.New()
+exprs := []string{"* * * * *", "0 */5 * * * *"}
+
+// gives []gronx.Expr{} array, each item has Due flag and Err enountered.
+dues := gron.BatchDue(exprs)
+
+for _, expr := range dues {
+ if expr.Err != nil {
+ // Handle err
+ } else if expr.Due {
+ // Handle due
+ }
+}
+
+// Or with given time
+ref := time.Now()
+gron.BatchDue(exprs, ref)
+```
+
### Next Tick
-To find out when is the cron due next (onwards):
+To find out when is the cron due next (in near future):
```go
allowCurrent = true // includes current time as well
nextTime, err := gron.NextTick(expr, allowCurrent) // gives time.Time, error
@@ -60,11 +83,26 @@ allowCurrent = false // excludes the ref time
nextTime, err := gron.NextTickAfter(expr, refTime, allowCurrent) // gives time.Time, error
```
+### Prev Tick
+
+To find out when was the cron due previously (in near past):
+```go
+allowCurrent = true // includes current time as well
+prevTime, err := gron.PrevTick(expr, allowCurrent) // gives time.Time, error
+
+// OR, prev tick before certain reference time
+refTime = time.Date(2022, time.November, 1, 1, 1, 0, 0, time.UTC)
+allowCurrent = false // excludes the ref time
+nextTime, err := gron.PrevTickBefore(expr, refTime, allowCurrent) // gives time.Time, error
+```
+
+> The working of `PrevTick*()` and `NextTick*()` are mostly the same except the direction.
+> They differ in lookback or lookahead.
+
### Standalone Daemon
In a more practical level, you would use this tool to manage and invoke jobs in app itself and not
-mess around with `crontab` for each and every new tasks/jobs. ~~It doesn't yet replace that but rather supplements it.
-There is a plan though [#1](https://github.com/adhocore/gronx/issues/1)~~.
+mess around with `crontab` for each and every new tasks/jobs.
In crontab just put one entry with `* * * * *` which points to your Go entry point that uses this tool.
Then in that entry point you would invoke different tasks if the corresponding Cron expr is due.
@@ -75,7 +113,7 @@ Check the section below for more sophisticated way of managing tasks automatical
---
### Go Tasker
-Tasker is a task manager that can be programatically used in Golang applications. It runs as a daemon and and invokes tasks scheduled with cron expression:
+Tasker is a task manager that can be programatically used in Golang applications. It runs as a daemon and invokes tasks scheduled with cron expression:
```go
package main
@@ -108,8 +146,12 @@ func main() {
return 0, nil
})
+ // run task without overlap, set concurrent flag to false:
+ concurrent := false
+ taskr.Task("* * * * * *", , tasker.Taskify("sleep 2", tasker.Option{}), concurrent)
+
// every 10 minute with arbitrary command
- taskr.Task("@10minutes", taskr.Taskify("command --option val -- args"))
+ taskr.Task("@10minutes", taskr.Taskify("command --option val -- args", tasker.Option{Shell: "/bin/sh -c"}))
// ... add more tasks
@@ -122,14 +164,31 @@ func main() {
}
```
+#### Concurrency
+
+By default the tasks can run concurrently i.e if previous run is still not finished
+but it is now due again, it will run again.
+If you want to run only one instance of a task at a time, set concurrent flag to false:
+
+```go
+taskr := tasker.New(tasker.Option{})
+
+concurrent := false
+expr, task := "* * * * * *", tasker.Taskify("php -r 'sleep(2);'")
+taskr.Task(expr, task, concurrent)
+```
+
### Task Daemon
+
It can also be used as standalone task daemon instead of programmatic usage for Golang application.
First, just install tasker command:
```sh
-go get -u github.com/adhocore/gronx/cmd/tasker
+go install github.com/adhocore/gronx/cmd/tasker@latest
```
+Or you can also download latest prebuilt binary from [release](https://github.com/adhocore/gronx/releases/latest) for platform of your choice.
+
Then prepare a taskfile ([example](./tests/../test/taskfile.txt)) in crontab format
(or can even point to existing crontab).
> `user` is not supported: it is just cron expr followed by the command.
@@ -141,6 +200,7 @@ tasker -file path/to/taskfile
> You can pass more options to control the behavior of task daemon, see below.
#### Tasker command options:
+
```txt
-file string <required>
The task file in crontab format
@@ -169,6 +229,7 @@ tasker -tz America/New_York -file path/to/taskfile -shell zsh # run all tasks us
> Same timezone applies for all tasks currently and it might support overriding timezone per task in future release.
#### Notes on Windows
+
In Windows if it doesn't find `bash.exe` or `git-bash.exe` it will use `powershell`.
`powershell` may not be compatible with Unix flavored commands. Also to note:
you can't do chaining with `cmd1 && cmd2` but rather `cmd1 ; cmd2`.
@@ -176,29 +237,40 @@ you can't do chaining with `cmd1 && cmd2` but rather `cmd1 ; cmd2`.
---
### Cron Expression
-Cron expression normally consists of 5 segments viz:
+A complete cron expression consists of 7 segments viz:
+```
+<second> <minute> <hour> <day> <month> <weekday> <year>
+```
+
+However only 5 will do and this is most commonly used. 5 segments are interpreted as:
```
<minute> <hour> <day> <month> <weekday>
```
-and sometimes there can be 6th segment for `<year>` at the end.
+in which case a default value of 0 is prepended for `<second>` position.
-For each segments you can have multiple choices separated by comma:
-> Eg: `0,30 * * * *` means either 0th or 30th minute.
+In a 6 segments expression, if 6th segment matches `<year>` (i.e 4 digits at least) it will be interpreted as:
+```
+<minute> <hour> <day> <month> <weekday> <year>
+```
+and a default value of 0 is prepended for `<second>` position.
-To specify range of values you can use dash:
-> Eg: `10-15 * * * *` means 10th, 11th, 12th, 13th, 14th and 15th minute.
+For each segments you can have **multiple choices** separated by comma:
+> Eg: `0 0,30 * * * *` means either 0th or 30th minute.
-To specify range of step you can combine a dash and slash:
-> Eg: `10-15/2 * * * *` means every 2 minutes between 10 and 15 i.e 10th, 12th and 14th minute.
+To specify **range of values** you can use dash:
+> Eg: `0 10-15 * * * *` means 10th, 11th, 12th, 13th, 14th and 15th minute.
-For the 3rd and 5th segment, there are additional [modifiers](#modifiers) (optional).
+To specify **range of step** you can combine a dash and slash:
+> Eg: `0 10-15/2 * * * *` means every 2 minutes between 10 and 15 i.e 10th, 12th and 14th minute.
-And if you want, you can mix them up:
-> `5,12-20/4,55 * * * *` matches if any one of `5` or `12-20/4` or `55` matches the minute.
+For the `<day>` and `<weekday>` segment, there are additional [**modifiers**](#modifiers) (optional).
+
+And if you want, you can mix the multiple choices, ranges and steps in a single expression:
+> `0 5,12-20/4,55 * * * *` matches if any one of `5` or `12-20/4` or `55` matches the minute.
### Real Abbreviations
-You can use real abbreviations for month and week days. eg: `JAN`, `dec`, `fri`, `SUN`
+You can use real abbreviations (3 chars) for month and week days. eg: `JAN`, `dec`, `fri`, `SUN`
### Tags
@@ -214,8 +286,13 @@ Following tags are available and they are converted to real cron expressions bef
- *@15minutes* - every 15 minutes
- *@30minutes* - every 30 minutes
- *@always* - every minute
+- *@everysecond* - every second
+
+> For BC reasons, `@always` still means every minute for now, in future release it may mean every seconds instead.
```go
+// Use tags like so:
+gron.IsDue("@hourly")
gron.IsDue("@5minutes")
```
@@ -223,10 +300,10 @@ gron.IsDue("@5minutes")
Following modifiers supported
-- *Day of Month / 3rd segment:*
+- *Day of Month / 3rd of 5 segments / 4th of 6+ segments:*
- `L` stands for last day of month (eg: `L` could mean 29th for February in leap year)
- `W` stands for closest week day (eg: `10W` is closest week days (MON-FRI) to 10th date)
-- *Day of Week / 5th segment:*
+- *Day of Week / 5th of 5 segments / 6th of 6+ segments:*
- `L` stands for last weekday of month (eg: `2L` is last monday)
- `#` stands for nth day of week in the month (eg: `1#2` is second sunday)
@@ -242,9 +319,10 @@ release managed by [please](https://github.com/adhocore/please).
---
### Other projects
+
My other golang projects you might find interesting and useful:
- [**urlsh**](https://github.com/adhocore/urlsh) - URL shortener and bookmarker service with UI, API, Cache, Hits Counter and forwarder using postgres and redis in backend, bulma in frontend; has [web](https://urlssh.xyz) and cli client
- [**fast**](https://github.com/adhocore/fast) - Check your internet speed with ease and comfort right from the terminal
- [**goic**](https://github.com/adhocore/goic) - Go Open ID Connect, is OpenID connect client library for Golang, supports the Authorization Code Flow of OpenID Connect specification.
-- [**chin**](https://github.com/adhocore/chin) - A GO lang command line tool to show a spinner as user waits for some long running jobs to finish.
+- [**chin**](https://github.com/adhocore/chin) - A Go lang command line tool to show a spinner as user waits for some long running jobs to finish.
diff --git a/vendor/github.com/adhocore/gronx/batch.go b/vendor/github.com/adhocore/gronx/batch.go
new file mode 100644
index 00000000..63d85ec2
--- /dev/null
+++ b/vendor/github.com/adhocore/gronx/batch.go
@@ -0,0 +1,51 @@
+package gronx
+
+import (
+ "strings"
+ "time"
+)
+
+// Expr represents an item in array for batch check
+type Expr struct {
+ Expr string
+ Due bool
+ Err error
+}
+
+// BatchDue checks if multiple expressions are due for given time (or now).
+// It returns []Expr with filled in Due and Err values.
+func (g *Gronx) BatchDue(exprs []string, ref ...time.Time) []Expr {
+ ref = append(ref, time.Now())
+ g.C.SetRef(ref[0])
+
+ var segs []string
+
+ cache, batch := map[string]Expr{}, make([]Expr, len(exprs))
+ for i := range exprs {
+ batch[i].Expr = exprs[i]
+ segs, batch[i].Err = Segments(exprs[i])
+ key := strings.Join(segs, " ")
+ if batch[i].Err != nil {
+ cache[key] = batch[i]
+ continue
+ }
+
+ if c, ok := cache[key]; ok {
+ batch[i] = c
+ batch[i].Expr = exprs[i]
+ continue
+ }
+
+ due := true
+ for pos, seg := range segs {
+ if seg != "*" && seg != "?" {
+ if due, batch[i].Err = g.C.CheckDue(seg, pos); !due || batch[i].Err != nil {
+ break
+ }
+ }
+ }
+ batch[i].Due = due
+ cache[key] = batch[i]
+ }
+ return batch
+}
diff --git a/vendor/github.com/adhocore/gronx/checker.go b/vendor/github.com/adhocore/gronx/checker.go
index 46988d4a..78fd0cca 100644
--- a/vendor/github.com/adhocore/gronx/checker.go
+++ b/vendor/github.com/adhocore/gronx/checker.go
@@ -1,6 +1,7 @@
package gronx
import (
+ "fmt"
"strconv"
"strings"
"time"
@@ -30,26 +31,25 @@ func (c *SegmentChecker) SetRef(ref time.Time) {
// CheckDue checks if the cron segment at given position is due.
// It returns bool or error if any.
-func (c *SegmentChecker) CheckDue(segment string, pos int) (bool, error) {
+func (c *SegmentChecker) CheckDue(segment string, pos int) (due bool, err error) {
ref, last := c.GetRef(), -1
val, loc := valueByPos(ref, pos), ref.Location()
+ isMonth, isWeekDay := pos == 3, pos == 5
for _, offset := range strings.Split(segment, ",") {
- mod := pos == 2 || pos == 4
- due, err := c.isOffsetDue(offset, val, pos)
-
- if due || (!mod && err != nil) {
- return due, err
+ mod := (isMonth || isWeekDay) && strings.ContainsAny(offset, "LW#")
+ if due, err = c.isOffsetDue(offset, val, pos); due || (!mod && err != nil) {
+ return
}
- if mod && !strings.ContainsAny(offset, "LW#") {
+ if !mod {
continue
}
if last == -1 {
last = time.Date(ref.Year(), ref.Month(), 1, 0, 0, 0, 0, loc).AddDate(0, 1, 0).Add(-time.Nanosecond).Day()
}
- if pos == 2 {
+ if isMonth {
due, err = isValidMonthDay(offset, last, ref)
- } else if pos == 4 {
+ } else if isWeekDay {
due, err = isValidWeekDay(offset, last, ref)
}
if due || err != nil {
@@ -64,17 +64,19 @@ func (c *SegmentChecker) isOffsetDue(offset string, val, pos int) (bool, error)
if offset == "*" || offset == "?" {
return true, nil
}
+
+ bounds, isWeekDay := boundsByPos(pos), pos == 5
if strings.Contains(offset, "/") {
- return inStep(val, offset)
+ return inStep(val, offset, bounds)
}
if strings.Contains(offset, "-") {
- if pos == 4 {
+ if isWeekDay {
offset = strings.Replace(offset, "7-", "0-", 1)
}
- return inRange(val, offset)
+ return inRange(val, offset, bounds)
}
- if pos != 4 && (val == 0 || offset == "0") {
+ if !isWeekDay && (val == 0 || offset == "0") {
return offset == "0" && val == 0, nil
}
@@ -82,29 +84,48 @@ func (c *SegmentChecker) isOffsetDue(offset string, val, pos int) (bool, error)
if err != nil {
return false, err
}
-
- if pos == 4 && nval == 7 {
- nval = 0
+ if nval < bounds[0] || nval > bounds[1] {
+ return false, fmt.Errorf("segment#%d: '%s' out of bounds(%d, %d)", pos, offset, bounds[0], bounds[1])
}
- return nval == val, nil
+ return nval == val || (isWeekDay && nval == 7 && val == 0), nil
}
-func valueByPos(ref time.Time, pos int) int {
+func valueByPos(ref time.Time, pos int) (val int) {
switch pos {
case 0:
- return ref.Minute()
+ val = ref.Second()
case 1:
- return ref.Hour()
+ val = ref.Minute()
case 2:
- return ref.Day()
+ val = ref.Hour()
case 3:
- return int(ref.Month())
+ val = ref.Day()
case 4:
- return int(ref.Weekday())
+ val = int(ref.Month())
case 5:
- return ref.Year()
+ val = int(ref.Weekday())
+ case 6:
+ val = ref.Year()
}
-
- return 0
+ return
+}
+
+func boundsByPos(pos int) (bounds []int) {
+ bounds = []int{0, 0}
+ switch pos {
+ case 0, 1:
+ bounds = []int{0, 59}
+ case 2:
+ bounds = []int{0, 23}
+ case 3:
+ bounds = []int{1, 31}
+ case 4:
+ bounds = []int{1, 12}
+ case 5:
+ bounds = []int{0, 7}
+ case 6:
+ bounds = []int{1, 9999}
+ }
+ return
}
diff --git a/vendor/github.com/adhocore/gronx/gronx.go b/vendor/github.com/adhocore/gronx/gronx.go
index 4b57da2a..f86f904d 100644
--- a/vendor/github.com/adhocore/gronx/gronx.go
+++ b/vendor/github.com/adhocore/gronx/gronx.go
@@ -25,10 +25,13 @@ var expressions = map[string]string{
"@10minutes": "*/10 * * * *",
"@15minutes": "*/15 * * * *",
"@30minutes": "0,30 * * * *",
+
+ "@everysecond": "* * * * * *",
}
// SpaceRe is regex for whitespace.
var SpaceRe = regexp.MustCompile(`\s+`)
+var yearRe = regexp.MustCompile(`\d{4}`)
func normalize(expr string) []string {
expr = strings.Trim(expr, " \t")
@@ -55,11 +58,8 @@ func New() Gronx {
// IsDue checks if cron expression is due for given reference time (or now).
// It returns bool or error if any.
func (g *Gronx) IsDue(expr string, ref ...time.Time) (bool, error) {
- if len(ref) > 0 {
- g.C.SetRef(ref[0])
- } else {
- g.C.SetRef(time.Now())
- }
+ ref = append(ref, time.Now())
+ g.C.SetRef(ref[0])
segs, err := Segments(expr)
if err != nil {
@@ -69,12 +69,25 @@ func (g *Gronx) IsDue(expr string, ref ...time.Time) (bool, error) {
return g.SegmentsDue(segs)
}
+func (g *Gronx) isDue(expr string, ref time.Time) bool {
+ due, err := g.IsDue(expr, ref)
+ return err == nil && due
+}
+
// Segments splits expr into array array of cron parts.
+// If expression contains 5 parts or 6th part is year like, it prepends a second.
// It returns array or error.
func Segments(expr string) ([]string, error) {
segs := normalize(expr)
- if len(segs) < 5 || len(segs) > 6 {
- return []string{}, errors.New("expr should contain 5-6 segments separated by space")
+ slen := len(segs)
+ if slen < 5 || slen > 7 {
+ return []string{}, errors.New("expr should contain 5-7 segments separated by space")
+ }
+
+ // Prepend second if required
+ prepend := slen == 5 || (slen == 6 && yearRe.MatchString(segs[5]))
+ if prepend {
+ segs = append([]string{"0"}, segs...)
}
return segs, nil
@@ -82,8 +95,8 @@ func Segments(expr string) ([]string, error) {
// SegmentsDue checks if all cron parts are due.
// It returns bool. You should use IsDue(expr) instead.
-func (g *Gronx) SegmentsDue(segments []string) (bool, error) {
- for pos, seg := range segments {
+func (g *Gronx) SegmentsDue(segs []string) (bool, error) {
+ for pos, seg := range segs {
if seg == "*" || seg == "?" {
continue
}
@@ -99,7 +112,17 @@ func (g *Gronx) SegmentsDue(segments []string) (bool, error) {
// IsValid checks if cron expression is valid.
// It returns bool.
func (g *Gronx) IsValid(expr string) bool {
- _, err := g.IsDue(expr)
+ segs, err := Segments(expr)
+ if err != nil {
+ return false
+ }
- return err == nil
+ g.C.SetRef(time.Now())
+ for pos, seg := range segs {
+ if _, err := g.C.CheckDue(seg, pos); err != nil {
+ return false
+ }
+ }
+
+ return true
}
diff --git a/vendor/github.com/adhocore/gronx/next.go b/vendor/github.com/adhocore/gronx/next.go
index 7700fe91..9b940ffb 100644
--- a/vendor/github.com/adhocore/gronx/next.go
+++ b/vendor/github.com/adhocore/gronx/next.go
@@ -22,58 +22,64 @@ func NextTick(expr string, inclRefTime bool) (time.Time, error) {
// NextTickAfter gives next run time from the provided time.Time
func NextTickAfter(expr string, start time.Time, inclRefTime bool) (time.Time, error) {
- gron, next := New(), start.Truncate(time.Minute)
+ gron, next := New(), start.Truncate(time.Second)
due, err := gron.IsDue(expr, start)
if err != nil || (due && inclRefTime) {
return start, err
}
segments, _ := Segments(expr)
- if len(segments) > 5 && isPastYear(segments[5], next, inclRefTime) {
- return next, fmt.Errorf("unreachable year segment: %s", segments[5])
+ if len(segments) > 6 && isUnreachableYear(segments[6], next, inclRefTime, false) {
+ return next, fmt.Errorf("unreachable year segment: %s", segments[6])
}
- if next, err = loop(gron, segments, next, inclRefTime); err != nil {
- // Ignore superfluous err
- if due, _ = gron.IsDue(expr, next); due {
- err = nil
- }
+ next, err = loop(gron, segments, next, inclRefTime, false)
+ // Ignore superfluous err
+ if err != nil && gron.isDue(expr, next) {
+ err = nil
}
return next, err
}
-func loop(gron Gronx, segments []string, start time.Time, incl bool) (next time.Time, err error) {
- iter, next, bumped := 1000, start, false
+func loop(gron Gronx, segments []string, start time.Time, incl bool, reverse bool) (next time.Time, err error) {
+ iter, next, bumped := 500, start, false
+over:
for iter > 0 {
- over:
iter--
for pos, seg := range segments {
if seg == "*" || seg == "?" {
continue
}
- if next, bumped, err = bumpUntilDue(gron.C, seg, pos, next); bumped {
+ if next, bumped, err = bumpUntilDue(gron.C, seg, pos, next, reverse); bumped {
goto over
}
}
- if !incl && next.Format(CronDateFormat) == start.Format(CronDateFormat) {
- next, _, err = bumpUntilDue(gron.C, segments[0], 0, next.Add(time.Minute))
+ if !incl && next.Format(FullDateFormat) == start.Format(FullDateFormat) {
+ delta := time.Second
+ if reverse {
+ delta = -time.Second
+ }
+ next, _, err = bumpUntilDue(gron.C, segments[0], 0, next.Add(delta), reverse)
continue
}
- return next, err
+ return
}
return start, errors.New("tried so hard")
}
var dashRe = regexp.MustCompile(`/.*$`)
-func isPastYear(year string, ref time.Time, incl bool) bool {
+func isUnreachableYear(year string, ref time.Time, incl bool, reverse bool) bool {
if year == "*" || year == "?" {
return false
}
- min := ref.Year()
+ edge, inc := ref.Year(), 1
if !incl {
- min++
+ if reverse {
+ inc = -1
+ }
+ edge += inc
}
for _, offset := range strings.Split(year, ",") {
if strings.Index(offset, "*/") == 0 || strings.Index(offset, "0/") == 0 {
@@ -81,7 +87,7 @@ func isPastYear(year string, ref time.Time, incl bool) bool {
}
for _, part := range strings.Split(dashRe.ReplaceAllString(offset, ""), "-") {
val, err := strconv.Atoi(part)
- if err != nil || val >= min {
+ if err != nil || (!reverse && val >= edge) || (reverse && val < edge) {
return false
}
}
@@ -89,34 +95,41 @@ func isPastYear(year string, ref time.Time, incl bool) bool {
return true
}
-var limit = map[int]int{0: 60, 1: 24, 2: 31, 3: 12, 4: 366, 5: 100}
+var limit = map[int]int{0: 60, 1: 60, 2: 24, 3: 31, 4: 12, 5: 366, 6: 100}
-func bumpUntilDue(c Checker, segment string, pos int, ref time.Time) (time.Time, bool, error) {
- // <minute> <hour> <day> <month> <weekday>
+func bumpUntilDue(c Checker, segment string, pos int, ref time.Time, reverse bool) (time.Time, bool, error) {
+ // <second> <minute> <hour> <day> <month> <weekday> <year>
iter := limit[pos]
for iter > 0 {
c.SetRef(ref)
if ok, _ := c.CheckDue(segment, pos); ok {
return ref, iter != limit[pos], nil
}
- ref = bump(ref, pos)
+ ref = bump(ref, pos, reverse)
iter--
}
return ref, false, errors.New("tried so hard")
}
-func bump(ref time.Time, pos int) time.Time {
+func bump(ref time.Time, pos int, reverse bool) time.Time {
+ factor := 1
+ if reverse {
+ factor = -1
+ }
+
switch pos {
case 0:
- ref = ref.Add(time.Minute)
+ ref = ref.Add(time.Duration(factor) * time.Second)
case 1:
- ref = ref.Add(time.Hour)
- case 2, 4:
- ref = ref.AddDate(0, 0, 1)
- case 3:
- ref = ref.AddDate(0, 1, 0)
- case 5:
- ref = ref.AddDate(1, 0, 0)
+ ref = ref.Add(time.Duration(factor) * time.Minute)
+ case 2:
+ ref = ref.Add(time.Duration(factor) * time.Hour)
+ case 3, 5:
+ ref = ref.AddDate(0, 0, factor)
+ case 4:
+ ref = ref.AddDate(0, factor, 0)
+ case 6:
+ ref = ref.AddDate(factor, 0, 0)
}
return ref
}
diff --git a/vendor/github.com/adhocore/gronx/prev.go b/vendor/github.com/adhocore/gronx/prev.go
new file mode 100644
index 00000000..d900bf73
--- /dev/null
+++ b/vendor/github.com/adhocore/gronx/prev.go
@@ -0,0 +1,32 @@
+package gronx
+
+import (
+ "fmt"
+ "time"
+)
+
+// PrevTick gives previous run time before now
+func PrevTick(expr string, inclRefTime bool) (time.Time, error) {
+ return PrevTickBefore(expr, time.Now(), inclRefTime)
+}
+
+// PrevTickBefore gives previous run time before given reference time
+func PrevTickBefore(expr string, start time.Time, inclRefTime bool) (time.Time, error) {
+ gron, prev := New(), start.Truncate(time.Second)
+ due, err := gron.IsDue(expr, start)
+ if err != nil || (due && inclRefTime) {
+ return prev, err
+ }
+
+ segments, _ := Segments(expr)
+ if len(segments) > 6 && isUnreachableYear(segments[6], prev, inclRefTime, true) {
+ return prev, fmt.Errorf("unreachable year segment: %s", segments[6])
+ }
+
+ prev, err = loop(gron, segments, prev, inclRefTime, true)
+ // Ignore superfluous err
+ if err != nil && gron.isDue(expr, prev) {
+ err = nil
+ }
+ return prev, err
+}
diff --git a/vendor/github.com/adhocore/gronx/validator.go b/vendor/github.com/adhocore/gronx/validator.go
index 074415b8..d772ad7f 100644
--- a/vendor/github.com/adhocore/gronx/validator.go
+++ b/vendor/github.com/adhocore/gronx/validator.go
@@ -2,12 +2,13 @@ package gronx
import (
"errors"
+ "fmt"
"strconv"
"strings"
"time"
)
-func inStep(val int, s string) (bool, error) {
+func inStep(val int, s string, bounds []int) (bool, error) {
parts := strings.Split(s, "/")
step, err := strconv.Atoi(parts[1])
if err != nil {
@@ -34,10 +35,14 @@ func inStep(val int, s string) (bool, error) {
}
}
+ if (len(sub) > 1 && end < start) || start < bounds[0] || end > bounds[1] {
+ return false, fmt.Errorf("step '%s' out of bounds(%d, %d)", parts[0], bounds[0], bounds[1])
+ }
+
return inStepRange(val, start, end, step), nil
}
-func inRange(val int, s string) (bool, error) {
+func inRange(val int, s string, bounds []int) (bool, error) {
parts := strings.Split(s, "-")
start, err := strconv.Atoi(parts[0])
if err != nil {
@@ -49,6 +54,10 @@ func inRange(val int, s string) (bool, error) {
return false, err
}
+ if end < start || start < bounds[0] || end > bounds[1] {
+ return false, fmt.Errorf("range '%s' out of bounds(%d, %d)", s, bounds[0], bounds[1])
+ }
+
return start <= val && val <= end, nil
}
@@ -61,7 +70,7 @@ func inStepRange(val, start, end, step int) bool {
return false
}
-func isValidMonthDay(val string, last int, ref time.Time) (bool, error) {
+func isValidMonthDay(val string, last int, ref time.Time) (valid bool, err error) {
day, loc := ref.Day(), ref.Location()
if val == "L" {
return day == last, nil
@@ -84,12 +93,13 @@ func isValidMonthDay(val string, last int, ref time.Time) (bool, error) {
week := int(iref.Weekday())
if week > 0 && week < 6 && iref.Month() == ref.Month() {
- return day == iref.Day(), nil
+ valid = day == iref.Day()
+ break
}
}
}
- return false, nil
+ return valid, nil
}
func isValidWeekDay(val string, last int, ref time.Time) (bool, error) {
diff --git a/vendor/github.com/caddyserver/certmagic/README.md b/vendor/github.com/caddyserver/certmagic/README.md
index b60f0130..691fca81 100644
--- a/vendor/github.com/caddyserver/certmagic/README.md
+++ b/vendor/github.com/caddyserver/certmagic/README.md
@@ -238,16 +238,17 @@ if err != nil {
For more control (particularly, if you need a different way of managing each certificate), you'll make and use a `Cache` and a `Config` like so:
```go
-cache := certmagic.NewCache(certmagic.CacheOptions{
+// First make a pointer to a Cache as we need to reference the same Cache in
+// GetConfigForCert below.
+var cache *certmagic.Cache
+cache = certmagic.NewCache(certmagic.CacheOptions{
GetConfigForCert: func(cert certmagic.Certificate) (*certmagic.Config, error) {
- // do whatever you need to do to get the right
- // configuration for this certificate; keep in
- // mind that this config value is used as a
- // template, and will be completed with any
- // defaults that are set in the Default config
- return &certmagic.Config{
+ // Here we use New to get a valid Config associated with the same cache.
+ // The provided Config is used as a template and will be completed with
+ // any defaults that are set in the Default config.
+ return certmagic.New(cache, &certmagic.config{
// ...
- }, nil
+ }), nil
},
...
})
diff --git a/vendor/github.com/caddyserver/certmagic/acmeissuer.go b/vendor/github.com/caddyserver/certmagic/acmeissuer.go
index 83073b5c..e930878b 100644
--- a/vendor/github.com/caddyserver/certmagic/acmeissuer.go
+++ b/vendor/github.com/caddyserver/certmagic/acmeissuer.go
@@ -115,6 +115,10 @@ type ACMEIssuer struct {
// desired, set this to zap.NewNop().
Logger *zap.Logger
+ // Set a http proxy to use when issuing a certificate.
+ // Default is http.ProxyFromEnvironment
+ HTTPProxy func(*http.Request) (*url.URL, error)
+
config *Config
httpClient *http.Client
@@ -204,6 +208,13 @@ func NewACMEIssuer(cfg *Config, template ACMEIssuer) *ACMEIssuer {
template.Logger = defaultLogger
}
+ if template.HTTPProxy == nil {
+ template.HTTPProxy = DefaultACME.HTTPProxy
+ }
+ if template.HTTPProxy == nil {
+ template.HTTPProxy = http.ProxyFromEnvironment
+ }
+
template.config = cfg
template.mu = new(sync.Mutex)
@@ -223,7 +234,7 @@ func NewACMEIssuer(cfg *Config, template ACMEIssuer) *ACMEIssuer {
}
}
transport := &http.Transport{
- Proxy: http.ProxyFromEnvironment,
+ Proxy: template.HTTPProxy,
DialContext: dialer.DialContext,
TLSHandshakeTimeout: 30 * time.Second, // increase to 30s requested in #175
ResponseHeaderTimeout: 30 * time.Second, // increase to 30s requested in #175
@@ -506,9 +517,10 @@ type ChainPreference struct {
// DefaultACME specifies default settings to use for ACMEIssuers.
// Using this value is optional but can be convenient.
var DefaultACME = ACMEIssuer{
- CA: LetsEncryptProductionCA,
- TestCA: LetsEncryptStagingCA,
- Logger: defaultLogger,
+ CA: LetsEncryptProductionCA,
+ TestCA: LetsEncryptStagingCA,
+ Logger: defaultLogger,
+ HTTPProxy: http.ProxyFromEnvironment,
}
// Some well-known CA endpoints available to use.
diff --git a/vendor/github.com/caddyserver/certmagic/cache.go b/vendor/github.com/caddyserver/certmagic/cache.go
index f5ab8684..a28021cc 100644
--- a/vendor/github.com/caddyserver/certmagic/cache.go
+++ b/vendor/github.com/caddyserver/certmagic/cache.go
@@ -145,7 +145,8 @@ type CacheOptions struct {
// used for managing a certificate, or for accessing
// that certificate's asset storage (e.g. for
// OCSP staples, etc). The returned Config MUST
- // be associated with the same Cache as the caller.
+ // be associated with the same Cache as the caller,
+ // use New to obtain a valid Config.
//
// The reason this is a callback function, dynamically
// returning a Config (instead of attaching a static
@@ -197,14 +198,29 @@ func (certCache *Cache) cacheCertificate(cert Certificate) {
// This function is NOT safe for concurrent use. Callers MUST acquire
// a write lock on certCache.mu first.
func (certCache *Cache) unsyncedCacheCertificate(cert Certificate) {
- // no-op if this certificate already exists in the cache
- if _, ok := certCache.cache[cert.hash]; ok {
- certCache.logger.Debug("certificate already cached",
+ // if this certificate already exists in the cache, this is basically
+ // a no-op so we reuse existing cert (prevent duplication), but we do
+ // modify the cert to add tags it may be missing (see issue #211)
+ if existingCert, ok := certCache.cache[cert.hash]; ok {
+ logMsg := "certificate already cached"
+
+ if len(cert.Tags) > 0 {
+ for _, tag := range cert.Tags {
+ if !existingCert.HasTag(tag) {
+ existingCert.Tags = append(existingCert.Tags, tag)
+ }
+ }
+ certCache.cache[cert.hash] = existingCert
+ logMsg += "; appended any missing tags to cert"
+ }
+
+ certCache.logger.Debug(logMsg,
zap.Strings("subjects", cert.Names),
zap.Time("expiration", expiresAt(cert.Leaf)),
zap.Bool("managed", cert.managed),
zap.String("issuer_key", cert.issuerKey),
- zap.String("hash", cert.hash))
+ zap.String("hash", cert.hash),
+ zap.Strings("tags", cert.Tags))
return
}
@@ -327,7 +343,11 @@ func (certCache *Cache) getConfig(cert Certificate) (*Config, error) {
if err != nil {
return nil, err
}
- if cfg.certCache != nil && cfg.certCache != certCache {
+ if cfg.certCache == nil {
+ return nil, fmt.Errorf("config returned for certificate %v has nil cache; expected %p (this one)",
+ cert.Names, certCache)
+ }
+ if cfg.certCache != certCache {
return nil, fmt.Errorf("config returned for certificate %v is not nil and points to different cache; got %p, expected %p (this one)",
cert.Names, cfg.certCache, certCache)
}
diff --git a/vendor/github.com/caddyserver/certmagic/certificates.go b/vendor/github.com/caddyserver/certmagic/certificates.go
index 5f9d0c89..9e983406 100644
--- a/vendor/github.com/caddyserver/certmagic/certificates.go
+++ b/vendor/github.com/caddyserver/certmagic/certificates.go
@@ -113,6 +113,9 @@ func (cert Certificate) HasTag(tag string) bool {
// resolution of ASN.1 UTCTime/GeneralizedTime by including the extra fraction
// of a second of certificate validity beyond the NotAfter value.
func expiresAt(cert *x509.Certificate) time.Time {
+ if cert == nil {
+ return time.Time{}
+ }
return cert.NotAfter.Truncate(time.Second).Add(1 * time.Second)
}
diff --git a/vendor/github.com/caddyserver/certmagic/certmagic.go b/vendor/github.com/caddyserver/certmagic/certmagic.go
index 9ee121dc..8200431f 100644
--- a/vendor/github.com/caddyserver/certmagic/certmagic.go
+++ b/vendor/github.com/caddyserver/certmagic/certmagic.go
@@ -270,7 +270,16 @@ type OnDemandConfig struct {
// request will be denied.
DecisionFunc func(name string) error
- // List of whitelisted hostnames (SNI values) for
+ // Sources for getting new, unmanaged certificates.
+ // They will be invoked only during TLS handshakes
+ // before on-demand certificate management occurs,
+ // for certificates that are not already loaded into
+ // the in-memory cache.
+ //
+ // TODO: EXPERIMENTAL: subject to change and/or removal.
+ Managers []Manager
+
+ // List of allowed hostnames (SNI values) for
// deferred (on-demand) obtaining of certificates.
// Used only by higher-level functions in this
// package to persist the list of hostnames that
@@ -282,15 +291,15 @@ type OnDemandConfig struct {
// for higher-level convenience functions to be
// able to retain their convenience (alternative
// is: the user manually creates a DecisionFunc
- // that whitelists the same names it already
- // passed into Manage) and without letting clients
- // have their run of any domain names they want.
+ // that allows the same names it already passed
+ // into Manage) and without letting clients have
+ // their run of any domain names they want.
// Only enforced if len > 0.
- hostWhitelist []string
+ hostAllowlist []string
}
-func (o *OnDemandConfig) whitelistContains(name string) bool {
- for _, n := range o.hostWhitelist {
+func (o *OnDemandConfig) allowlistContains(name string) bool {
+ for _, n := range o.hostAllowlist {
if strings.EqualFold(n, name) {
return true
}
@@ -433,7 +442,7 @@ type CertificateResource struct {
// The unique string identifying the issuer of the
// certificate; internally useful for storage access.
- issuerKey string `json:"-"`
+ issuerKey string
}
// NamesKey returns the list of SANs as a single string,
diff --git a/vendor/github.com/caddyserver/certmagic/config.go b/vendor/github.com/caddyserver/certmagic/config.go
index 3cb11bb8..ddafa87e 100644
--- a/vendor/github.com/caddyserver/certmagic/config.go
+++ b/vendor/github.com/caddyserver/certmagic/config.go
@@ -72,6 +72,13 @@ type Config struct {
// ClientHello's ServerName field is empty.
DefaultServerName string
+ // FallbackServerName specifies a server name
+ // to use when choosing a certificate if the
+ // ClientHello's ServerName field doesn't match
+ // any available certificate.
+ // EXPERIMENTAL: Subject to change or removal.
+ FallbackServerName string
+
// The state needed to operate on-demand TLS;
// if non-nil, on-demand TLS is enabled and
// certificate operations are deferred to
@@ -88,15 +95,6 @@ type Config struct {
// turn until one succeeds.
Issuers []Issuer
- // Sources for getting new, unmanaged certificates.
- // They will be invoked only during TLS handshakes
- // before on-demand certificate management occurs,
- // for certificates that are not already loaded into
- // the in-memory cache.
- //
- // TODO: EXPERIMENTAL: subject to change and/or removal.
- Managers []Manager
-
// The source of new private keys for certificates;
// the default KeySource is StandardKeyGenerator.
KeySource KeyGenerator
@@ -119,6 +117,16 @@ type Config struct {
// TLS assets. Default is the local file system.
Storage Storage
+ // CertMagic will verify the storage configuration
+ // is acceptable before obtaining a certificate
+ // to avoid information loss after an expensive
+ // operation. If you are absolutely 100% sure your
+ // storage is properly configured and has sufficient
+ // space, you can disable this check to reduce I/O
+ // if that is expensive for you.
+ // EXPERIMENTAL: Option subject to change or removal.
+ DisableStorageCheck bool
+
// Set a logger to enable logging. If not set,
// a default logger will be created.
Logger *zap.Logger
@@ -162,6 +170,7 @@ func NewDefault() *Config {
GetConfigForCert: func(Certificate) (*Config, error) {
return NewDefault(), nil
},
+ Logger: Default.Logger,
})
}
certCache := defaultCache
@@ -209,10 +218,10 @@ func newWithCache(certCache *Cache, cfg Config) *Config {
if !cfg.MustStaple {
cfg.MustStaple = Default.MustStaple
}
- if len(cfg.Issuers) == 0 {
+ if cfg.Issuers == nil {
cfg.Issuers = Default.Issuers
- if len(cfg.Issuers) == 0 {
- // at least one issuer is absolutely required
+ if cfg.Issuers == nil {
+ // at least one issuer is absolutely required if not nil
cfg.Issuers = []Issuer{NewACMEIssuer(&cfg, DefaultACME)}
}
}
@@ -228,6 +237,9 @@ func newWithCache(certCache *Cache, cfg Config) *Config {
if cfg.DefaultServerName == "" {
cfg.DefaultServerName = Default.DefaultServerName
}
+ if cfg.FallbackServerName == "" {
+ cfg.FallbackServerName = Default.FallbackServerName
+ }
if cfg.Storage == nil {
cfg.Storage = Default.Storage
}
@@ -329,12 +341,13 @@ func (cfg *Config) manageAll(ctx context.Context, domainNames []string, async bo
for _, domainName := range domainNames {
// if on-demand is configured, defer obtain and renew operations
if cfg.OnDemand != nil {
- if !cfg.OnDemand.whitelistContains(domainName) {
- cfg.OnDemand.hostWhitelist = append(cfg.OnDemand.hostWhitelist, domainName)
+ if !cfg.OnDemand.allowlistContains(domainName) {
+ cfg.OnDemand.hostAllowlist = append(cfg.OnDemand.hostAllowlist, domainName)
}
continue
}
+ // TODO: consider doing this in a goroutine if async, to utilize multiple cores while loading certs
// otherwise, begin management immediately
err := cfg.manageOne(ctx, domainName, async)
if err != nil {
@@ -587,6 +600,7 @@ func (cfg *Config) obtainCert(ctx context.Context, name string, interactive bool
CertificatePEM: issuedCert.Certificate,
PrivateKeyPEM: privKeyPEM,
IssuerData: issuedCert.Metadata,
+ issuerKey: issuerUsed.IssuerKey(),
}
err = cfg.saveCertResource(ctx, issuerUsed, certRes)
if err != nil {
@@ -812,6 +826,7 @@ func (cfg *Config) renewCert(ctx context.Context, name string, force, interactiv
CertificatePEM: issuedCert.Certificate,
PrivateKeyPEM: certRes.PrivateKeyPEM,
IssuerData: issuedCert.Metadata,
+ issuerKey: issuerUsed.IssuerKey(),
}
err = cfg.saveCertResource(ctx, issuerUsed, newCertRes)
if err != nil {
@@ -1000,6 +1015,9 @@ func (cfg *Config) getChallengeInfo(ctx context.Context, identifier string) (Cha
// comparing the loaded value. If this fails, the provided
// cfg.Storage mechanism should not be used.
func (cfg *Config) checkStorage(ctx context.Context) error {
+ if cfg.DisableStorageCheck {
+ return nil
+ }
key := fmt.Sprintf("rw_test_%d", weakrand.Int())
contents := make([]byte, 1024*10) // size sufficient for one or two ACME resources
_, err := weakrand.Read(contents)
diff --git a/vendor/github.com/caddyserver/certmagic/dnsutil.go b/vendor/github.com/caddyserver/certmagic/dnsutil.go
index a2b7866d..fc93dc2a 100644
--- a/vendor/github.com/caddyserver/certmagic/dnsutil.go
+++ b/vendor/github.com/caddyserver/certmagic/dnsutil.go
@@ -237,7 +237,7 @@ func checkDNSPropagation(fqdn, value string, resolvers []string) (bool, error) {
// checkAuthoritativeNss queries each of the given nameservers for the expected TXT record.
func checkAuthoritativeNss(fqdn, value string, nameservers []string) (bool, error) {
for _, ns := range nameservers {
- r, err := dnsQuery(fqdn, dns.TypeTXT, []string{net.JoinHostPort(ns, "53")}, false)
+ r, err := dnsQuery(fqdn, dns.TypeTXT, []string{net.JoinHostPort(ns, "53")}, true)
if err != nil {
return false, err
}
diff --git a/vendor/github.com/caddyserver/certmagic/handshake.go b/vendor/github.com/caddyserver/certmagic/handshake.go
index d1697d54..6d28ddfc 100644
--- a/vendor/github.com/caddyserver/certmagic/handshake.go
+++ b/vendor/github.com/caddyserver/certmagic/handshake.go
@@ -42,9 +42,15 @@ import (
// 5. Issuers (if on-demand is enabled)
//
// This method is safe for use as a tls.Config.GetCertificate callback.
+//
+// GetCertificate will run in a new context, use GetCertificateWithContext to provide
+// a context.
func (cfg *Config) GetCertificate(clientHello *tls.ClientHelloInfo) (*tls.Certificate, error) {
ctx := context.TODO() // TODO: get a proper context? from somewhere...
+ return cfg.GetCertificateWithContext(ctx, clientHello)
+}
+func (cfg *Config) GetCertificateWithContext(ctx context.Context, clientHello *tls.ClientHelloInfo) (*tls.Certificate, error) {
if err := cfg.emit(ctx, "tls_get_certificate", map[string]any{"client_hello": clientHello}); err != nil {
cfg.Logger.Error("TLS handshake aborted by event handler",
zap.String("server_name", clientHello.ServerName),
@@ -60,6 +66,7 @@ func (cfg *Config) GetCertificate(clientHello *tls.ClientHelloInfo) (*tls.Certif
challengeCert, distributed, err := cfg.getTLSALPNChallengeCert(clientHello)
if err != nil {
cfg.Logger.Error("tls-alpn challenge",
+ zap.String("remote_addr", clientHello.Conn.RemoteAddr().String()),
zap.String("server_name", clientHello.ServerName),
zap.Error(err))
return nil, err
@@ -74,7 +81,7 @@ func (cfg *Config) GetCertificate(clientHello *tls.ClientHelloInfo) (*tls.Certif
}
// get the certificate and serve it up
- cert, err := cfg.getCertDuringHandshake(ctx, clientHello, true, true)
+ cert, err := cfg.getCertDuringHandshake(ctx, clientHello, true)
return &cert.Certificate, err
}
@@ -136,6 +143,20 @@ func (cfg *Config) getCertificateFromCache(hello *tls.ClientHelloInfo) (cert Cer
}
}
+ // a fallback server name can be tried in the very niche
+ // case where a client sends one SNI value but expects or
+ // accepts a different one in return (this is sometimes
+ // the case with CDNs like Cloudflare that send the
+ // downstream ServerName in the handshake but accept
+ // the backend origin's true hostname in a cert).
+ if cfg.FallbackServerName != "" {
+ normFallback := normalizedName(cfg.FallbackServerName)
+ cert, defaulted = cfg.selectCert(hello, normFallback)
+ if defaulted {
+ return
+ }
+ }
+
// otherwise, we're bingo on ammo; see issues
// caddyserver/caddy#2035 and caddyserver/caddy#1303 (any
// change to certificate matching behavior must
@@ -232,18 +253,19 @@ func DefaultCertificateSelector(hello *tls.ClientHelloInfo, choices []Certificat
// An error will be returned if and only if no certificate is available.
//
// This function is safe for concurrent use.
-func (cfg *Config) getCertDuringHandshake(ctx context.Context, hello *tls.ClientHelloInfo, loadIfNecessary, obtainIfNecessary bool) (Certificate, error) {
- log := logWithRemote(cfg.Logger.Named("handshake"), hello)
+func (cfg *Config) getCertDuringHandshake(ctx context.Context, hello *tls.ClientHelloInfo, loadOrObtainIfNecessary bool) (Certificate, error) {
+ logger := logWithRemote(cfg.Logger.Named("handshake"), hello)
+ name := cfg.getNameFromClientHello(hello)
// First check our in-memory cache to see if we've already loaded it
cert, matched, defaulted := cfg.getCertificateFromCache(hello)
if matched {
- log.Debug("matched certificate in cache",
+ logger.Debug("matched certificate in cache",
zap.Strings("subjects", cert.Names),
zap.Bool("managed", cert.managed),
zap.Time("expiration", expiresAt(cert.Leaf)),
zap.String("hash", cert.hash))
- if cert.managed && cfg.OnDemand != nil && obtainIfNecessary {
+ if cert.managed && cfg.OnDemand != nil && loadOrObtainIfNecessary {
// On-demand certificates are maintained in the background, but
// maintenance is triggered by handshakes instead of by a timer
// as in maintain.go.
@@ -252,9 +274,52 @@ func (cfg *Config) getCertDuringHandshake(ctx context.Context, hello *tls.Client
return cert, nil
}
+ // By this point, we need to load or obtain a certificate. If a swarm of requests comes in for the same
+ // domain, avoid pounding manager or storage thousands of times simultaneously. We do a similar sync
+ // strategy for obtaining certificate during handshake.
+ certLoadWaitChansMu.Lock()
+ wait, ok := certLoadWaitChans[name]
+ if ok {
+ // another goroutine is already loading the cert; just wait and we'll get it from the in-memory cache
+ certLoadWaitChansMu.Unlock()
+
+ timeout := time.NewTimer(2 * time.Minute) // TODO: have Caddy use the context param to establish a timeout
+ select {
+ case <-timeout.C:
+ return Certificate{}, fmt.Errorf("timed out waiting to load certificate for %s", name)
+ case <-ctx.Done():
+ timeout.Stop()
+ return Certificate{}, ctx.Err()
+ case <-wait:
+ timeout.Stop()
+ }
+
+ return cfg.getCertDuringHandshake(ctx, hello, false)
+ } else {
+ // no other goroutine is currently trying to load this cert
+ wait = make(chan struct{})
+ certLoadWaitChans[name] = wait
+ certLoadWaitChansMu.Unlock()
+
+ // unblock others and clean up when we're done
+ defer func() {
+ certLoadWaitChansMu.Lock()
+ close(wait)
+ delete(certLoadWaitChans, name)
+ certLoadWaitChansMu.Unlock()
+ }()
+ }
+
+ // Make sure a certificate is allowed for the given name. If not, it doesn't
+ // make sense to try loading one from storage (issue #185), getting it from a
+ // certificate manager, or obtaining one from an issuer.
+ if err := cfg.checkIfCertShouldBeObtained(name, false); err != nil {
+ return Certificate{}, fmt.Errorf("certificate is not allowed for server name %s: %v", name, err)
+ }
+
// If an external Manager is configured, try to get it from them.
// Only continue to use our own logic if it returns empty+nil.
- externalCert, err := cfg.getCertFromAnyCertManager(ctx, hello, log)
+ externalCert, err := cfg.getCertFromAnyCertManager(ctx, hello, logger)
if err != nil {
return Certificate{}, err
}
@@ -262,8 +327,6 @@ func (cfg *Config) getCertDuringHandshake(ctx context.Context, hello *tls.Client
return externalCert, nil
}
- name := cfg.getNameFromClientHello(hello)
-
// We might be able to load or obtain a needed certificate. Load from
// storage if OnDemand is enabled, or if there is the possibility that
// a statically-managed cert was evicted from a full cache.
@@ -282,42 +345,25 @@ func (cfg *Config) getCertDuringHandshake(ctx context.Context, hello *tls.Client
cacheAlmostFull := cacheCapacity > 0 && float64(cacheSize) >= cacheCapacity*.9
loadDynamically := cfg.OnDemand != nil || cacheAlmostFull
- if loadDynamically && loadIfNecessary {
- // Then check to see if we have one on disk
- // TODO: As suggested here, https://caddy.community/t/error-tls-alert-internal-error-592-again/13272/30?u=matt,
- // it might be a good idea to check with the DecisionFunc or allowlist first before even loading the certificate
- // from storage, since if we can't renew it, why should we even try serving it (it will just get evicted after
- // we get a return value of false anyway)? See issue #174
- loadedCert, err := cfg.CacheManagedCertificate(ctx, name)
- if errors.Is(err, fs.ErrNotExist) {
- // If no exact match, try a wildcard variant, which is something we can still use
- labels := strings.Split(name, ".")
- labels[0] = "*"
- loadedCert, err = cfg.CacheManagedCertificate(ctx, strings.Join(labels, "."))
- }
+ if loadDynamically && loadOrObtainIfNecessary {
+ // Check to see if we have one on disk
+ loadedCert, err := cfg.loadCertFromStorage(ctx, logger, hello)
if err == nil {
- log.Debug("loaded certificate from storage",
- zap.Strings("subjects", loadedCert.Names),
- zap.Bool("managed", loadedCert.managed),
- zap.Time("expiration", expiresAt(loadedCert.Leaf)),
- zap.String("hash", loadedCert.hash))
- loadedCert, err = cfg.handshakeMaintenance(ctx, hello, loadedCert)
- if err != nil {
- log.Error("maintaining newly-loaded certificate",
- zap.String("server_name", name),
- zap.Error(err))
- }
return loadedCert, nil
}
- if cfg.OnDemand != nil && obtainIfNecessary {
+ logger.Debug("did not load cert from storage",
+ zap.String("server_name", hello.ServerName),
+ zap.Error(err))
+ if cfg.OnDemand != nil {
// By this point, we need to ask the CA for a certificate
return cfg.obtainOnDemandCertificate(ctx, hello)
}
+ return loadedCert, nil
}
- // Fall back to the default certificate if there is one
+ // Fall back to another certificate if there is one (either DefaultServerName or FallbackServerName)
if defaulted {
- log.Debug("fell back to default certificate",
+ logger.Debug("fell back to default certificate",
zap.Strings("subjects", cert.Names),
zap.Bool("managed", cert.managed),
zap.Time("expiration", expiresAt(cert.Leaf)),
@@ -325,19 +371,44 @@ func (cfg *Config) getCertDuringHandshake(ctx context.Context, hello *tls.Client
return cert, nil
}
- log.Debug("no certificate matching TLS ClientHello",
+ logger.Debug("no certificate matching TLS ClientHello",
zap.String("server_name", hello.ServerName),
zap.String("remote", hello.Conn.RemoteAddr().String()),
zap.String("identifier", name),
zap.Uint16s("cipher_suites", hello.CipherSuites),
zap.Float64("cert_cache_fill", float64(cacheSize)/cacheCapacity), // may be approximate! because we are not within the lock
- zap.Bool("load_if_necessary", loadIfNecessary),
- zap.Bool("obtain_if_necessary", obtainIfNecessary),
+ zap.Bool("load_or_obtain_if_necessary", loadOrObtainIfNecessary),
zap.Bool("on_demand", cfg.OnDemand != nil))
return Certificate{}, fmt.Errorf("no certificate available for '%s'", name)
}
+func (cfg *Config) loadCertFromStorage(ctx context.Context, logger *zap.Logger, hello *tls.ClientHelloInfo) (Certificate, error) {
+ name := normalizedName(hello.ServerName)
+ loadedCert, err := cfg.CacheManagedCertificate(ctx, name)
+ if errors.Is(err, fs.ErrNotExist) {
+ // If no exact match, try a wildcard variant, which is something we can still use
+ labels := strings.Split(name, ".")
+ labels[0] = "*"
+ loadedCert, err = cfg.CacheManagedCertificate(ctx, strings.Join(labels, "."))
+ }
+ if err != nil {
+ return Certificate{}, fmt.Errorf("no matching certificate to load for %s: %w", name, err)
+ }
+ logger.Debug("loaded certificate from storage",
+ zap.Strings("subjects", loadedCert.Names),
+ zap.Bool("managed", loadedCert.managed),
+ zap.Time("expiration", expiresAt(loadedCert.Leaf)),
+ zap.String("hash", loadedCert.hash))
+ loadedCert, err = cfg.handshakeMaintenance(ctx, hello, loadedCert)
+ if err != nil {
+ logger.Error("maintaining newly-loaded certificate",
+ zap.String("server_name", name),
+ zap.Error(err))
+ }
+ return loadedCert, nil
+}
+
// optionalMaintenance will perform maintenance on the certificate (if necessary) and
// will return the resulting certificate. This should only be done if the certificate
// is managed, OnDemand is enabled, and the scope is allowed to obtain certificates.
@@ -363,19 +434,23 @@ func (cfg *Config) optionalMaintenance(ctx context.Context, log *zap.Logger, cer
// checkIfCertShouldBeObtained checks to see if an on-demand TLS certificate
// should be obtained for a given domain based upon the config settings. If
// a non-nil error is returned, do not issue a new certificate for name.
-func (cfg *Config) checkIfCertShouldBeObtained(name string) error {
- if cfg.OnDemand == nil {
+func (cfg *Config) checkIfCertShouldBeObtained(name string, requireOnDemand bool) error {
+ if requireOnDemand && cfg.OnDemand == nil {
return fmt.Errorf("not configured for on-demand certificate issuance")
}
if !SubjectQualifiesForCert(name) {
return fmt.Errorf("subject name does not qualify for certificate: %s", name)
}
- if cfg.OnDemand.DecisionFunc != nil {
- return cfg.OnDemand.DecisionFunc(name)
- }
- if len(cfg.OnDemand.hostWhitelist) > 0 &&
- !cfg.OnDemand.whitelistContains(name) {
- return fmt.Errorf("certificate for '%s' is not managed", name)
+ if cfg.OnDemand != nil {
+ if cfg.OnDemand.DecisionFunc != nil {
+ if err := cfg.OnDemand.DecisionFunc(name); err != nil {
+ return fmt.Errorf("decision func: %w", err)
+ }
+ return nil
+ }
+ if len(cfg.OnDemand.hostAllowlist) > 0 && !cfg.OnDemand.allowlistContains(name) {
+ return fmt.Errorf("certificate for '%s' is not managed", name)
+ }
}
return nil
}
@@ -390,11 +465,6 @@ func (cfg *Config) obtainOnDemandCertificate(ctx context.Context, hello *tls.Cli
name := cfg.getNameFromClientHello(hello)
- getCertWithoutReobtaining := func() (Certificate, error) {
- // very important to set the obtainIfNecessary argument to false, so we don't repeat this infinitely
- return cfg.getCertDuringHandshake(ctx, hello, true, false)
- }
-
// We must protect this process from happening concurrently, so synchronize.
obtainCertWaitChansMu.Lock()
wait, ok := obtainCertWaitChans[name]
@@ -412,7 +482,7 @@ func (cfg *Config) obtainOnDemandCertificate(ctx context.Context, hello *tls.Cli
timeout.Stop()
}
- return getCertWithoutReobtaining()
+ return cfg.loadCertFromStorage(ctx, log, hello)
}
// looks like it's up to us to do all the work and obtain the cert.
@@ -428,13 +498,6 @@ func (cfg *Config) obtainOnDemandCertificate(ctx context.Context, hello *tls.Cli
obtainCertWaitChansMu.Unlock()
}
- // Make sure the certificate should be obtained based on config
- err := cfg.checkIfCertShouldBeObtained(name)
- if err != nil {
- unblockWaiters()
- return Certificate{}, err
- }
-
log.Info("obtaining new certificate", zap.String("server_name", name))
// TODO: we are only adding a timeout because we don't know if the context passed in is actually cancelable...
@@ -444,7 +507,7 @@ func (cfg *Config) obtainOnDemandCertificate(ctx context.Context, hello *tls.Cli
defer cancel()
// Obtain the certificate
- err = cfg.ObtainCertAsync(ctx, name)
+ err := cfg.ObtainCertAsync(ctx, name)
// immediately unblock anyone waiting for it; doing this in
// a defer would risk deadlock because of the recursive call
@@ -458,7 +521,7 @@ func (cfg *Config) obtainOnDemandCertificate(ctx context.Context, hello *tls.Cli
// success; certificate was just placed on disk, so
// we need only restart serving the certificate
- return getCertWithoutReobtaining()
+ return cfg.loadCertFromStorage(ctx, log, hello)
}
// handshakeMaintenance performs a check on cert for expiration and OCSP validity.
@@ -512,6 +575,16 @@ func (cfg *Config) handshakeMaintenance(ctx context.Context, hello *tls.ClientHe
// Check cert expiration
if currentlyInRenewalWindow(cert.Leaf.NotBefore, expiresAt(cert.Leaf), cfg.RenewalWindowRatio) {
+ // Check if the certificate still exists on disk. If not, we need to obtain a new one.
+ // This can happen if the certificate was cleaned up by the storage cleaner, but still
+ // remains in the in-memory cache.
+ if !cfg.storageHasCertResourcesAnyIssuer(ctx, cert.Names[0]) {
+ log.Debug("certificate not found on disk; obtaining new certificate",
+ zap.Strings("identifiers", cert.Names))
+
+ return cfg.obtainOnDemandCertificate(ctx, hello)
+ }
+ // Otherwise, renew the certificate.
return cfg.renewDynamicCertificate(ctx, hello, cert)
}
@@ -536,11 +609,6 @@ func (cfg *Config) renewDynamicCertificate(ctx context.Context, hello *tls.Clien
timeLeft := time.Until(expiresAt(currentCert.Leaf))
revoked := currentCert.ocsp != nil && currentCert.ocsp.Status == ocsp.Revoked
- getCertWithoutReobtaining := func() (Certificate, error) {
- // very important to set the obtainIfNecessary argument to false, so we don't repeat this infinitely
- return cfg.getCertDuringHandshake(ctx, hello, true, false)
- }
-
// see if another goroutine is already working on this certificate
obtainCertWaitChansMu.Lock()
wait, ok := obtainCertWaitChans[name]
@@ -575,7 +643,7 @@ func (cfg *Config) renewDynamicCertificate(ctx context.Context, hello *tls.Clien
timeout.Stop()
}
- return getCertWithoutReobtaining()
+ return cfg.loadCertFromStorage(ctx, log, hello)
}
// looks like it's up to us to do all the work and renew the cert
@@ -602,10 +670,8 @@ func (cfg *Config) renewDynamicCertificate(ctx context.Context, hello *tls.Clien
renewAndReload := func(ctx context.Context, cancel context.CancelFunc) (Certificate, error) {
defer cancel()
- log.Info("attempting certificate renewal")
-
- // Make sure a certificate for this name should be obtained on-demand
- err := cfg.checkIfCertShouldBeObtained(name)
+ // Make sure a certificate for this name should be renewed on-demand
+ err := cfg.checkIfCertShouldBeObtained(name, true)
if err != nil {
// if not, remove from cache (it will be deleted from storage later)
cfg.certCache.mu.Lock()
@@ -620,6 +686,8 @@ func (cfg *Config) renewDynamicCertificate(ctx context.Context, hello *tls.Clien
return Certificate{}, err
}
+ log.Info("attempting certificate renewal")
+
// otherwise, renew with issuer, etc.
var newCert Certificate
if revoked {
@@ -650,7 +718,7 @@ func (cfg *Config) renewDynamicCertificate(ctx context.Context, hello *tls.Clien
return newCert, err
}
- return getCertWithoutReobtaining()
+ return cfg.loadCertFromStorage(ctx, log, hello)
}
// if the certificate hasn't expired, we can serve what we have and renew in the background
@@ -668,20 +736,20 @@ func (cfg *Config) renewDynamicCertificate(ctx context.Context, hello *tls.Clien
// getCertFromAnyCertManager gets a certificate from cfg's Managers. If there are no Managers defined, this is
// a no-op that returns empty values. Otherwise, it gets a certificate for hello from the first Manager that
// returns a certificate and no error.
-func (cfg *Config) getCertFromAnyCertManager(ctx context.Context, hello *tls.ClientHelloInfo, log *zap.Logger) (Certificate, error) {
+func (cfg *Config) getCertFromAnyCertManager(ctx context.Context, hello *tls.ClientHelloInfo, logger *zap.Logger) (Certificate, error) {
// fast path if nothing to do
- if len(cfg.Managers) == 0 {
+ if cfg.OnDemand == nil || len(cfg.OnDemand.Managers) == 0 {
return Certificate{}, nil
}
var upstreamCert *tls.Certificate
// try all the GetCertificate methods on external managers; use first one that returns a certificate
- for i, certManager := range cfg.Managers {
+ for i, certManager := range cfg.OnDemand.Managers {
var err error
upstreamCert, err = certManager.GetCertificate(ctx, hello)
if err != nil {
- log.Error("getting certificate from external certificate manager",
+ logger.Error("getting certificate from external certificate manager",
zap.String("sni", hello.ServerName),
zap.Int("cert_manager", i),
zap.Error(err))
@@ -692,7 +760,7 @@ func (cfg *Config) getCertFromAnyCertManager(ctx context.Context, hello *tls.Cli
}
}
if upstreamCert == nil {
- log.Debug("all external certificate managers yielded no certificates and no errors", zap.String("sni", hello.ServerName))
+ logger.Debug("all external certificate managers yielded no certificates and no errors", zap.String("sni", hello.ServerName))
return Certificate{}, nil
}
@@ -702,7 +770,7 @@ func (cfg *Config) getCertFromAnyCertManager(ctx context.Context, hello *tls.Cli
return Certificate{}, fmt.Errorf("external certificate manager: %s: filling cert from leaf: %v", hello.ServerName, err)
}
- log.Debug("using externally-managed certificate",
+ logger.Debug("using externally-managed certificate",
zap.String("sni", hello.ServerName),
zap.Strings("names", cert.Names),
zap.Time("expiration", expiresAt(cert.Leaf)))
@@ -792,5 +860,11 @@ func normalizedName(serverName string) string {
}
// obtainCertWaitChans is used to coordinate obtaining certs for each hostname.
-var obtainCertWaitChans = make(map[string]chan struct{})
-var obtainCertWaitChansMu sync.Mutex
+var (
+ obtainCertWaitChans = make(map[string]chan struct{})
+ obtainCertWaitChansMu sync.Mutex
+)
+var (
+ certLoadWaitChans = make(map[string]chan struct{})
+ certLoadWaitChansMu sync.Mutex
+)
diff --git a/vendor/github.com/caddyserver/certmagic/httphandler.go b/vendor/github.com/caddyserver/certmagic/httphandler.go
index 0736c344..fc2a8804 100644
--- a/vendor/github.com/caddyserver/certmagic/httphandler.go
+++ b/vendor/github.com/caddyserver/certmagic/httphandler.go
@@ -75,6 +75,8 @@ func (am *ACMEIssuer) distributedHTTPChallengeSolver(w http.ResponseWriter, r *h
if err != nil {
am.Logger.Error("looking up info for HTTP challenge",
zap.String("host", host),
+ zap.String("remote_addr", r.RemoteAddr),
+ zap.String("user_agent", r.Header.Get("User-Agent")),
zap.Error(err))
return false
}
diff --git a/vendor/github.com/caddyserver/certmagic/ratelimiter.go b/vendor/github.com/caddyserver/certmagic/ratelimiter.go
index 6a3b7b18..eda98b61 100644
--- a/vendor/github.com/caddyserver/certmagic/ratelimiter.go
+++ b/vendor/github.com/caddyserver/certmagic/ratelimiter.go
@@ -33,7 +33,7 @@ func NewRateLimiter(maxEvents int, window time.Duration) *RingBufferRateLimiter
panic("maxEvents cannot be less than zero")
}
if maxEvents == 0 && window != 0 {
- panic("invalid configuration: maxEvents = 0 and window != 0 would not allow any events")
+ panic("NewRateLimiter: invalid configuration: maxEvents = 0 and window != 0 would not allow any events")
}
rbrl := &RingBufferRateLimiter{
window: window,
@@ -144,14 +144,15 @@ func (r *RingBufferRateLimiter) MaxEvents() int {
// the oldest events will be forgotten. If the new limit is
// higher, the window will suddenly have capacity for new
// reservations. It panics if maxEvents is 0 and window size
-// is not zero.
+// is not zero; if setting both the events limit and the
+// window size to 0, call SetWindow() first.
func (r *RingBufferRateLimiter) SetMaxEvents(maxEvents int) {
newRing := make([]time.Time, maxEvents)
r.mu.Lock()
defer r.mu.Unlock()
if r.window != 0 && maxEvents == 0 {
- panic("invalid configuration: maxEvents = 0 and window != 0 would not allow any events")
+ panic("SetMaxEvents: invalid configuration: maxEvents = 0 and window != 0 would not allow any events")
}
// only make the change if the new limit is different
@@ -203,7 +204,7 @@ func (r *RingBufferRateLimiter) SetWindow(window time.Duration) {
r.mu.Lock()
defer r.mu.Unlock()
if window != 0 && len(r.ring) == 0 {
- panic("invalid configuration: maxEvents = 0 and window != 0 would not allow any events")
+ panic("SetWindow: invalid configuration: maxEvents = 0 and window != 0 would not allow any events")
}
r.window = window
}
diff --git a/vendor/github.com/casbin/casbin/v2/CONTRIBUTING.md b/vendor/github.com/casbin/casbin/v2/CONTRIBUTING.md
index c5f0ddb5..702b2d92 100644
--- a/vendor/github.com/casbin/casbin/v2/CONTRIBUTING.md
+++ b/vendor/github.com/casbin/casbin/v2/CONTRIBUTING.md
@@ -12,7 +12,7 @@ This project adheres to the [Contributor Covenant 1.2.](https://www.contributor-
## Reporting issues
-Reporting issues are a great way to contribute to the project. We are perpetually grateful about a well-written, thorough bug report.
+Reporting issues are a great way to contribute to the project. We are perpetually grateful about a well-written, through bug report.
Before raising a new issue, check our [issue list](https://github.com/casbin/casbin/issues) to determine if it already contains the problem that you are facing.
diff --git a/vendor/github.com/casbin/casbin/v2/rbac/default-role-manager/role_manager.go b/vendor/github.com/casbin/casbin/v2/rbac/default-role-manager/role_manager.go
index 9a42781c..a0f01048 100644
--- a/vendor/github.com/casbin/casbin/v2/rbac/default-role-manager/role_manager.go
+++ b/vendor/github.com/casbin/casbin/v2/rbac/default-role-manager/role_manager.go
@@ -56,12 +56,12 @@ func (r *Role) removeRole(role *Role) {
role.removeUser(r)
}
-//should only be called inside addRole
+// should only be called inside addRole
func (r *Role) addUser(user *Role) {
r.users.Store(user.name, user)
}
-//should only be called inside removeRole
+// should only be called inside removeRole
func (r *Role) removeUser(user *Role) {
r.users.Delete(user.name)
}
@@ -201,18 +201,14 @@ func (rm *RoleManagerImpl) rebuild() {
}
func (rm *RoleManagerImpl) Match(str string, pattern string) bool {
- cacheKey := strings.Join([]string{str, pattern}, "$$")
- if v, has := rm.matchingFuncCache.Get(cacheKey); has {
- return v.(bool)
+ if str == pattern {
+ return true
+ }
+
+ if rm.matchingFunc != nil {
+ return rm.matchingFunc(str, pattern)
} else {
- var matched bool
- if rm.matchingFunc != nil {
- matched = rm.matchingFunc(str, pattern)
- } else {
- matched = str == pattern
- }
- rm.matchingFuncCache.Put(cacheKey, matched)
- return matched
+ return false
}
}
@@ -493,7 +489,7 @@ func (dm *DomainManager) rebuild() {
})
}
-//Clear clears all stored data and resets the role manager to the initial state.
+// Clear clears all stored data and resets the role manager to the initial state.
func (dm *DomainManager) Clear() error {
dm.rmMap = &sync.Map{}
dm.matchingFuncCache = util.NewSyncLRUCache(100)
@@ -512,18 +508,14 @@ func (dm *DomainManager) getDomain(domains ...string) (domain string, err error)
}
func (dm *DomainManager) Match(str string, pattern string) bool {
- cacheKey := strings.Join([]string{str, pattern}, "$$")
- if v, has := dm.matchingFuncCache.Get(cacheKey); has {
- return v.(bool)
+ if str == pattern {
+ return true
+ }
+
+ if dm.domainMatchingFunc != nil {
+ return dm.domainMatchingFunc(str, pattern)
} else {
- var matched bool
- if dm.domainMatchingFunc != nil {
- matched = dm.domainMatchingFunc(str, pattern)
- } else {
- matched = str == pattern
- }
- dm.matchingFuncCache.Put(cacheKey, matched)
- return matched
+ return false
}
}
diff --git a/vendor/github.com/datarhei/gosrt/README.md b/vendor/github.com/datarhei/gosrt/README.md
index f18a4e51..2c39d900 100644
--- a/vendor/github.com/datarhei/gosrt/README.md
+++ b/vendor/github.com/datarhei/gosrt/README.md
@@ -42,7 +42,7 @@ The parts that are implemented are based on what has been published in the SRT R
## Requirements
-A Go version of 1.16+ is required.
+A Go version of 1.18+ is required.
## Installation
diff --git a/vendor/github.com/datarhei/gosrt/config.go b/vendor/github.com/datarhei/gosrt/config.go
index 21a7a991..9ceb6eb2 100644
--- a/vendor/github.com/datarhei/gosrt/config.go
+++ b/vendor/github.com/datarhei/gosrt/config.go
@@ -218,17 +218,17 @@ func DefaultConfig() Config {
// UnmarshalURL takes a SRT URL and parses out the configuration. A SRT URL is
// srt://[host]:[port]?[key1]=[value1]&[key2]=[value2]...
-func (c *Config) UnmarshalURL(addr string) (string, error) {
+func (c *Config) UnmarshalURL(addr string) (string, string, error) {
u, err := url.Parse(addr)
if err != nil {
- return "", err
+ return "", "", err
}
if u.Scheme != "srt" {
- return "", fmt.Errorf("the URL doesn't seem to be an srt:// URL")
+ return "", "", fmt.Errorf("the URL doesn't seem to be an srt:// URL")
}
- return u.Host, c.UnmarshalQuery(u.RawQuery)
+ return u.Hostname(), u.Port(), c.UnmarshalQuery(u.RawQuery)
}
// UnmarshalQuery parses a query string and interprets it as a configuration
diff --git a/vendor/github.com/datarhei/gosrt/connection.go b/vendor/github.com/datarhei/gosrt/connection.go
index 10b47a29..1c9a517e 100644
--- a/vendor/github.com/datarhei/gosrt/connection.go
+++ b/vendor/github.com/datarhei/gosrt/connection.go
@@ -633,69 +633,71 @@ func (c *srtConn) handlePacket(p packet.Packet) {
c.handleKMResponse(p)
}
}
+
+ return
+ }
+
+ if header.PacketSequenceNumber.Gt(c.debug.expectedRcvPacketSequenceNumber) {
+ c.log("connection:error", func() string {
+ return fmt.Sprintf("recv lost packets. got: %d, expected: %d (%d)\n", header.PacketSequenceNumber.Val(), c.debug.expectedRcvPacketSequenceNumber.Val(), c.debug.expectedRcvPacketSequenceNumber.Distance(header.PacketSequenceNumber))
+ })
+ }
+
+ c.debug.expectedRcvPacketSequenceNumber = header.PacketSequenceNumber.Inc()
+
+ //fmt.Printf("%s\n", p.String())
+
+ // Ignore FEC filter control packets
+ // https://github.com/Haivision/srt/blob/master/docs/features/packet-filtering-and-fec.md
+ // "An FEC control packet is distinguished from a regular data packet by having
+ // its message number equal to 0. This value isn't normally used in SRT (message
+ // numbers start from 1, increment to a maximum, and then roll back to 1)."
+ if header.MessageNumber == 0 {
+ c.log("connection:filter", func() string { return "dropped FEC filter control packet" })
+ return
+ }
+
+ // 4.5.1.1. TSBPD Time Base Calculation
+ if !c.tsbpdWrapPeriod {
+ if header.Timestamp > packet.MAX_TIMESTAMP-(30*1000000) {
+ c.tsbpdWrapPeriod = true
+ c.log("connection:tsbpd", func() string { return "TSBPD wrapping period started" })
+ }
} else {
- if header.PacketSequenceNumber.Gt(c.debug.expectedRcvPacketSequenceNumber) {
- c.log("connection:error", func() string {
- return fmt.Sprintf("recv lost packets. got: %d, expected: %d (%d)\n", header.PacketSequenceNumber.Val(), c.debug.expectedRcvPacketSequenceNumber.Val(), c.debug.expectedRcvPacketSequenceNumber.Distance(header.PacketSequenceNumber))
- })
+ if header.Timestamp >= (30*1000000) && header.Timestamp <= (60*1000000) {
+ c.tsbpdWrapPeriod = false
+ c.tsbpdTimeBaseOffset += uint64(packet.MAX_TIMESTAMP) + 1
+ c.log("connection:tsbpd", func() string { return "TSBPD wrapping period finished" })
}
+ }
- c.debug.expectedRcvPacketSequenceNumber = header.PacketSequenceNumber.Inc()
-
- //fmt.Printf("%s\n", p.String())
-
- // Ignore FEC filter control packets
- // https://github.com/Haivision/srt/blob/master/docs/features/packet-filtering-and-fec.md
- // "An FEC control packet is distinguished from a regular data packet by having
- // its message number equal to 0. This value isn't normally used in SRT (message
- // numbers start from 1, increment to a maximum, and then roll back to 1)."
- if header.MessageNumber == 0 {
- c.log("connection:filter", func() string { return "dropped FEC filter control packet" })
- return
+ tsbpdTimeBaseOffset := c.tsbpdTimeBaseOffset
+ if c.tsbpdWrapPeriod {
+ if header.Timestamp < (30 * 1000000) {
+ tsbpdTimeBaseOffset += uint64(packet.MAX_TIMESTAMP) + 1
}
+ }
- // 4.5.1.1. TSBPD Time Base Calculation
- if !c.tsbpdWrapPeriod {
- if header.Timestamp > packet.MAX_TIMESTAMP-(30*1000000) {
- c.tsbpdWrapPeriod = true
- c.log("connection:tsbpd", func() string { return "TSBPD wrapping period started" })
- }
- } else {
- if header.Timestamp >= (30*1000000) && header.Timestamp <= (60*1000000) {
- c.tsbpdWrapPeriod = false
- c.tsbpdTimeBaseOffset += uint64(packet.MAX_TIMESTAMP) + 1
- c.log("connection:tsbpd", func() string { return "TSBPD wrapping period finished" })
- }
- }
+ header.PktTsbpdTime = c.tsbpdTimeBase + tsbpdTimeBaseOffset + uint64(header.Timestamp) + c.tsbpdDelay + c.tsbpdDrift
- tsbpdTimeBaseOffset := c.tsbpdTimeBaseOffset
- if c.tsbpdWrapPeriod {
- if header.Timestamp < (30 * 1000000) {
- tsbpdTimeBaseOffset += uint64(packet.MAX_TIMESTAMP) + 1
- }
- }
+ c.log("data:recv:dump", func() string { return p.Dump() })
- header.PktTsbpdTime = c.tsbpdTimeBase + tsbpdTimeBaseOffset + uint64(header.Timestamp) + c.tsbpdDelay + c.tsbpdDrift
-
- c.log("data:recv:dump", func() string { return p.Dump() })
-
- c.cryptoLock.Lock()
- if c.crypto != nil {
- if header.KeyBaseEncryptionFlag != 0 {
- if err := c.crypto.EncryptOrDecryptPayload(p.Data(), header.KeyBaseEncryptionFlag, header.PacketSequenceNumber.Val()); err != nil {
- c.statistics.pktRecvUndecrypt++
- c.statistics.byteRecvUndecrypt += p.Len()
- }
- } else {
+ c.cryptoLock.Lock()
+ if c.crypto != nil {
+ if header.KeyBaseEncryptionFlag != 0 {
+ if err := c.crypto.EncryptOrDecryptPayload(p.Data(), header.KeyBaseEncryptionFlag, header.PacketSequenceNumber.Val()); err != nil {
c.statistics.pktRecvUndecrypt++
c.statistics.byteRecvUndecrypt += p.Len()
}
+ } else {
+ c.statistics.pktRecvUndecrypt++
+ c.statistics.byteRecvUndecrypt += p.Len()
}
- c.cryptoLock.Unlock()
-
- // Put the packet into receive congestion control
- c.recv.Push(p)
}
+ c.cryptoLock.Unlock()
+
+ // Put the packet into receive congestion control
+ c.recv.Push(p)
}
// handleKeepAlive resets the idle timeout and sends a keepalive to the peer.
diff --git a/vendor/github.com/datarhei/gosrt/internal/congestion/live.go b/vendor/github.com/datarhei/gosrt/internal/congestion/live.go
index 68c0e0fb..0f1ff5fa 100644
--- a/vendor/github.com/datarhei/gosrt/internal/congestion/live.go
+++ b/vendor/github.com/datarhei/gosrt/internal/congestion/live.go
@@ -115,7 +115,7 @@ func (s *liveSend) Push(p packet.Packet) {
return
}
- // give to the packet a sequence number
+ // Give to the packet a sequence number
p.Header().PacketSequenceNumber = s.nextSequenceNumber
p.Header().PacketPositionFlag = packet.SinglePacket
p.Header().OrderFlag = false
@@ -128,7 +128,7 @@ func (s *liveSend) Push(p packet.Packet) {
s.statistics.PktBuf++
s.statistics.ByteBuf += pktLen
- // input bandwidth calculation
+ // Input bandwidth calculation
s.rate.bytes += pktLen
p.Header().Timestamp = uint32(p.Header().PktTsbpdTime & uint64(packet.MAX_TIMESTAMP))
@@ -152,7 +152,7 @@ func (s *liveSend) Push(p packet.Packet) {
}
func (s *liveSend) Tick(now uint64) {
- // deliver packets whose PktTsbpdTime is ripe
+ // Deliver packets whose PktTsbpdTime is ripe
s.lock.Lock()
removeList := make([]*list.Element, 0, s.packetList.Len())
for e := s.packetList.Front(); e != nil; e = e.Next() {
@@ -192,7 +192,7 @@ func (s *liveSend) Tick(now uint64) {
p := e.Value.(packet.Packet)
if p.Header().PktTsbpdTime+s.dropThreshold <= now {
- // dropped packet because too old
+ // Dropped packet because too old
s.statistics.PktDrop++
s.statistics.PktLoss++
s.statistics.ByteDrop += p.Len()
@@ -245,7 +245,7 @@ func (s *liveSend) ACK(sequenceNumber circular.Number) {
for e := s.lossList.Front(); e != nil; e = e.Next() {
p := e.Value.(packet.Packet)
if p.Header().PacketSequenceNumber.Lt(sequenceNumber) {
- // remove packet from buffer because it has been successfully transmitted
+ // Remove packet from buffer because it has been successfully transmitted
removeList = append(removeList, e)
} else {
break
@@ -470,7 +470,7 @@ func (r *liveReceive) Push(pkt packet.Packet) {
r.avgPayloadSize = 0.875*r.avgPayloadSize + 0.125*float64(pktLen)
if pkt.Header().PacketSequenceNumber.Lte(r.lastDeliveredSequenceNumber) {
- // too old, because up until r.lastDeliveredSequenceNumber, we already delivered
+ // Too old, because up until r.lastDeliveredSequenceNumber, we already delivered
r.statistics.PktBelated++
r.statistics.ByteBelated += pktLen
@@ -481,7 +481,7 @@ func (r *liveReceive) Push(pkt packet.Packet) {
}
if pkt.Header().PacketSequenceNumber.Lt(r.lastACKSequenceNumber) {
- // already acknowledged, ignoring
+ // Already acknowledged, ignoring
r.statistics.PktDrop++
r.statistics.ByteDrop += pktLen
@@ -489,21 +489,21 @@ func (r *liveReceive) Push(pkt packet.Packet) {
}
if pkt.Header().PacketSequenceNumber.Equals(r.maxSeenSequenceNumber.Inc()) {
- // in order, the packet we expected
+ // In order, the packet we expected
r.maxSeenSequenceNumber = pkt.Header().PacketSequenceNumber
} else if pkt.Header().PacketSequenceNumber.Lte(r.maxSeenSequenceNumber) {
- // out of order, is it a missing piece? put it in the correct position
+ // Out of order, is it a missing piece? put it in the correct position
for e := r.packetList.Front(); e != nil; e = e.Next() {
p := e.Value.(packet.Packet)
if p.Header().PacketSequenceNumber == pkt.Header().PacketSequenceNumber {
- // already received (has been sent more than once), ignoring
+ // Already received (has been sent more than once), ignoring
r.statistics.PktDrop++
r.statistics.ByteDrop += pktLen
break
} else if p.Header().PacketSequenceNumber.Gt(pkt.Header().PacketSequenceNumber) {
- // late arrival, this fills a gap
+ // Late arrival, this fills a gap
r.statistics.PktBuf++
r.statistics.PktUnique++
@@ -518,7 +518,7 @@ func (r *liveReceive) Push(pkt packet.Packet) {
return
} else {
- // too far ahead, there are some missing sequence numbers, immediate NAK report
+ // Too far ahead, there are some missing sequence numbers, immediate NAK report
// here we can prevent a possibly unnecessary NAK with SRTO_LOXXMAXTTL
r.sendNAK(r.maxSeenSequenceNumber.Inc(), pkt.Header().PacketSequenceNumber.Dec())
@@ -545,7 +545,7 @@ func (r *liveReceive) periodicACK(now uint64) (ok bool, sequenceNumber circular.
// 4.8.1. Packet Acknowledgement (ACKs, ACKACKs)
if now-r.lastPeriodicACK < r.periodicACKInterval {
if r.nPackets >= 64 {
- lite = true // send light ACK
+ lite = true // Send light ACK
} else {
return
}
@@ -555,8 +555,9 @@ func (r *liveReceive) periodicACK(now uint64) (ok bool, sequenceNumber circular.
ackSequenceNumber := r.lastDeliveredSequenceNumber
- // find the sequence number up until we have all in a row.
- // where the first gap is (or at the end of the list) is where we can ACK to.
+ // Find the sequence number up until we have all in a row.
+ // Where the first gap is (or at the end of the list) is where we can ACK to.
+
e := r.packetList.Front()
if e != nil {
p := e.Value.(packet.Packet)
@@ -564,6 +565,25 @@ func (r *liveReceive) periodicACK(now uint64) (ok bool, sequenceNumber circular.
minPktTsbpdTime = p.Header().PktTsbpdTime
maxPktTsbpdTime = p.Header().PktTsbpdTime
+ // If there are packets that should be delivered by now, move foward.
+ if p.Header().PktTsbpdTime <= now {
+ for e = e.Next(); e != nil; e = e.Next() {
+ p = e.Value.(packet.Packet)
+
+ if p.Header().PktTsbpdTime > now {
+ break
+ }
+ }
+
+ ackSequenceNumber = p.Header().PacketSequenceNumber
+ maxPktTsbpdTime = p.Header().PktTsbpdTime
+
+ if e != nil {
+ e = e.Next()
+ p = e.Value.(packet.Packet)
+ }
+ }
+
if p.Header().PacketSequenceNumber.Equals(ackSequenceNumber.Inc()) {
ackSequenceNumber = p.Header().PacketSequenceNumber
@@ -581,7 +601,7 @@ func (r *liveReceive) periodicACK(now uint64) (ok bool, sequenceNumber circular.
ok = true
sequenceNumber = ackSequenceNumber.Inc()
- // keep track of the last ACK's sequence. with this we can faster ignore
+ // Keep track of the last ACK's sequence. with this we can faster ignore
// packets that come in that have a lower sequence number.
r.lastACKSequenceNumber = ackSequenceNumber
}
@@ -602,12 +622,12 @@ func (r *liveReceive) periodicNAK(now uint64) (ok bool, from, to circular.Number
return
}
- // send a periodic NAK
+ // Send a periodic NAK
ackSequenceNumber := r.lastDeliveredSequenceNumber
- // send a NAK only for the first gap.
- // alternatively send a NAK for max. X gaps because the size of the NAK packet is limited
+ // Send a NAK only for the first gap.
+ // Alternatively send a NAK for max. X gaps because the size of the NAK packet is limited.
for e := r.packetList.Front(); e != nil; e = e.Next() {
p := e.Value.(packet.Packet)
@@ -638,7 +658,7 @@ func (r *liveReceive) Tick(now uint64) {
r.sendNAK(from, to)
}
- // deliver packets whose PktTsbpdTime is ripe
+ // Deliver packets whose PktTsbpdTime is ripe
r.lock.Lock()
removeList := make([]*list.Element, 0, r.packetList.Len())
for e := r.packetList.Front(); e != nil; e = e.Next() {
@@ -819,12 +839,12 @@ func (r *fakeLiveReceive) Push(pkt packet.Packet) {
r.avgPayloadSize = 0.875*r.avgPayloadSize + 0.125*float64(pktLen)
if pkt.Header().PacketSequenceNumber.Lte(r.lastDeliveredSequenceNumber) {
- // too old, because up until r.lastDeliveredSequenceNumber, we already delivered
+ // Too old, because up until r.lastDeliveredSequenceNumber, we already delivered
return
}
if pkt.Header().PacketSequenceNumber.Lt(r.lastACKSequenceNumber) {
- // already acknowledged, ignoring
+ // Already acknowledged, ignoring
return
}
@@ -842,7 +862,7 @@ func (r *fakeLiveReceive) periodicACK(now uint64) (ok bool, sequenceNumber circu
// 4.8.1. Packet Acknowledgement (ACKs, ACKACKs)
if now-r.lastPeriodicACK < r.periodicACKInterval {
if r.nPackets >= 64 {
- lite = true // send light ACK
+ lite = true // Send light ACK
} else {
return
}
@@ -864,7 +884,7 @@ func (r *fakeLiveReceive) Tick(now uint64) {
r.sendACK(sequenceNumber, lite)
}
- // deliver packets whose PktTsbpdTime is ripe
+ // Deliver packets whose PktTsbpdTime is ripe
r.lock.Lock()
defer r.lock.Unlock()
diff --git a/vendor/github.com/go-openapi/swag/util.go b/vendor/github.com/go-openapi/swag/util.go
index f78ab684..d971fbe3 100644
--- a/vendor/github.com/go-openapi/swag/util.go
+++ b/vendor/github.com/go-openapi/swag/util.go
@@ -341,12 +341,21 @@ type zeroable interface {
// IsZero returns true when the value passed into the function is a zero value.
// This allows for safer checking of interface values.
func IsZero(data interface{}) bool {
+ v := reflect.ValueOf(data)
+ // check for nil data
+ switch v.Kind() {
+ case reflect.Interface, reflect.Map, reflect.Ptr, reflect.Slice:
+ if v.IsNil() {
+ return true
+ }
+ }
+
// check for things that have an IsZero method instead
if vv, ok := data.(zeroable); ok {
return vv.IsZero()
}
+
// continue with slightly more complex reflection
- v := reflect.ValueOf(data)
switch v.Kind() {
case reflect.String:
return v.Len() == 0
@@ -358,14 +367,13 @@ func IsZero(data interface{}) bool {
return v.Uint() == 0
case reflect.Float32, reflect.Float64:
return v.Float() == 0
- case reflect.Interface, reflect.Map, reflect.Ptr, reflect.Slice:
- return v.IsNil()
case reflect.Struct, reflect.Array:
return reflect.DeepEqual(data, reflect.Zero(v.Type()).Interface())
case reflect.Invalid:
return true
+ default:
+ return false
}
- return false
}
// AddInitialisms add additional initialisms
diff --git a/vendor/github.com/go-playground/validator/v10/README.md b/vendor/github.com/go-playground/validator/v10/README.md
index 931b3414..520661db 100644
--- a/vendor/github.com/go-playground/validator/v10/README.md
+++ b/vendor/github.com/go-playground/validator/v10/README.md
@@ -1,7 +1,7 @@
Package validator
=================
<img align="right" src="https://raw.githubusercontent.com/go-playground/validator/v10/logo.png">[](https://gitter.im/go-playground/validator?utm_source=badge&utm_medium=badge&utm_campaign=pr-badge&utm_content=badge)
-
+
[](https://travis-ci.org/go-playground/validator)
[](https://coveralls.io/github/go-playground/validator?branch=master)
[](https://goreportcard.com/report/github.com/go-playground/validator)
diff --git a/vendor/github.com/go-playground/validator/v10/baked_in.go b/vendor/github.com/go-playground/validator/v10/baked_in.go
index 8e6b169c..e676f1d1 100644
--- a/vendor/github.com/go-playground/validator/v10/baked_in.go
+++ b/vendor/github.com/go-playground/validator/v10/baked_in.go
@@ -1414,25 +1414,21 @@ func isURL(fl FieldLevel) bool {
switch field.Kind() {
case reflect.String:
- var i int
s := field.String()
- // checks needed as of Go 1.6 because of change https://github.com/golang/go/commit/617c93ce740c3c3cc28cdd1a0d712be183d0b328#diff-6c2d018290e298803c0c9419d8739885L195
- // emulate browser and strip the '#' suffix prior to validation. see issue-#237
- if i = strings.Index(s, "#"); i > -1 {
- s = s[:i]
- }
-
if len(s) == 0 {
return false
}
- url, err := url.ParseRequestURI(s)
-
+ url, err := url.Parse(s)
if err != nil || url.Scheme == "" {
return false
}
+ if url.Host == "" && url.Fragment == "" && url.Opaque == "" {
+ return false
+ }
+
return true
}
@@ -1450,7 +1446,13 @@ func isHttpURL(fl FieldLevel) bool {
case reflect.String:
s := strings.ToLower(field.String())
- return strings.HasPrefix(s, "http://") || strings.HasPrefix(s, "https://")
+
+ url, err := url.Parse(s)
+ if err != nil || url.Host == "" {
+ return false
+ }
+
+ return url.Scheme == "http" || url.Scheme == "https"
}
panic(fmt.Sprintf("Bad field type %T", field.Interface()))
@@ -2568,9 +2570,17 @@ func isDirPath(fl FieldLevel) bool {
func isJSON(fl FieldLevel) bool {
field := fl.Field()
- if field.Kind() == reflect.String {
+ switch field.Kind() {
+ case reflect.String:
val := field.String()
return json.Valid([]byte(val))
+ case reflect.Slice:
+ fieldType := field.Type()
+
+ if fieldType.ConvertibleTo(byteSliceType) {
+ b := field.Convert(byteSliceType).Interface().([]byte)
+ return json.Valid(b)
+ }
}
panic(fmt.Sprintf("Bad field type %T", field.Interface()))
diff --git a/vendor/github.com/go-playground/validator/v10/validator_instance.go b/vendor/github.com/go-playground/validator/v10/validator_instance.go
index d2ee8fe3..d9dbf0ce 100644
--- a/vendor/github.com/go-playground/validator/v10/validator_instance.go
+++ b/vendor/github.com/go-playground/validator/v10/validator_instance.go
@@ -53,6 +53,8 @@ var (
timeDurationType = reflect.TypeOf(time.Duration(0))
timeType = reflect.TypeOf(time.Time{})
+ byteSliceType = reflect.TypeOf([]byte{})
+
defaultCField = &cField{namesEqual: true}
)
diff --git a/vendor/github.com/hashicorp/golang-lru/v2/2q.go b/vendor/github.com/hashicorp/golang-lru/v2/2q.go
index 1f0055b7..5e00d9a7 100644
--- a/vendor/github.com/hashicorp/golang-lru/v2/2q.go
+++ b/vendor/github.com/hashicorp/golang-lru/v2/2q.go
@@ -181,6 +181,16 @@ func (c *TwoQueueCache[K, V]) Keys() []K {
return append(k1, k2...)
}
+// Values returns a slice of the values in the cache.
+// The frequently used values are first in the returned slice.
+func (c *TwoQueueCache[K, V]) Values() []V {
+ c.lock.RLock()
+ defer c.lock.RUnlock()
+ v1 := c.frequent.Values()
+ v2 := c.recent.Values()
+ return append(v1, v2...)
+}
+
// Remove removes the provided key from the cache.
func (c *TwoQueueCache[K, V]) Remove(key K) {
c.lock.Lock()
diff --git a/vendor/github.com/hashicorp/golang-lru/v2/README.md b/vendor/github.com/hashicorp/golang-lru/v2/README.md
index 4c08cc46..b60785fc 100644
--- a/vendor/github.com/hashicorp/golang-lru/v2/README.md
+++ b/vendor/github.com/hashicorp/golang-lru/v2/README.md
@@ -15,11 +15,20 @@ Example
Using the LRU is very simple:
```go
-l, _ := New[int, interface{}](128)
-for i := 0; i < 256; i++ {
- l.Add(i, nil)
-}
-if l.Len() != 128 {
- panic(fmt.Sprintf("bad len: %v", l.Len()))
+package main
+
+import (
+ "fmt"
+ "github.com/hashicorp/golang-lru/v2"
+)
+
+func main() {
+ l, _ := lru.New[int, any](128)
+ for i := 0; i < 256; i++ {
+ l.Add(i, nil)
+ }
+ if l.Len() != 128 {
+ panic(fmt.Sprintf("bad len: %v", l.Len()))
+ }
}
```
diff --git a/vendor/github.com/hashicorp/golang-lru/v2/arc.go b/vendor/github.com/hashicorp/golang-lru/v2/arc.go
deleted file mode 100644
index a255aae2..00000000
--- a/vendor/github.com/hashicorp/golang-lru/v2/arc.go
+++ /dev/null
@@ -1,259 +0,0 @@
-// Copyright (c) HashiCorp, Inc.
-// SPDX-License-Identifier: MPL-2.0
-
-package lru
-
-import (
- "sync"
-
- "github.com/hashicorp/golang-lru/v2/simplelru"
-)
-
-// ARCCache is a thread-safe fixed size Adaptive Replacement Cache (ARC).
-// ARC is an enhancement over the standard LRU cache in that tracks both
-// frequency and recency of use. This avoids a burst in access to new
-// entries from evicting the frequently used older entries. It adds some
-// additional tracking overhead to a standard LRU cache, computationally
-// it is roughly 2x the cost, and the extra memory overhead is linear
-// with the size of the cache. ARC has been patented by IBM, but is
-// similar to the TwoQueueCache (2Q) which requires setting parameters.
-type ARCCache[K comparable, V any] struct {
- size int // Size is the total capacity of the cache
- p int // P is the dynamic preference towards T1 or T2
-
- t1 simplelru.LRUCache[K, V] // T1 is the LRU for recently accessed items
- b1 simplelru.LRUCache[K, struct{}] // B1 is the LRU for evictions from t1
-
- t2 simplelru.LRUCache[K, V] // T2 is the LRU for frequently accessed items
- b2 simplelru.LRUCache[K, struct{}] // B2 is the LRU for evictions from t2
-
- lock sync.RWMutex
-}
-
-// NewARC creates an ARC of the given size
-func NewARC[K comparable, V any](size int) (*ARCCache[K, V], error) {
- // Create the sub LRUs
- b1, err := simplelru.NewLRU[K, struct{}](size, nil)
- if err != nil {
- return nil, err
- }
- b2, err := simplelru.NewLRU[K, struct{}](size, nil)
- if err != nil {
- return nil, err
- }
- t1, err := simplelru.NewLRU[K, V](size, nil)
- if err != nil {
- return nil, err
- }
- t2, err := simplelru.NewLRU[K, V](size, nil)
- if err != nil {
- return nil, err
- }
-
- // Initialize the ARC
- c := &ARCCache[K, V]{
- size: size,
- p: 0,
- t1: t1,
- b1: b1,
- t2: t2,
- b2: b2,
- }
- return c, nil
-}
-
-// Get looks up a key's value from the cache.
-func (c *ARCCache[K, V]) Get(key K) (value V, ok bool) {
- c.lock.Lock()
- defer c.lock.Unlock()
-
- // If the value is contained in T1 (recent), then
- // promote it to T2 (frequent)
- if val, ok := c.t1.Peek(key); ok {
- c.t1.Remove(key)
- c.t2.Add(key, val)
- return val, ok
- }
-
- // Check if the value is contained in T2 (frequent)
- if val, ok := c.t2.Get(key); ok {
- return val, ok
- }
-
- // No hit
- return
-}
-
-// Add adds a value to the cache.
-func (c *ARCCache[K, V]) Add(key K, value V) {
- c.lock.Lock()
- defer c.lock.Unlock()
-
- // Check if the value is contained in T1 (recent), and potentially
- // promote it to frequent T2
- if c.t1.Contains(key) {
- c.t1.Remove(key)
- c.t2.Add(key, value)
- return
- }
-
- // Check if the value is already in T2 (frequent) and update it
- if c.t2.Contains(key) {
- c.t2.Add(key, value)
- return
- }
-
- // Check if this value was recently evicted as part of the
- // recently used list
- if c.b1.Contains(key) {
- // T1 set is too small, increase P appropriately
- delta := 1
- b1Len := c.b1.Len()
- b2Len := c.b2.Len()
- if b2Len > b1Len {
- delta = b2Len / b1Len
- }
- if c.p+delta >= c.size {
- c.p = c.size
- } else {
- c.p += delta
- }
-
- // Potentially need to make room in the cache
- if c.t1.Len()+c.t2.Len() >= c.size {
- c.replace(false)
- }
-
- // Remove from B1
- c.b1.Remove(key)
-
- // Add the key to the frequently used list
- c.t2.Add(key, value)
- return
- }
-
- // Check if this value was recently evicted as part of the
- // frequently used list
- if c.b2.Contains(key) {
- // T2 set is too small, decrease P appropriately
- delta := 1
- b1Len := c.b1.Len()
- b2Len := c.b2.Len()
- if b1Len > b2Len {
- delta = b1Len / b2Len
- }
- if delta >= c.p {
- c.p = 0
- } else {
- c.p -= delta
- }
-
- // Potentially need to make room in the cache
- if c.t1.Len()+c.t2.Len() >= c.size {
- c.replace(true)
- }
-
- // Remove from B2
- c.b2.Remove(key)
-
- // Add the key to the frequently used list
- c.t2.Add(key, value)
- return
- }
-
- // Potentially need to make room in the cache
- if c.t1.Len()+c.t2.Len() >= c.size {
- c.replace(false)
- }
-
- // Keep the size of the ghost buffers trim
- if c.b1.Len() > c.size-c.p {
- c.b1.RemoveOldest()
- }
- if c.b2.Len() > c.p {
- c.b2.RemoveOldest()
- }
-
- // Add to the recently seen list
- c.t1.Add(key, value)
-}
-
-// replace is used to adaptively evict from either T1 or T2
-// based on the current learned value of P
-func (c *ARCCache[K, V]) replace(b2ContainsKey bool) {
- t1Len := c.t1.Len()
- if t1Len > 0 && (t1Len > c.p || (t1Len == c.p && b2ContainsKey)) {
- k, _, ok := c.t1.RemoveOldest()
- if ok {
- c.b1.Add(k, struct{}{})
- }
- } else {
- k, _, ok := c.t2.RemoveOldest()
- if ok {
- c.b2.Add(k, struct{}{})
- }
- }
-}
-
-// Len returns the number of cached entries
-func (c *ARCCache[K, V]) Len() int {
- c.lock.RLock()
- defer c.lock.RUnlock()
- return c.t1.Len() + c.t2.Len()
-}
-
-// Keys returns all the cached keys
-func (c *ARCCache[K, V]) Keys() []K {
- c.lock.RLock()
- defer c.lock.RUnlock()
- k1 := c.t1.Keys()
- k2 := c.t2.Keys()
- return append(k1, k2...)
-}
-
-// Remove is used to purge a key from the cache
-func (c *ARCCache[K, V]) Remove(key K) {
- c.lock.Lock()
- defer c.lock.Unlock()
- if c.t1.Remove(key) {
- return
- }
- if c.t2.Remove(key) {
- return
- }
- if c.b1.Remove(key) {
- return
- }
- if c.b2.Remove(key) {
- return
- }
-}
-
-// Purge is used to clear the cache
-func (c *ARCCache[K, V]) Purge() {
- c.lock.Lock()
- defer c.lock.Unlock()
- c.t1.Purge()
- c.t2.Purge()
- c.b1.Purge()
- c.b2.Purge()
-}
-
-// Contains is used to check if the cache contains a key
-// without updating recency or frequency.
-func (c *ARCCache[K, V]) Contains(key K) bool {
- c.lock.RLock()
- defer c.lock.RUnlock()
- return c.t1.Contains(key) || c.t2.Contains(key)
-}
-
-// Peek is used to inspect the cache value of a key
-// without updating recency or frequency.
-func (c *ARCCache[K, V]) Peek(key K) (value V, ok bool) {
- c.lock.RLock()
- defer c.lock.RUnlock()
- if val, ok := c.t1.Peek(key); ok {
- return val, ok
- }
- return c.t2.Peek(key)
-}
diff --git a/vendor/github.com/hashicorp/golang-lru/v2/doc.go b/vendor/github.com/hashicorp/golang-lru/v2/doc.go
index 2474929f..24107ee0 100644
--- a/vendor/github.com/hashicorp/golang-lru/v2/doc.go
+++ b/vendor/github.com/hashicorp/golang-lru/v2/doc.go
@@ -3,21 +3,21 @@
// Package lru provides three different LRU caches of varying sophistication.
//
-// Cache is a simple LRU cache. It is based on the
-// LRU implementation in groupcache:
-// https://github.com/golang/groupcache/tree/master/lru
+// Cache is a simple LRU cache. It is based on the LRU implementation in
+// groupcache: https://github.com/golang/groupcache/tree/master/lru
//
// TwoQueueCache tracks frequently used and recently used entries separately.
-// This avoids a burst of accesses from taking out frequently used entries,
-// at the cost of about 2x computational overhead and some extra bookkeeping.
+// This avoids a burst of accesses from taking out frequently used entries, at
+// the cost of about 2x computational overhead and some extra bookkeeping.
//
-// ARCCache is an adaptive replacement cache. It tracks recent evictions as
-// well as recent usage in both the frequent and recent caches. Its
-// computational overhead is comparable to TwoQueueCache, but the memory
-// overhead is linear with the size of the cache.
+// ARCCache is an adaptive replacement cache. It tracks recent evictions as well
+// as recent usage in both the frequent and recent caches. Its computational
+// overhead is comparable to TwoQueueCache, but the memory overhead is linear
+// with the size of the cache.
//
// ARC has been patented by IBM, so do not use it if that is problematic for
-// your program.
+// your program. For this reason, it is in a separate go module contained within
+// this repository.
//
// All caches in this package take locks while operating, and are therefore
// thread-safe for consumers.
diff --git a/vendor/github.com/hashicorp/golang-lru/v2/lru.go b/vendor/github.com/hashicorp/golang-lru/v2/lru.go
index 32d04170..a2655f1f 100644
--- a/vendor/github.com/hashicorp/golang-lru/v2/lru.go
+++ b/vendor/github.com/hashicorp/golang-lru/v2/lru.go
@@ -233,6 +233,14 @@ func (c *Cache[K, V]) Keys() []K {
return keys
}
+// Values returns a slice of the values in the cache, from oldest to newest.
+func (c *Cache[K, V]) Values() []V {
+ c.lock.RLock()
+ values := c.lru.Values()
+ c.lock.RUnlock()
+ return values
+}
+
// Len returns the number of items in the cache.
func (c *Cache[K, V]) Len() int {
c.lock.RLock()
diff --git a/vendor/github.com/hashicorp/golang-lru/v2/simplelru/lru.go b/vendor/github.com/hashicorp/golang-lru/v2/simplelru/lru.go
index b6731afd..ac256645 100644
--- a/vendor/github.com/hashicorp/golang-lru/v2/simplelru/lru.go
+++ b/vendor/github.com/hashicorp/golang-lru/v2/simplelru/lru.go
@@ -129,6 +129,17 @@ func (c *LRU[K, V]) Keys() []K {
return keys
}
+// Values returns a slice of the values in the cache, from oldest to newest.
+func (c *LRU[K, V]) Values() []V {
+ values := make([]V, len(c.items))
+ i := 0
+ for ent := c.evictList.back(); ent != nil; ent = ent.prevEntry() {
+ values[i] = ent.value
+ i++
+ }
+ return values
+}
+
// Len returns the number of items in the cache.
func (c *LRU[K, V]) Len() int {
return c.evictList.length()
diff --git a/vendor/github.com/hashicorp/golang-lru/v2/simplelru/lru_interface.go b/vendor/github.com/hashicorp/golang-lru/v2/simplelru/lru_interface.go
index 3cbf02bc..043b8bcc 100644
--- a/vendor/github.com/hashicorp/golang-lru/v2/simplelru/lru_interface.go
+++ b/vendor/github.com/hashicorp/golang-lru/v2/simplelru/lru_interface.go
@@ -32,6 +32,9 @@ type LRUCache[K comparable, V any] interface {
// Returns a slice of the keys in the cache, from oldest to newest.
Keys() []K
+ // Values returns a slice of the values in the cache, from oldest to newest.
+ Values() []V
+
// Returns the number of items in the cache.
Len() int
diff --git a/vendor/github.com/hashicorp/golang-lru/v2/testing.go b/vendor/github.com/hashicorp/golang-lru/v2/testing.go
deleted file mode 100644
index 3277c218..00000000
--- a/vendor/github.com/hashicorp/golang-lru/v2/testing.go
+++ /dev/null
@@ -1,19 +0,0 @@
-// Copyright (c) HashiCorp, Inc.
-// SPDX-License-Identifier: MPL-2.0
-
-package lru
-
-import (
- "crypto/rand"
- "math"
- "math/big"
- "testing"
-)
-
-func getRand(tb testing.TB) int64 {
- out, err := rand.Int(rand.Reader, big.NewInt(math.MaxInt64))
- if err != nil {
- tb.Fatal(err)
- }
- return out.Int64()
-}
diff --git a/vendor/github.com/klauspost/compress/s2/encode_all.go b/vendor/github.com/klauspost/compress/s2/encode_all.go
index 11657f09..5e57995d 100644
--- a/vendor/github.com/klauspost/compress/s2/encode_all.go
+++ b/vendor/github.com/klauspost/compress/s2/encode_all.go
@@ -742,7 +742,6 @@ searchDict:
x := load64(src, s-2)
m2Hash := hash6(x, tableBits)
currHash := hash6(x>>8, tableBits)
- candidate = int(table[currHash])
table[m2Hash] = uint32(s - 2)
table[currHash] = uint32(s - 1)
cv = load64(src, s)
diff --git a/vendor/github.com/klauspost/compress/s2/encode_better.go b/vendor/github.com/klauspost/compress/s2/encode_better.go
index f46adb41..544cb1e1 100644
--- a/vendor/github.com/klauspost/compress/s2/encode_better.go
+++ b/vendor/github.com/klauspost/compress/s2/encode_better.go
@@ -157,7 +157,6 @@ func encodeBlockBetterGo(dst, src []byte) (d int) {
index0 := base + 1
index1 := s - 2
- cv = load64(src, s)
for index0 < index1 {
cv0 := load64(src, index0)
cv1 := load64(src, index1)
@@ -269,18 +268,21 @@ func encodeBlockBetterGo(dst, src []byte) (d int) {
lTable[hash7(cv0, lTableBits)] = uint32(index0)
sTable[hash4(cv0>>8, sTableBits)] = uint32(index0 + 1)
+ // lTable could be postponed, but very minor difference.
lTable[hash7(cv1, lTableBits)] = uint32(index1)
sTable[hash4(cv1>>8, sTableBits)] = uint32(index1 + 1)
index0 += 1
index1 -= 1
cv = load64(src, s)
- // index every second long in between.
- for index0 < index1 {
+ // Index large values sparsely in between.
+ // We do two starting from different offsets for speed.
+ index2 := (index0 + index1 + 1) >> 1
+ for index2 < index1 {
lTable[hash7(load64(src, index0), lTableBits)] = uint32(index0)
- lTable[hash7(load64(src, index1), lTableBits)] = uint32(index1)
+ lTable[hash7(load64(src, index2), lTableBits)] = uint32(index2)
index0 += 2
- index1 -= 2
+ index2 += 2
}
}
@@ -459,12 +461,14 @@ func encodeBlockBetterSnappyGo(dst, src []byte) (d int) {
index1 -= 1
cv = load64(src, s)
- // index every second long in between.
- for index0 < index1 {
+ // Index large values sparsely in between.
+ // We do two starting from different offsets for speed.
+ index2 := (index0 + index1 + 1) >> 1
+ for index2 < index1 {
lTable[hash7(load64(src, index0), lTableBits)] = uint32(index0)
- lTable[hash7(load64(src, index1), lTableBits)] = uint32(index1)
+ lTable[hash7(load64(src, index2), lTableBits)] = uint32(index2)
index0 += 2
- index1 -= 2
+ index2 += 2
}
}
@@ -599,7 +603,6 @@ searchDict:
if s >= sLimit {
break searchDict
}
- cv = load64(src, s)
// Index in-between
index0 := base + 1
index1 := s - 2
@@ -865,12 +868,14 @@ searchDict:
index1 -= 1
cv = load64(src, s)
- // index every second long in between.
- for index0 < index1 {
+ // Index large values sparsely in between.
+ // We do two starting from different offsets for speed.
+ index2 := (index0 + index1 + 1) >> 1
+ for index2 < index1 {
lTable[hash7(load64(src, index0), lTableBits)] = uint32(index0)
- lTable[hash7(load64(src, index1), lTableBits)] = uint32(index1)
+ lTable[hash7(load64(src, index2), lTableBits)] = uint32(index2)
index0 += 2
- index1 -= 2
+ index2 += 2
}
}
@@ -961,7 +966,6 @@ searchDict:
index0 := base + 1
index1 := s - 2
- cv = load64(src, s)
for index0 < index1 {
cv0 := load64(src, index0)
cv1 := load64(src, index1)
@@ -1079,12 +1083,14 @@ searchDict:
index1 -= 1
cv = load64(src, s)
- // index every second long in between.
- for index0 < index1 {
+ // Index large values sparsely in between.
+ // We do two starting from different offsets for speed.
+ index2 := (index0 + index1 + 1) >> 1
+ for index2 < index1 {
lTable[hash7(load64(src, index0), lTableBits)] = uint32(index0)
- lTable[hash7(load64(src, index1), lTableBits)] = uint32(index1)
+ lTable[hash7(load64(src, index2), lTableBits)] = uint32(index2)
index0 += 2
- index1 -= 2
+ index2 += 2
}
}
diff --git a/vendor/github.com/klauspost/compress/s2/encodeblock_amd64.s b/vendor/github.com/klauspost/compress/s2/encodeblock_amd64.s
index 9222d179..54031aa3 100644
--- a/vendor/github.com/klauspost/compress/s2/encodeblock_amd64.s
+++ b/vendor/github.com/klauspost/compress/s2/encodeblock_amd64.s
@@ -274,7 +274,6 @@ matchlen_loop_repeat_extend_encodeBlockAsm:
LEAL 8(R11), R11
CMPL R8, $0x08
JAE matchlen_loopback_repeat_extend_encodeBlockAsm
- JZ repeat_extend_forward_end_encodeBlockAsm
matchlen_match4_repeat_extend_encodeBlockAsm:
CMPL R8, $0x04
@@ -282,21 +281,21 @@ matchlen_match4_repeat_extend_encodeBlockAsm:
MOVL (R9)(R11*1), R10
CMPL (BX)(R11*1), R10
JNE matchlen_match2_repeat_extend_encodeBlockAsm
- SUBL $0x04, R8
+ LEAL -4(R8), R8
LEAL 4(R11), R11
matchlen_match2_repeat_extend_encodeBlockAsm:
- CMPL R8, $0x02
- JB matchlen_match1_repeat_extend_encodeBlockAsm
+ CMPL R8, $0x01
+ JE matchlen_match1_repeat_extend_encodeBlockAsm
+ JB repeat_extend_forward_end_encodeBlockAsm
MOVW (R9)(R11*1), R10
CMPW (BX)(R11*1), R10
JNE matchlen_match1_repeat_extend_encodeBlockAsm
- SUBL $0x02, R8
LEAL 2(R11), R11
+ SUBL $0x02, R8
+ JZ repeat_extend_forward_end_encodeBlockAsm
matchlen_match1_repeat_extend_encodeBlockAsm:
- CMPL R8, $0x01
- JB repeat_extend_forward_end_encodeBlockAsm
MOVB (R9)(R11*1), R10
CMPB (BX)(R11*1), R10
JNE repeat_extend_forward_end_encodeBlockAsm
@@ -877,7 +876,6 @@ matchlen_loop_match_nolit_encodeBlockAsm:
LEAL 8(R9), R9
CMPL SI, $0x08
JAE matchlen_loopback_match_nolit_encodeBlockAsm
- JZ match_nolit_end_encodeBlockAsm
matchlen_match4_match_nolit_encodeBlockAsm:
CMPL SI, $0x04
@@ -885,21 +883,21 @@ matchlen_match4_match_nolit_encodeBlockAsm:
MOVL (DI)(R9*1), R8
CMPL (BX)(R9*1), R8
JNE matchlen_match2_match_nolit_encodeBlockAsm
- SUBL $0x04, SI
+ LEAL -4(SI), SI
LEAL 4(R9), R9
matchlen_match2_match_nolit_encodeBlockAsm:
- CMPL SI, $0x02
- JB matchlen_match1_match_nolit_encodeBlockAsm
+ CMPL SI, $0x01
+ JE matchlen_match1_match_nolit_encodeBlockAsm
+ JB match_nolit_end_encodeBlockAsm
MOVW (DI)(R9*1), R8
CMPW (BX)(R9*1), R8
JNE matchlen_match1_match_nolit_encodeBlockAsm
- SUBL $0x02, SI
LEAL 2(R9), R9
+ SUBL $0x02, SI
+ JZ match_nolit_end_encodeBlockAsm
matchlen_match1_match_nolit_encodeBlockAsm:
- CMPL SI, $0x01
- JB match_nolit_end_encodeBlockAsm
MOVB (DI)(R9*1), R8
CMPB (BX)(R9*1), R8
JNE match_nolit_end_encodeBlockAsm
@@ -1637,7 +1635,6 @@ matchlen_loop_repeat_extend_encodeBlockAsm4MB:
LEAL 8(R11), R11
CMPL R8, $0x08
JAE matchlen_loopback_repeat_extend_encodeBlockAsm4MB
- JZ repeat_extend_forward_end_encodeBlockAsm4MB
matchlen_match4_repeat_extend_encodeBlockAsm4MB:
CMPL R8, $0x04
@@ -1645,21 +1642,21 @@ matchlen_match4_repeat_extend_encodeBlockAsm4MB:
MOVL (R9)(R11*1), R10
CMPL (BX)(R11*1), R10
JNE matchlen_match2_repeat_extend_encodeBlockAsm4MB
- SUBL $0x04, R8
+ LEAL -4(R8), R8
LEAL 4(R11), R11
matchlen_match2_repeat_extend_encodeBlockAsm4MB:
- CMPL R8, $0x02
- JB matchlen_match1_repeat_extend_encodeBlockAsm4MB
+ CMPL R8, $0x01
+ JE matchlen_match1_repeat_extend_encodeBlockAsm4MB
+ JB repeat_extend_forward_end_encodeBlockAsm4MB
MOVW (R9)(R11*1), R10
CMPW (BX)(R11*1), R10
JNE matchlen_match1_repeat_extend_encodeBlockAsm4MB
- SUBL $0x02, R8
LEAL 2(R11), R11
+ SUBL $0x02, R8
+ JZ repeat_extend_forward_end_encodeBlockAsm4MB
matchlen_match1_repeat_extend_encodeBlockAsm4MB:
- CMPL R8, $0x01
- JB repeat_extend_forward_end_encodeBlockAsm4MB
MOVB (R9)(R11*1), R10
CMPB (BX)(R11*1), R10
JNE repeat_extend_forward_end_encodeBlockAsm4MB
@@ -2190,7 +2187,6 @@ matchlen_loop_match_nolit_encodeBlockAsm4MB:
LEAL 8(R9), R9
CMPL SI, $0x08
JAE matchlen_loopback_match_nolit_encodeBlockAsm4MB
- JZ match_nolit_end_encodeBlockAsm4MB
matchlen_match4_match_nolit_encodeBlockAsm4MB:
CMPL SI, $0x04
@@ -2198,21 +2194,21 @@ matchlen_match4_match_nolit_encodeBlockAsm4MB:
MOVL (DI)(R9*1), R8
CMPL (BX)(R9*1), R8
JNE matchlen_match2_match_nolit_encodeBlockAsm4MB
- SUBL $0x04, SI
+ LEAL -4(SI), SI
LEAL 4(R9), R9
matchlen_match2_match_nolit_encodeBlockAsm4MB:
- CMPL SI, $0x02
- JB matchlen_match1_match_nolit_encodeBlockAsm4MB
+ CMPL SI, $0x01
+ JE matchlen_match1_match_nolit_encodeBlockAsm4MB
+ JB match_nolit_end_encodeBlockAsm4MB
MOVW (DI)(R9*1), R8
CMPW (BX)(R9*1), R8
JNE matchlen_match1_match_nolit_encodeBlockAsm4MB
- SUBL $0x02, SI
LEAL 2(R9), R9
+ SUBL $0x02, SI
+ JZ match_nolit_end_encodeBlockAsm4MB
matchlen_match1_match_nolit_encodeBlockAsm4MB:
- CMPL SI, $0x01
- JB match_nolit_end_encodeBlockAsm4MB
MOVB (DI)(R9*1), R8
CMPB (BX)(R9*1), R8
JNE match_nolit_end_encodeBlockAsm4MB
@@ -2902,7 +2898,6 @@ matchlen_loop_repeat_extend_encodeBlockAsm12B:
LEAL 8(R11), R11
CMPL R8, $0x08
JAE matchlen_loopback_repeat_extend_encodeBlockAsm12B
- JZ repeat_extend_forward_end_encodeBlockAsm12B
matchlen_match4_repeat_extend_encodeBlockAsm12B:
CMPL R8, $0x04
@@ -2910,21 +2905,21 @@ matchlen_match4_repeat_extend_encodeBlockAsm12B:
MOVL (R9)(R11*1), R10
CMPL (BX)(R11*1), R10
JNE matchlen_match2_repeat_extend_encodeBlockAsm12B
- SUBL $0x04, R8
+ LEAL -4(R8), R8
LEAL 4(R11), R11
matchlen_match2_repeat_extend_encodeBlockAsm12B:
- CMPL R8, $0x02
- JB matchlen_match1_repeat_extend_encodeBlockAsm12B
+ CMPL R8, $0x01
+ JE matchlen_match1_repeat_extend_encodeBlockAsm12B
+ JB repeat_extend_forward_end_encodeBlockAsm12B
MOVW (R9)(R11*1), R10
CMPW (BX)(R11*1), R10
JNE matchlen_match1_repeat_extend_encodeBlockAsm12B
- SUBL $0x02, R8
LEAL 2(R11), R11
+ SUBL $0x02, R8
+ JZ repeat_extend_forward_end_encodeBlockAsm12B
matchlen_match1_repeat_extend_encodeBlockAsm12B:
- CMPL R8, $0x01
- JB repeat_extend_forward_end_encodeBlockAsm12B
MOVB (R9)(R11*1), R10
CMPB (BX)(R11*1), R10
JNE repeat_extend_forward_end_encodeBlockAsm12B
@@ -3333,7 +3328,6 @@ matchlen_loop_match_nolit_encodeBlockAsm12B:
LEAL 8(R9), R9
CMPL SI, $0x08
JAE matchlen_loopback_match_nolit_encodeBlockAsm12B
- JZ match_nolit_end_encodeBlockAsm12B
matchlen_match4_match_nolit_encodeBlockAsm12B:
CMPL SI, $0x04
@@ -3341,21 +3335,21 @@ matchlen_match4_match_nolit_encodeBlockAsm12B:
MOVL (DI)(R9*1), R8
CMPL (BX)(R9*1), R8
JNE matchlen_match2_match_nolit_encodeBlockAsm12B
- SUBL $0x04, SI
+ LEAL -4(SI), SI
LEAL 4(R9), R9
matchlen_match2_match_nolit_encodeBlockAsm12B:
- CMPL SI, $0x02
- JB matchlen_match1_match_nolit_encodeBlockAsm12B
+ CMPL SI, $0x01
+ JE matchlen_match1_match_nolit_encodeBlockAsm12B
+ JB match_nolit_end_encodeBlockAsm12B
MOVW (DI)(R9*1), R8
CMPW (BX)(R9*1), R8
JNE matchlen_match1_match_nolit_encodeBlockAsm12B
- SUBL $0x02, SI
LEAL 2(R9), R9
+ SUBL $0x02, SI
+ JZ match_nolit_end_encodeBlockAsm12B
matchlen_match1_match_nolit_encodeBlockAsm12B:
- CMPL SI, $0x01
- JB match_nolit_end_encodeBlockAsm12B
MOVB (DI)(R9*1), R8
CMPB (BX)(R9*1), R8
JNE match_nolit_end_encodeBlockAsm12B
@@ -3935,7 +3929,6 @@ matchlen_loop_repeat_extend_encodeBlockAsm10B:
LEAL 8(R11), R11
CMPL R8, $0x08
JAE matchlen_loopback_repeat_extend_encodeBlockAsm10B
- JZ repeat_extend_forward_end_encodeBlockAsm10B
matchlen_match4_repeat_extend_encodeBlockAsm10B:
CMPL R8, $0x04
@@ -3943,21 +3936,21 @@ matchlen_match4_repeat_extend_encodeBlockAsm10B:
MOVL (R9)(R11*1), R10
CMPL (BX)(R11*1), R10
JNE matchlen_match2_repeat_extend_encodeBlockAsm10B
- SUBL $0x04, R8
+ LEAL -4(R8), R8
LEAL 4(R11), R11
matchlen_match2_repeat_extend_encodeBlockAsm10B:
- CMPL R8, $0x02
- JB matchlen_match1_repeat_extend_encodeBlockAsm10B
+ CMPL R8, $0x01
+ JE matchlen_match1_repeat_extend_encodeBlockAsm10B
+ JB repeat_extend_forward_end_encodeBlockAsm10B
MOVW (R9)(R11*1), R10
CMPW (BX)(R11*1), R10
JNE matchlen_match1_repeat_extend_encodeBlockAsm10B
- SUBL $0x02, R8
LEAL 2(R11), R11
+ SUBL $0x02, R8
+ JZ repeat_extend_forward_end_encodeBlockAsm10B
matchlen_match1_repeat_extend_encodeBlockAsm10B:
- CMPL R8, $0x01
- JB repeat_extend_forward_end_encodeBlockAsm10B
MOVB (R9)(R11*1), R10
CMPB (BX)(R11*1), R10
JNE repeat_extend_forward_end_encodeBlockAsm10B
@@ -4366,7 +4359,6 @@ matchlen_loop_match_nolit_encodeBlockAsm10B:
LEAL 8(R9), R9
CMPL SI, $0x08
JAE matchlen_loopback_match_nolit_encodeBlockAsm10B
- JZ match_nolit_end_encodeBlockAsm10B
matchlen_match4_match_nolit_encodeBlockAsm10B:
CMPL SI, $0x04
@@ -4374,21 +4366,21 @@ matchlen_match4_match_nolit_encodeBlockAsm10B:
MOVL (DI)(R9*1), R8
CMPL (BX)(R9*1), R8
JNE matchlen_match2_match_nolit_encodeBlockAsm10B
- SUBL $0x04, SI
+ LEAL -4(SI), SI
LEAL 4(R9), R9
matchlen_match2_match_nolit_encodeBlockAsm10B:
- CMPL SI, $0x02
- JB matchlen_match1_match_nolit_encodeBlockAsm10B
+ CMPL SI, $0x01
+ JE matchlen_match1_match_nolit_encodeBlockAsm10B
+ JB match_nolit_end_encodeBlockAsm10B
MOVW (DI)(R9*1), R8
CMPW (BX)(R9*1), R8
JNE matchlen_match1_match_nolit_encodeBlockAsm10B
- SUBL $0x02, SI
LEAL 2(R9), R9
+ SUBL $0x02, SI
+ JZ match_nolit_end_encodeBlockAsm10B
matchlen_match1_match_nolit_encodeBlockAsm10B:
- CMPL SI, $0x01
- JB match_nolit_end_encodeBlockAsm10B
MOVB (DI)(R9*1), R8
CMPB (BX)(R9*1), R8
JNE match_nolit_end_encodeBlockAsm10B
@@ -4968,7 +4960,6 @@ matchlen_loop_repeat_extend_encodeBlockAsm8B:
LEAL 8(R11), R11
CMPL R8, $0x08
JAE matchlen_loopback_repeat_extend_encodeBlockAsm8B
- JZ repeat_extend_forward_end_encodeBlockAsm8B
matchlen_match4_repeat_extend_encodeBlockAsm8B:
CMPL R8, $0x04
@@ -4976,21 +4967,21 @@ matchlen_match4_repeat_extend_encodeBlockAsm8B:
MOVL (R9)(R11*1), R10
CMPL (BX)(R11*1), R10
JNE matchlen_match2_repeat_extend_encodeBlockAsm8B
- SUBL $0x04, R8
+ LEAL -4(R8), R8
LEAL 4(R11), R11
matchlen_match2_repeat_extend_encodeBlockAsm8B:
- CMPL R8, $0x02
- JB matchlen_match1_repeat_extend_encodeBlockAsm8B
+ CMPL R8, $0x01
+ JE matchlen_match1_repeat_extend_encodeBlockAsm8B
+ JB repeat_extend_forward_end_encodeBlockAsm8B
MOVW (R9)(R11*1), R10
CMPW (BX)(R11*1), R10
JNE matchlen_match1_repeat_extend_encodeBlockAsm8B
- SUBL $0x02, R8
LEAL 2(R11), R11
+ SUBL $0x02, R8
+ JZ repeat_extend_forward_end_encodeBlockAsm8B
matchlen_match1_repeat_extend_encodeBlockAsm8B:
- CMPL R8, $0x01
- JB repeat_extend_forward_end_encodeBlockAsm8B
MOVB (R9)(R11*1), R10
CMPB (BX)(R11*1), R10
JNE repeat_extend_forward_end_encodeBlockAsm8B
@@ -5385,7 +5376,6 @@ matchlen_loop_match_nolit_encodeBlockAsm8B:
LEAL 8(R9), R9
CMPL SI, $0x08
JAE matchlen_loopback_match_nolit_encodeBlockAsm8B
- JZ match_nolit_end_encodeBlockAsm8B
matchlen_match4_match_nolit_encodeBlockAsm8B:
CMPL SI, $0x04
@@ -5393,21 +5383,21 @@ matchlen_match4_match_nolit_encodeBlockAsm8B:
MOVL (DI)(R9*1), R8
CMPL (BX)(R9*1), R8
JNE matchlen_match2_match_nolit_encodeBlockAsm8B
- SUBL $0x04, SI
+ LEAL -4(SI), SI
LEAL 4(R9), R9
matchlen_match2_match_nolit_encodeBlockAsm8B:
- CMPL SI, $0x02
- JB matchlen_match1_match_nolit_encodeBlockAsm8B
+ CMPL SI, $0x01
+ JE matchlen_match1_match_nolit_encodeBlockAsm8B
+ JB match_nolit_end_encodeBlockAsm8B
MOVW (DI)(R9*1), R8
CMPW (BX)(R9*1), R8
JNE matchlen_match1_match_nolit_encodeBlockAsm8B
- SUBL $0x02, SI
LEAL 2(R9), R9
+ SUBL $0x02, SI
+ JZ match_nolit_end_encodeBlockAsm8B
matchlen_match1_match_nolit_encodeBlockAsm8B:
- CMPL SI, $0x01
- JB match_nolit_end_encodeBlockAsm8B
MOVB (DI)(R9*1), R8
CMPB (BX)(R9*1), R8
JNE match_nolit_end_encodeBlockAsm8B
@@ -5889,7 +5879,6 @@ matchlen_loop_match_nolit_encodeBetterBlockAsm:
LEAL 8(R11), R11
CMPL DI, $0x08
JAE matchlen_loopback_match_nolit_encodeBetterBlockAsm
- JZ match_nolit_end_encodeBetterBlockAsm
matchlen_match4_match_nolit_encodeBetterBlockAsm:
CMPL DI, $0x04
@@ -5897,21 +5886,21 @@ matchlen_match4_match_nolit_encodeBetterBlockAsm:
MOVL (R8)(R11*1), R10
CMPL (R9)(R11*1), R10
JNE matchlen_match2_match_nolit_encodeBetterBlockAsm
- SUBL $0x04, DI
+ LEAL -4(DI), DI
LEAL 4(R11), R11
matchlen_match2_match_nolit_encodeBetterBlockAsm:
- CMPL DI, $0x02
- JB matchlen_match1_match_nolit_encodeBetterBlockAsm
+ CMPL DI, $0x01
+ JE matchlen_match1_match_nolit_encodeBetterBlockAsm
+ JB match_nolit_end_encodeBetterBlockAsm
MOVW (R8)(R11*1), R10
CMPW (R9)(R11*1), R10
JNE matchlen_match1_match_nolit_encodeBetterBlockAsm
- SUBL $0x02, DI
LEAL 2(R11), R11
+ SUBL $0x02, DI
+ JZ match_nolit_end_encodeBetterBlockAsm
matchlen_match1_match_nolit_encodeBetterBlockAsm:
- CMPL DI, $0x01
- JB match_nolit_end_encodeBetterBlockAsm
MOVB (R8)(R11*1), R10
CMPB (R9)(R11*1), R10
JNE match_nolit_end_encodeBetterBlockAsm
@@ -6607,24 +6596,26 @@ match_nolit_dst_ok_encodeBetterBlockAsm:
MOVL R8, 24(SP)(R11*4)
MOVL DI, 524312(SP)(R10*4)
MOVL R13, 524312(SP)(R12*4)
+ LEAQ 1(R8)(SI*1), DI
+ SHRQ $0x01, DI
ADDQ $0x01, SI
SUBQ $0x01, R8
index_loop_encodeBetterBlockAsm:
- CMPQ SI, R8
+ CMPQ DI, R8
JAE search_loop_encodeBetterBlockAsm
- MOVQ (DX)(SI*1), DI
- MOVQ (DX)(R8*1), R9
- SHLQ $0x08, DI
- IMULQ BX, DI
- SHRQ $0x2f, DI
+ MOVQ (DX)(SI*1), R9
+ MOVQ (DX)(DI*1), R10
SHLQ $0x08, R9
IMULQ BX, R9
SHRQ $0x2f, R9
- MOVL SI, 24(SP)(DI*4)
- MOVL R8, 24(SP)(R9*4)
+ SHLQ $0x08, R10
+ IMULQ BX, R10
+ SHRQ $0x2f, R10
+ MOVL SI, 24(SP)(R9*4)
+ MOVL DI, 24(SP)(R10*4)
ADDQ $0x02, SI
- SUBQ $0x02, R8
+ ADDQ $0x02, DI
JMP index_loop_encodeBetterBlockAsm
emit_remainder_encodeBetterBlockAsm:
@@ -6960,7 +6951,6 @@ matchlen_loop_match_nolit_encodeBetterBlockAsm4MB:
LEAL 8(R11), R11
CMPL DI, $0x08
JAE matchlen_loopback_match_nolit_encodeBetterBlockAsm4MB
- JZ match_nolit_end_encodeBetterBlockAsm4MB
matchlen_match4_match_nolit_encodeBetterBlockAsm4MB:
CMPL DI, $0x04
@@ -6968,21 +6958,21 @@ matchlen_match4_match_nolit_encodeBetterBlockAsm4MB:
MOVL (R8)(R11*1), R10
CMPL (R9)(R11*1), R10
JNE matchlen_match2_match_nolit_encodeBetterBlockAsm4MB
- SUBL $0x04, DI
+ LEAL -4(DI), DI
LEAL 4(R11), R11
matchlen_match2_match_nolit_encodeBetterBlockAsm4MB:
- CMPL DI, $0x02
- JB matchlen_match1_match_nolit_encodeBetterBlockAsm4MB
+ CMPL DI, $0x01
+ JE matchlen_match1_match_nolit_encodeBetterBlockAsm4MB
+ JB match_nolit_end_encodeBetterBlockAsm4MB
MOVW (R8)(R11*1), R10
CMPW (R9)(R11*1), R10
JNE matchlen_match1_match_nolit_encodeBetterBlockAsm4MB
- SUBL $0x02, DI
LEAL 2(R11), R11
+ SUBL $0x02, DI
+ JZ match_nolit_end_encodeBetterBlockAsm4MB
matchlen_match1_match_nolit_encodeBetterBlockAsm4MB:
- CMPL DI, $0x01
- JB match_nolit_end_encodeBetterBlockAsm4MB
MOVB (R8)(R11*1), R10
CMPB (R9)(R11*1), R10
JNE match_nolit_end_encodeBetterBlockAsm4MB
@@ -7620,24 +7610,26 @@ match_nolit_dst_ok_encodeBetterBlockAsm4MB:
MOVL R8, 24(SP)(R11*4)
MOVL DI, 524312(SP)(R10*4)
MOVL R13, 524312(SP)(R12*4)
+ LEAQ 1(R8)(SI*1), DI
+ SHRQ $0x01, DI
ADDQ $0x01, SI
SUBQ $0x01, R8
index_loop_encodeBetterBlockAsm4MB:
- CMPQ SI, R8
+ CMPQ DI, R8
JAE search_loop_encodeBetterBlockAsm4MB
- MOVQ (DX)(SI*1), DI
- MOVQ (DX)(R8*1), R9
- SHLQ $0x08, DI
- IMULQ BX, DI
- SHRQ $0x2f, DI
+ MOVQ (DX)(SI*1), R9
+ MOVQ (DX)(DI*1), R10
SHLQ $0x08, R9
IMULQ BX, R9
SHRQ $0x2f, R9
- MOVL SI, 24(SP)(DI*4)
- MOVL R8, 24(SP)(R9*4)
+ SHLQ $0x08, R10
+ IMULQ BX, R10
+ SHRQ $0x2f, R10
+ MOVL SI, 24(SP)(R9*4)
+ MOVL DI, 24(SP)(R10*4)
ADDQ $0x02, SI
- SUBQ $0x02, R8
+ ADDQ $0x02, DI
JMP index_loop_encodeBetterBlockAsm4MB
emit_remainder_encodeBetterBlockAsm4MB:
@@ -7957,7 +7949,6 @@ matchlen_loop_match_nolit_encodeBetterBlockAsm12B:
LEAL 8(R11), R11
CMPL DI, $0x08
JAE matchlen_loopback_match_nolit_encodeBetterBlockAsm12B
- JZ match_nolit_end_encodeBetterBlockAsm12B
matchlen_match4_match_nolit_encodeBetterBlockAsm12B:
CMPL DI, $0x04
@@ -7965,21 +7956,21 @@ matchlen_match4_match_nolit_encodeBetterBlockAsm12B:
MOVL (R8)(R11*1), R10
CMPL (R9)(R11*1), R10
JNE matchlen_match2_match_nolit_encodeBetterBlockAsm12B
- SUBL $0x04, DI
+ LEAL -4(DI), DI
LEAL 4(R11), R11
matchlen_match2_match_nolit_encodeBetterBlockAsm12B:
- CMPL DI, $0x02
- JB matchlen_match1_match_nolit_encodeBetterBlockAsm12B
+ CMPL DI, $0x01
+ JE matchlen_match1_match_nolit_encodeBetterBlockAsm12B
+ JB match_nolit_end_encodeBetterBlockAsm12B
MOVW (R8)(R11*1), R10
CMPW (R9)(R11*1), R10
JNE matchlen_match1_match_nolit_encodeBetterBlockAsm12B
- SUBL $0x02, DI
LEAL 2(R11), R11
+ SUBL $0x02, DI
+ JZ match_nolit_end_encodeBetterBlockAsm12B
matchlen_match1_match_nolit_encodeBetterBlockAsm12B:
- CMPL DI, $0x01
- JB match_nolit_end_encodeBetterBlockAsm12B
MOVB (R8)(R11*1), R10
CMPB (R9)(R11*1), R10
JNE match_nolit_end_encodeBetterBlockAsm12B
@@ -8478,24 +8469,26 @@ match_nolit_dst_ok_encodeBetterBlockAsm12B:
MOVL R8, 24(SP)(R11*4)
MOVL DI, 65560(SP)(R10*4)
MOVL R13, 65560(SP)(R12*4)
+ LEAQ 1(R8)(SI*1), DI
+ SHRQ $0x01, DI
ADDQ $0x01, SI
SUBQ $0x01, R8
index_loop_encodeBetterBlockAsm12B:
- CMPQ SI, R8
+ CMPQ DI, R8
JAE search_loop_encodeBetterBlockAsm12B
- MOVQ (DX)(SI*1), DI
- MOVQ (DX)(R8*1), R9
- SHLQ $0x10, DI
- IMULQ BX, DI
- SHRQ $0x32, DI
+ MOVQ (DX)(SI*1), R9
+ MOVQ (DX)(DI*1), R10
SHLQ $0x10, R9
IMULQ BX, R9
SHRQ $0x32, R9
- MOVL SI, 24(SP)(DI*4)
- MOVL R8, 24(SP)(R9*4)
+ SHLQ $0x10, R10
+ IMULQ BX, R10
+ SHRQ $0x32, R10
+ MOVL SI, 24(SP)(R9*4)
+ MOVL DI, 24(SP)(R10*4)
ADDQ $0x02, SI
- SUBQ $0x02, R8
+ ADDQ $0x02, DI
JMP index_loop_encodeBetterBlockAsm12B
emit_remainder_encodeBetterBlockAsm12B:
@@ -8807,7 +8800,6 @@ matchlen_loop_match_nolit_encodeBetterBlockAsm10B:
LEAL 8(R11), R11
CMPL DI, $0x08
JAE matchlen_loopback_match_nolit_encodeBetterBlockAsm10B
- JZ match_nolit_end_encodeBetterBlockAsm10B
matchlen_match4_match_nolit_encodeBetterBlockAsm10B:
CMPL DI, $0x04
@@ -8815,21 +8807,21 @@ matchlen_match4_match_nolit_encodeBetterBlockAsm10B:
MOVL (R8)(R11*1), R10
CMPL (R9)(R11*1), R10
JNE matchlen_match2_match_nolit_encodeBetterBlockAsm10B
- SUBL $0x04, DI
+ LEAL -4(DI), DI
LEAL 4(R11), R11
matchlen_match2_match_nolit_encodeBetterBlockAsm10B:
- CMPL DI, $0x02
- JB matchlen_match1_match_nolit_encodeBetterBlockAsm10B
+ CMPL DI, $0x01
+ JE matchlen_match1_match_nolit_encodeBetterBlockAsm10B
+ JB match_nolit_end_encodeBetterBlockAsm10B
MOVW (R8)(R11*1), R10
CMPW (R9)(R11*1), R10
JNE matchlen_match1_match_nolit_encodeBetterBlockAsm10B
- SUBL $0x02, DI
LEAL 2(R11), R11
+ SUBL $0x02, DI
+ JZ match_nolit_end_encodeBetterBlockAsm10B
matchlen_match1_match_nolit_encodeBetterBlockAsm10B:
- CMPL DI, $0x01
- JB match_nolit_end_encodeBetterBlockAsm10B
MOVB (R8)(R11*1), R10
CMPB (R9)(R11*1), R10
JNE match_nolit_end_encodeBetterBlockAsm10B
@@ -9328,24 +9320,26 @@ match_nolit_dst_ok_encodeBetterBlockAsm10B:
MOVL R8, 24(SP)(R11*4)
MOVL DI, 16408(SP)(R10*4)
MOVL R13, 16408(SP)(R12*4)
+ LEAQ 1(R8)(SI*1), DI
+ SHRQ $0x01, DI
ADDQ $0x01, SI
SUBQ $0x01, R8
index_loop_encodeBetterBlockAsm10B:
- CMPQ SI, R8
+ CMPQ DI, R8
JAE search_loop_encodeBetterBlockAsm10B
- MOVQ (DX)(SI*1), DI
- MOVQ (DX)(R8*1), R9
- SHLQ $0x10, DI
- IMULQ BX, DI
- SHRQ $0x34, DI
+ MOVQ (DX)(SI*1), R9
+ MOVQ (DX)(DI*1), R10
SHLQ $0x10, R9
IMULQ BX, R9
SHRQ $0x34, R9
- MOVL SI, 24(SP)(DI*4)
- MOVL R8, 24(SP)(R9*4)
+ SHLQ $0x10, R10
+ IMULQ BX, R10
+ SHRQ $0x34, R10
+ MOVL SI, 24(SP)(R9*4)
+ MOVL DI, 24(SP)(R10*4)
ADDQ $0x02, SI
- SUBQ $0x02, R8
+ ADDQ $0x02, DI
JMP index_loop_encodeBetterBlockAsm10B
emit_remainder_encodeBetterBlockAsm10B:
@@ -9657,7 +9651,6 @@ matchlen_loop_match_nolit_encodeBetterBlockAsm8B:
LEAL 8(R11), R11
CMPL DI, $0x08
JAE matchlen_loopback_match_nolit_encodeBetterBlockAsm8B
- JZ match_nolit_end_encodeBetterBlockAsm8B
matchlen_match4_match_nolit_encodeBetterBlockAsm8B:
CMPL DI, $0x04
@@ -9665,21 +9658,21 @@ matchlen_match4_match_nolit_encodeBetterBlockAsm8B:
MOVL (R8)(R11*1), R10
CMPL (R9)(R11*1), R10
JNE matchlen_match2_match_nolit_encodeBetterBlockAsm8B
- SUBL $0x04, DI
+ LEAL -4(DI), DI
LEAL 4(R11), R11
matchlen_match2_match_nolit_encodeBetterBlockAsm8B:
- CMPL DI, $0x02
- JB matchlen_match1_match_nolit_encodeBetterBlockAsm8B
+ CMPL DI, $0x01
+ JE matchlen_match1_match_nolit_encodeBetterBlockAsm8B
+ JB match_nolit_end_encodeBetterBlockAsm8B
MOVW (R8)(R11*1), R10
CMPW (R9)(R11*1), R10
JNE matchlen_match1_match_nolit_encodeBetterBlockAsm8B
- SUBL $0x02, DI
LEAL 2(R11), R11
+ SUBL $0x02, DI
+ JZ match_nolit_end_encodeBetterBlockAsm8B
matchlen_match1_match_nolit_encodeBetterBlockAsm8B:
- CMPL DI, $0x01
- JB match_nolit_end_encodeBetterBlockAsm8B
MOVB (R8)(R11*1), R10
CMPB (R9)(R11*1), R10
JNE match_nolit_end_encodeBetterBlockAsm8B
@@ -10164,24 +10157,26 @@ match_nolit_dst_ok_encodeBetterBlockAsm8B:
MOVL R8, 24(SP)(R11*4)
MOVL DI, 4120(SP)(R10*4)
MOVL R13, 4120(SP)(R12*4)
+ LEAQ 1(R8)(SI*1), DI
+ SHRQ $0x01, DI
ADDQ $0x01, SI
SUBQ $0x01, R8
index_loop_encodeBetterBlockAsm8B:
- CMPQ SI, R8
+ CMPQ DI, R8
JAE search_loop_encodeBetterBlockAsm8B
- MOVQ (DX)(SI*1), DI
- MOVQ (DX)(R8*1), R9
- SHLQ $0x10, DI
- IMULQ BX, DI
- SHRQ $0x36, DI
+ MOVQ (DX)(SI*1), R9
+ MOVQ (DX)(DI*1), R10
SHLQ $0x10, R9
IMULQ BX, R9
SHRQ $0x36, R9
- MOVL SI, 24(SP)(DI*4)
- MOVL R8, 24(SP)(R9*4)
+ SHLQ $0x10, R10
+ IMULQ BX, R10
+ SHRQ $0x36, R10
+ MOVL SI, 24(SP)(R9*4)
+ MOVL DI, 24(SP)(R10*4)
ADDQ $0x02, SI
- SUBQ $0x02, R8
+ ADDQ $0x02, DI
JMP index_loop_encodeBetterBlockAsm8B
emit_remainder_encodeBetterBlockAsm8B:
@@ -10605,7 +10600,6 @@ matchlen_loop_repeat_extend_encodeSnappyBlockAsm:
LEAL 8(R10), R10
CMPL DI, $0x08
JAE matchlen_loopback_repeat_extend_encodeSnappyBlockAsm
- JZ repeat_extend_forward_end_encodeSnappyBlockAsm
matchlen_match4_repeat_extend_encodeSnappyBlockAsm:
CMPL DI, $0x04
@@ -10613,21 +10607,21 @@ matchlen_match4_repeat_extend_encodeSnappyBlockAsm:
MOVL (R8)(R10*1), R9
CMPL (BX)(R10*1), R9
JNE matchlen_match2_repeat_extend_encodeSnappyBlockAsm
- SUBL $0x04, DI
+ LEAL -4(DI), DI
LEAL 4(R10), R10
matchlen_match2_repeat_extend_encodeSnappyBlockAsm:
- CMPL DI, $0x02
- JB matchlen_match1_repeat_extend_encodeSnappyBlockAsm
+ CMPL DI, $0x01
+ JE matchlen_match1_repeat_extend_encodeSnappyBlockAsm
+ JB repeat_extend_forward_end_encodeSnappyBlockAsm
MOVW (R8)(R10*1), R9
CMPW (BX)(R10*1), R9
JNE matchlen_match1_repeat_extend_encodeSnappyBlockAsm
- SUBL $0x02, DI
LEAL 2(R10), R10
+ SUBL $0x02, DI
+ JZ repeat_extend_forward_end_encodeSnappyBlockAsm
matchlen_match1_repeat_extend_encodeSnappyBlockAsm:
- CMPL DI, $0x01
- JB repeat_extend_forward_end_encodeSnappyBlockAsm
MOVB (R8)(R10*1), R9
CMPB (BX)(R10*1), R9
JNE repeat_extend_forward_end_encodeSnappyBlockAsm
@@ -10928,7 +10922,6 @@ matchlen_loop_match_nolit_encodeSnappyBlockAsm:
LEAL 8(R9), R9
CMPL SI, $0x08
JAE matchlen_loopback_match_nolit_encodeSnappyBlockAsm
- JZ match_nolit_end_encodeSnappyBlockAsm
matchlen_match4_match_nolit_encodeSnappyBlockAsm:
CMPL SI, $0x04
@@ -10936,21 +10929,21 @@ matchlen_match4_match_nolit_encodeSnappyBlockAsm:
MOVL (DI)(R9*1), R8
CMPL (BX)(R9*1), R8
JNE matchlen_match2_match_nolit_encodeSnappyBlockAsm
- SUBL $0x04, SI
+ LEAL -4(SI), SI
LEAL 4(R9), R9
matchlen_match2_match_nolit_encodeSnappyBlockAsm:
- CMPL SI, $0x02
- JB matchlen_match1_match_nolit_encodeSnappyBlockAsm
+ CMPL SI, $0x01
+ JE matchlen_match1_match_nolit_encodeSnappyBlockAsm
+ JB match_nolit_end_encodeSnappyBlockAsm
MOVW (DI)(R9*1), R8
CMPW (BX)(R9*1), R8
JNE matchlen_match1_match_nolit_encodeSnappyBlockAsm
- SUBL $0x02, SI
LEAL 2(R9), R9
+ SUBL $0x02, SI
+ JZ match_nolit_end_encodeSnappyBlockAsm
matchlen_match1_match_nolit_encodeSnappyBlockAsm:
- CMPL SI, $0x01
- JB match_nolit_end_encodeSnappyBlockAsm
MOVB (DI)(R9*1), R8
CMPB (BX)(R9*1), R8
JNE match_nolit_end_encodeSnappyBlockAsm
@@ -11469,7 +11462,6 @@ matchlen_loop_repeat_extend_encodeSnappyBlockAsm64K:
LEAL 8(R10), R10
CMPL DI, $0x08
JAE matchlen_loopback_repeat_extend_encodeSnappyBlockAsm64K
- JZ repeat_extend_forward_end_encodeSnappyBlockAsm64K
matchlen_match4_repeat_extend_encodeSnappyBlockAsm64K:
CMPL DI, $0x04
@@ -11477,21 +11469,21 @@ matchlen_match4_repeat_extend_encodeSnappyBlockAsm64K:
MOVL (R8)(R10*1), R9
CMPL (BX)(R10*1), R9
JNE matchlen_match2_repeat_extend_encodeSnappyBlockAsm64K
- SUBL $0x04, DI
+ LEAL -4(DI), DI
LEAL 4(R10), R10
matchlen_match2_repeat_extend_encodeSnappyBlockAsm64K:
- CMPL DI, $0x02
- JB matchlen_match1_repeat_extend_encodeSnappyBlockAsm64K
+ CMPL DI, $0x01
+ JE matchlen_match1_repeat_extend_encodeSnappyBlockAsm64K
+ JB repeat_extend_forward_end_encodeSnappyBlockAsm64K
MOVW (R8)(R10*1), R9
CMPW (BX)(R10*1), R9
JNE matchlen_match1_repeat_extend_encodeSnappyBlockAsm64K
- SUBL $0x02, DI
LEAL 2(R10), R10
+ SUBL $0x02, DI
+ JZ repeat_extend_forward_end_encodeSnappyBlockAsm64K
matchlen_match1_repeat_extend_encodeSnappyBlockAsm64K:
- CMPL DI, $0x01
- JB repeat_extend_forward_end_encodeSnappyBlockAsm64K
MOVB (R8)(R10*1), R9
CMPB (BX)(R10*1), R9
JNE repeat_extend_forward_end_encodeSnappyBlockAsm64K
@@ -11752,7 +11744,6 @@ matchlen_loop_match_nolit_encodeSnappyBlockAsm64K:
LEAL 8(R9), R9
CMPL SI, $0x08
JAE matchlen_loopback_match_nolit_encodeSnappyBlockAsm64K
- JZ match_nolit_end_encodeSnappyBlockAsm64K
matchlen_match4_match_nolit_encodeSnappyBlockAsm64K:
CMPL SI, $0x04
@@ -11760,21 +11751,21 @@ matchlen_match4_match_nolit_encodeSnappyBlockAsm64K:
MOVL (DI)(R9*1), R8
CMPL (BX)(R9*1), R8
JNE matchlen_match2_match_nolit_encodeSnappyBlockAsm64K
- SUBL $0x04, SI
+ LEAL -4(SI), SI
LEAL 4(R9), R9
matchlen_match2_match_nolit_encodeSnappyBlockAsm64K:
- CMPL SI, $0x02
- JB matchlen_match1_match_nolit_encodeSnappyBlockAsm64K
+ CMPL SI, $0x01
+ JE matchlen_match1_match_nolit_encodeSnappyBlockAsm64K
+ JB match_nolit_end_encodeSnappyBlockAsm64K
MOVW (DI)(R9*1), R8
CMPW (BX)(R9*1), R8
JNE matchlen_match1_match_nolit_encodeSnappyBlockAsm64K
- SUBL $0x02, SI
LEAL 2(R9), R9
+ SUBL $0x02, SI
+ JZ match_nolit_end_encodeSnappyBlockAsm64K
matchlen_match1_match_nolit_encodeSnappyBlockAsm64K:
- CMPL SI, $0x01
- JB match_nolit_end_encodeSnappyBlockAsm64K
MOVB (DI)(R9*1), R8
CMPB (BX)(R9*1), R8
JNE match_nolit_end_encodeSnappyBlockAsm64K
@@ -12253,7 +12244,6 @@ matchlen_loop_repeat_extend_encodeSnappyBlockAsm12B:
LEAL 8(R10), R10
CMPL DI, $0x08
JAE matchlen_loopback_repeat_extend_encodeSnappyBlockAsm12B
- JZ repeat_extend_forward_end_encodeSnappyBlockAsm12B
matchlen_match4_repeat_extend_encodeSnappyBlockAsm12B:
CMPL DI, $0x04
@@ -12261,21 +12251,21 @@ matchlen_match4_repeat_extend_encodeSnappyBlockAsm12B:
MOVL (R8)(R10*1), R9
CMPL (BX)(R10*1), R9
JNE matchlen_match2_repeat_extend_encodeSnappyBlockAsm12B
- SUBL $0x04, DI
+ LEAL -4(DI), DI
LEAL 4(R10), R10
matchlen_match2_repeat_extend_encodeSnappyBlockAsm12B:
- CMPL DI, $0x02
- JB matchlen_match1_repeat_extend_encodeSnappyBlockAsm12B
+ CMPL DI, $0x01
+ JE matchlen_match1_repeat_extend_encodeSnappyBlockAsm12B
+ JB repeat_extend_forward_end_encodeSnappyBlockAsm12B
MOVW (R8)(R10*1), R9
CMPW (BX)(R10*1), R9
JNE matchlen_match1_repeat_extend_encodeSnappyBlockAsm12B
- SUBL $0x02, DI
LEAL 2(R10), R10
+ SUBL $0x02, DI
+ JZ repeat_extend_forward_end_encodeSnappyBlockAsm12B
matchlen_match1_repeat_extend_encodeSnappyBlockAsm12B:
- CMPL DI, $0x01
- JB repeat_extend_forward_end_encodeSnappyBlockAsm12B
MOVB (R8)(R10*1), R9
CMPB (BX)(R10*1), R9
JNE repeat_extend_forward_end_encodeSnappyBlockAsm12B
@@ -12536,7 +12526,6 @@ matchlen_loop_match_nolit_encodeSnappyBlockAsm12B:
LEAL 8(R9), R9
CMPL SI, $0x08
JAE matchlen_loopback_match_nolit_encodeSnappyBlockAsm12B
- JZ match_nolit_end_encodeSnappyBlockAsm12B
matchlen_match4_match_nolit_encodeSnappyBlockAsm12B:
CMPL SI, $0x04
@@ -12544,21 +12533,21 @@ matchlen_match4_match_nolit_encodeSnappyBlockAsm12B:
MOVL (DI)(R9*1), R8
CMPL (BX)(R9*1), R8
JNE matchlen_match2_match_nolit_encodeSnappyBlockAsm12B
- SUBL $0x04, SI
+ LEAL -4(SI), SI
LEAL 4(R9), R9
matchlen_match2_match_nolit_encodeSnappyBlockAsm12B:
- CMPL SI, $0x02
- JB matchlen_match1_match_nolit_encodeSnappyBlockAsm12B
+ CMPL SI, $0x01
+ JE matchlen_match1_match_nolit_encodeSnappyBlockAsm12B
+ JB match_nolit_end_encodeSnappyBlockAsm12B
MOVW (DI)(R9*1), R8
CMPW (BX)(R9*1), R8
JNE matchlen_match1_match_nolit_encodeSnappyBlockAsm12B
- SUBL $0x02, SI
LEAL 2(R9), R9
+ SUBL $0x02, SI
+ JZ match_nolit_end_encodeSnappyBlockAsm12B
matchlen_match1_match_nolit_encodeSnappyBlockAsm12B:
- CMPL SI, $0x01
- JB match_nolit_end_encodeSnappyBlockAsm12B
MOVB (DI)(R9*1), R8
CMPB (BX)(R9*1), R8
JNE match_nolit_end_encodeSnappyBlockAsm12B
@@ -13037,7 +13026,6 @@ matchlen_loop_repeat_extend_encodeSnappyBlockAsm10B:
LEAL 8(R10), R10
CMPL DI, $0x08
JAE matchlen_loopback_repeat_extend_encodeSnappyBlockAsm10B
- JZ repeat_extend_forward_end_encodeSnappyBlockAsm10B
matchlen_match4_repeat_extend_encodeSnappyBlockAsm10B:
CMPL DI, $0x04
@@ -13045,21 +13033,21 @@ matchlen_match4_repeat_extend_encodeSnappyBlockAsm10B:
MOVL (R8)(R10*1), R9
CMPL (BX)(R10*1), R9
JNE matchlen_match2_repeat_extend_encodeSnappyBlockAsm10B
- SUBL $0x04, DI
+ LEAL -4(DI), DI
LEAL 4(R10), R10
matchlen_match2_repeat_extend_encodeSnappyBlockAsm10B:
- CMPL DI, $0x02
- JB matchlen_match1_repeat_extend_encodeSnappyBlockAsm10B
+ CMPL DI, $0x01
+ JE matchlen_match1_repeat_extend_encodeSnappyBlockAsm10B
+ JB repeat_extend_forward_end_encodeSnappyBlockAsm10B
MOVW (R8)(R10*1), R9
CMPW (BX)(R10*1), R9
JNE matchlen_match1_repeat_extend_encodeSnappyBlockAsm10B
- SUBL $0x02, DI
LEAL 2(R10), R10
+ SUBL $0x02, DI
+ JZ repeat_extend_forward_end_encodeSnappyBlockAsm10B
matchlen_match1_repeat_extend_encodeSnappyBlockAsm10B:
- CMPL DI, $0x01
- JB repeat_extend_forward_end_encodeSnappyBlockAsm10B
MOVB (R8)(R10*1), R9
CMPB (BX)(R10*1), R9
JNE repeat_extend_forward_end_encodeSnappyBlockAsm10B
@@ -13320,7 +13308,6 @@ matchlen_loop_match_nolit_encodeSnappyBlockAsm10B:
LEAL 8(R9), R9
CMPL SI, $0x08
JAE matchlen_loopback_match_nolit_encodeSnappyBlockAsm10B
- JZ match_nolit_end_encodeSnappyBlockAsm10B
matchlen_match4_match_nolit_encodeSnappyBlockAsm10B:
CMPL SI, $0x04
@@ -13328,21 +13315,21 @@ matchlen_match4_match_nolit_encodeSnappyBlockAsm10B:
MOVL (DI)(R9*1), R8
CMPL (BX)(R9*1), R8
JNE matchlen_match2_match_nolit_encodeSnappyBlockAsm10B
- SUBL $0x04, SI
+ LEAL -4(SI), SI
LEAL 4(R9), R9
matchlen_match2_match_nolit_encodeSnappyBlockAsm10B:
- CMPL SI, $0x02
- JB matchlen_match1_match_nolit_encodeSnappyBlockAsm10B
+ CMPL SI, $0x01
+ JE matchlen_match1_match_nolit_encodeSnappyBlockAsm10B
+ JB match_nolit_end_encodeSnappyBlockAsm10B
MOVW (DI)(R9*1), R8
CMPW (BX)(R9*1), R8
JNE matchlen_match1_match_nolit_encodeSnappyBlockAsm10B
- SUBL $0x02, SI
LEAL 2(R9), R9
+ SUBL $0x02, SI
+ JZ match_nolit_end_encodeSnappyBlockAsm10B
matchlen_match1_match_nolit_encodeSnappyBlockAsm10B:
- CMPL SI, $0x01
- JB match_nolit_end_encodeSnappyBlockAsm10B
MOVB (DI)(R9*1), R8
CMPB (BX)(R9*1), R8
JNE match_nolit_end_encodeSnappyBlockAsm10B
@@ -13821,7 +13808,6 @@ matchlen_loop_repeat_extend_encodeSnappyBlockAsm8B:
LEAL 8(R10), R10
CMPL DI, $0x08
JAE matchlen_loopback_repeat_extend_encodeSnappyBlockAsm8B
- JZ repeat_extend_forward_end_encodeSnappyBlockAsm8B
matchlen_match4_repeat_extend_encodeSnappyBlockAsm8B:
CMPL DI, $0x04
@@ -13829,21 +13815,21 @@ matchlen_match4_repeat_extend_encodeSnappyBlockAsm8B:
MOVL (R8)(R10*1), R9
CMPL (BX)(R10*1), R9
JNE matchlen_match2_repeat_extend_encodeSnappyBlockAsm8B
- SUBL $0x04, DI
+ LEAL -4(DI), DI
LEAL 4(R10), R10
matchlen_match2_repeat_extend_encodeSnappyBlockAsm8B:
- CMPL DI, $0x02
- JB matchlen_match1_repeat_extend_encodeSnappyBlockAsm8B
+ CMPL DI, $0x01
+ JE matchlen_match1_repeat_extend_encodeSnappyBlockAsm8B
+ JB repeat_extend_forward_end_encodeSnappyBlockAsm8B
MOVW (R8)(R10*1), R9
CMPW (BX)(R10*1), R9
JNE matchlen_match1_repeat_extend_encodeSnappyBlockAsm8B
- SUBL $0x02, DI
LEAL 2(R10), R10
+ SUBL $0x02, DI
+ JZ repeat_extend_forward_end_encodeSnappyBlockAsm8B
matchlen_match1_repeat_extend_encodeSnappyBlockAsm8B:
- CMPL DI, $0x01
- JB repeat_extend_forward_end_encodeSnappyBlockAsm8B
MOVB (R8)(R10*1), R9
CMPB (BX)(R10*1), R9
JNE repeat_extend_forward_end_encodeSnappyBlockAsm8B
@@ -14102,7 +14088,6 @@ matchlen_loop_match_nolit_encodeSnappyBlockAsm8B:
LEAL 8(R9), R9
CMPL SI, $0x08
JAE matchlen_loopback_match_nolit_encodeSnappyBlockAsm8B
- JZ match_nolit_end_encodeSnappyBlockAsm8B
matchlen_match4_match_nolit_encodeSnappyBlockAsm8B:
CMPL SI, $0x04
@@ -14110,21 +14095,21 @@ matchlen_match4_match_nolit_encodeSnappyBlockAsm8B:
MOVL (DI)(R9*1), R8
CMPL (BX)(R9*1), R8
JNE matchlen_match2_match_nolit_encodeSnappyBlockAsm8B
- SUBL $0x04, SI
+ LEAL -4(SI), SI
LEAL 4(R9), R9
matchlen_match2_match_nolit_encodeSnappyBlockAsm8B:
- CMPL SI, $0x02
- JB matchlen_match1_match_nolit_encodeSnappyBlockAsm8B
+ CMPL SI, $0x01
+ JE matchlen_match1_match_nolit_encodeSnappyBlockAsm8B
+ JB match_nolit_end_encodeSnappyBlockAsm8B
MOVW (DI)(R9*1), R8
CMPW (BX)(R9*1), R8
JNE matchlen_match1_match_nolit_encodeSnappyBlockAsm8B
- SUBL $0x02, SI
LEAL 2(R9), R9
+ SUBL $0x02, SI
+ JZ match_nolit_end_encodeSnappyBlockAsm8B
matchlen_match1_match_nolit_encodeSnappyBlockAsm8B:
- CMPL SI, $0x01
- JB match_nolit_end_encodeSnappyBlockAsm8B
MOVB (DI)(R9*1), R8
CMPB (BX)(R9*1), R8
JNE match_nolit_end_encodeSnappyBlockAsm8B
@@ -14513,7 +14498,6 @@ matchlen_loop_match_nolit_encodeSnappyBetterBlockAsm:
LEAL 8(R11), R11
CMPL DI, $0x08
JAE matchlen_loopback_match_nolit_encodeSnappyBetterBlockAsm
- JZ match_nolit_end_encodeSnappyBetterBlockAsm
matchlen_match4_match_nolit_encodeSnappyBetterBlockAsm:
CMPL DI, $0x04
@@ -14521,21 +14505,21 @@ matchlen_match4_match_nolit_encodeSnappyBetterBlockAsm:
MOVL (R8)(R11*1), R10
CMPL (R9)(R11*1), R10
JNE matchlen_match2_match_nolit_encodeSnappyBetterBlockAsm
- SUBL $0x04, DI
+ LEAL -4(DI), DI
LEAL 4(R11), R11
matchlen_match2_match_nolit_encodeSnappyBetterBlockAsm:
- CMPL DI, $0x02
- JB matchlen_match1_match_nolit_encodeSnappyBetterBlockAsm
+ CMPL DI, $0x01
+ JE matchlen_match1_match_nolit_encodeSnappyBetterBlockAsm
+ JB match_nolit_end_encodeSnappyBetterBlockAsm
MOVW (R8)(R11*1), R10
CMPW (R9)(R11*1), R10
JNE matchlen_match1_match_nolit_encodeSnappyBetterBlockAsm
- SUBL $0x02, DI
LEAL 2(R11), R11
+ SUBL $0x02, DI
+ JZ match_nolit_end_encodeSnappyBetterBlockAsm
matchlen_match1_match_nolit_encodeSnappyBetterBlockAsm:
- CMPL DI, $0x01
- JB match_nolit_end_encodeSnappyBetterBlockAsm
MOVB (R8)(R11*1), R10
CMPB (R9)(R11*1), R10
JNE match_nolit_end_encodeSnappyBetterBlockAsm
@@ -14790,24 +14774,26 @@ match_nolit_dst_ok_encodeSnappyBetterBlockAsm:
MOVL R8, 24(SP)(R11*4)
MOVL DI, 524312(SP)(R10*4)
MOVL R13, 524312(SP)(R12*4)
+ LEAQ 1(R8)(SI*1), DI
+ SHRQ $0x01, DI
ADDQ $0x01, SI
SUBQ $0x01, R8
index_loop_encodeSnappyBetterBlockAsm:
- CMPQ SI, R8
+ CMPQ DI, R8
JAE search_loop_encodeSnappyBetterBlockAsm
- MOVQ (DX)(SI*1), DI
- MOVQ (DX)(R8*1), R9
- SHLQ $0x08, DI
- IMULQ BX, DI
- SHRQ $0x2f, DI
+ MOVQ (DX)(SI*1), R9
+ MOVQ (DX)(DI*1), R10
SHLQ $0x08, R9
IMULQ BX, R9
SHRQ $0x2f, R9
- MOVL SI, 24(SP)(DI*4)
- MOVL R8, 24(SP)(R9*4)
+ SHLQ $0x08, R10
+ IMULQ BX, R10
+ SHRQ $0x2f, R10
+ MOVL SI, 24(SP)(R9*4)
+ MOVL DI, 24(SP)(R10*4)
ADDQ $0x02, SI
- SUBQ $0x02, R8
+ ADDQ $0x02, DI
JMP index_loop_encodeSnappyBetterBlockAsm
emit_remainder_encodeSnappyBetterBlockAsm:
@@ -15135,7 +15121,6 @@ matchlen_loop_match_nolit_encodeSnappyBetterBlockAsm64K:
LEAL 8(R11), R11
CMPL DI, $0x08
JAE matchlen_loopback_match_nolit_encodeSnappyBetterBlockAsm64K
- JZ match_nolit_end_encodeSnappyBetterBlockAsm64K
matchlen_match4_match_nolit_encodeSnappyBetterBlockAsm64K:
CMPL DI, $0x04
@@ -15143,21 +15128,21 @@ matchlen_match4_match_nolit_encodeSnappyBetterBlockAsm64K:
MOVL (R8)(R11*1), R10
CMPL (R9)(R11*1), R10
JNE matchlen_match2_match_nolit_encodeSnappyBetterBlockAsm64K
- SUBL $0x04, DI
+ LEAL -4(DI), DI
LEAL 4(R11), R11
matchlen_match2_match_nolit_encodeSnappyBetterBlockAsm64K:
- CMPL DI, $0x02
- JB matchlen_match1_match_nolit_encodeSnappyBetterBlockAsm64K
+ CMPL DI, $0x01
+ JE matchlen_match1_match_nolit_encodeSnappyBetterBlockAsm64K
+ JB match_nolit_end_encodeSnappyBetterBlockAsm64K
MOVW (R8)(R11*1), R10
CMPW (R9)(R11*1), R10
JNE matchlen_match1_match_nolit_encodeSnappyBetterBlockAsm64K
- SUBL $0x02, DI
LEAL 2(R11), R11
+ SUBL $0x02, DI
+ JZ match_nolit_end_encodeSnappyBetterBlockAsm64K
matchlen_match1_match_nolit_encodeSnappyBetterBlockAsm64K:
- CMPL DI, $0x01
- JB match_nolit_end_encodeSnappyBetterBlockAsm64K
MOVB (R8)(R11*1), R10
CMPB (R9)(R11*1), R10
JNE match_nolit_end_encodeSnappyBetterBlockAsm64K
@@ -15363,24 +15348,26 @@ match_nolit_dst_ok_encodeSnappyBetterBlockAsm64K:
MOVL R8, 24(SP)(R11*4)
MOVL DI, 262168(SP)(R10*4)
MOVL R13, 262168(SP)(R12*4)
+ LEAQ 1(R8)(SI*1), DI
+ SHRQ $0x01, DI
ADDQ $0x01, SI
SUBQ $0x01, R8
index_loop_encodeSnappyBetterBlockAsm64K:
- CMPQ SI, R8
+ CMPQ DI, R8
JAE search_loop_encodeSnappyBetterBlockAsm64K
- MOVQ (DX)(SI*1), DI
- MOVQ (DX)(R8*1), R9
- SHLQ $0x08, DI
- IMULQ BX, DI
- SHRQ $0x30, DI
+ MOVQ (DX)(SI*1), R9
+ MOVQ (DX)(DI*1), R10
SHLQ $0x08, R9
IMULQ BX, R9
SHRQ $0x30, R9
- MOVL SI, 24(SP)(DI*4)
- MOVL R8, 24(SP)(R9*4)
+ SHLQ $0x08, R10
+ IMULQ BX, R10
+ SHRQ $0x30, R10
+ MOVL SI, 24(SP)(R9*4)
+ MOVL DI, 24(SP)(R10*4)
ADDQ $0x02, SI
- SUBQ $0x02, R8
+ ADDQ $0x02, DI
JMP index_loop_encodeSnappyBetterBlockAsm64K
emit_remainder_encodeSnappyBetterBlockAsm64K:
@@ -15692,7 +15679,6 @@ matchlen_loop_match_nolit_encodeSnappyBetterBlockAsm12B:
LEAL 8(R11), R11
CMPL DI, $0x08
JAE matchlen_loopback_match_nolit_encodeSnappyBetterBlockAsm12B
- JZ match_nolit_end_encodeSnappyBetterBlockAsm12B
matchlen_match4_match_nolit_encodeSnappyBetterBlockAsm12B:
CMPL DI, $0x04
@@ -15700,21 +15686,21 @@ matchlen_match4_match_nolit_encodeSnappyBetterBlockAsm12B:
MOVL (R8)(R11*1), R10
CMPL (R9)(R11*1), R10
JNE matchlen_match2_match_nolit_encodeSnappyBetterBlockAsm12B
- SUBL $0x04, DI
+ LEAL -4(DI), DI
LEAL 4(R11), R11
matchlen_match2_match_nolit_encodeSnappyBetterBlockAsm12B:
- CMPL DI, $0x02
- JB matchlen_match1_match_nolit_encodeSnappyBetterBlockAsm12B
+ CMPL DI, $0x01
+ JE matchlen_match1_match_nolit_encodeSnappyBetterBlockAsm12B
+ JB match_nolit_end_encodeSnappyBetterBlockAsm12B
MOVW (R8)(R11*1), R10
CMPW (R9)(R11*1), R10
JNE matchlen_match1_match_nolit_encodeSnappyBetterBlockAsm12B
- SUBL $0x02, DI
LEAL 2(R11), R11
+ SUBL $0x02, DI
+ JZ match_nolit_end_encodeSnappyBetterBlockAsm12B
matchlen_match1_match_nolit_encodeSnappyBetterBlockAsm12B:
- CMPL DI, $0x01
- JB match_nolit_end_encodeSnappyBetterBlockAsm12B
MOVB (R8)(R11*1), R10
CMPB (R9)(R11*1), R10
JNE match_nolit_end_encodeSnappyBetterBlockAsm12B
@@ -15920,24 +15906,26 @@ match_nolit_dst_ok_encodeSnappyBetterBlockAsm12B:
MOVL R8, 24(SP)(R11*4)
MOVL DI, 65560(SP)(R10*4)
MOVL R13, 65560(SP)(R12*4)
+ LEAQ 1(R8)(SI*1), DI
+ SHRQ $0x01, DI
ADDQ $0x01, SI
SUBQ $0x01, R8
index_loop_encodeSnappyBetterBlockAsm12B:
- CMPQ SI, R8
+ CMPQ DI, R8
JAE search_loop_encodeSnappyBetterBlockAsm12B
- MOVQ (DX)(SI*1), DI
- MOVQ (DX)(R8*1), R9
- SHLQ $0x10, DI
- IMULQ BX, DI
- SHRQ $0x32, DI
+ MOVQ (DX)(SI*1), R9
+ MOVQ (DX)(DI*1), R10
SHLQ $0x10, R9
IMULQ BX, R9
SHRQ $0x32, R9
- MOVL SI, 24(SP)(DI*4)
- MOVL R8, 24(SP)(R9*4)
+ SHLQ $0x10, R10
+ IMULQ BX, R10
+ SHRQ $0x32, R10
+ MOVL SI, 24(SP)(R9*4)
+ MOVL DI, 24(SP)(R10*4)
ADDQ $0x02, SI
- SUBQ $0x02, R8
+ ADDQ $0x02, DI
JMP index_loop_encodeSnappyBetterBlockAsm12B
emit_remainder_encodeSnappyBetterBlockAsm12B:
@@ -16249,7 +16237,6 @@ matchlen_loop_match_nolit_encodeSnappyBetterBlockAsm10B:
LEAL 8(R11), R11
CMPL DI, $0x08
JAE matchlen_loopback_match_nolit_encodeSnappyBetterBlockAsm10B
- JZ match_nolit_end_encodeSnappyBetterBlockAsm10B
matchlen_match4_match_nolit_encodeSnappyBetterBlockAsm10B:
CMPL DI, $0x04
@@ -16257,21 +16244,21 @@ matchlen_match4_match_nolit_encodeSnappyBetterBlockAsm10B:
MOVL (R8)(R11*1), R10
CMPL (R9)(R11*1), R10
JNE matchlen_match2_match_nolit_encodeSnappyBetterBlockAsm10B
- SUBL $0x04, DI
+ LEAL -4(DI), DI
LEAL 4(R11), R11
matchlen_match2_match_nolit_encodeSnappyBetterBlockAsm10B:
- CMPL DI, $0x02
- JB matchlen_match1_match_nolit_encodeSnappyBetterBlockAsm10B
+ CMPL DI, $0x01
+ JE matchlen_match1_match_nolit_encodeSnappyBetterBlockAsm10B
+ JB match_nolit_end_encodeSnappyBetterBlockAsm10B
MOVW (R8)(R11*1), R10
CMPW (R9)(R11*1), R10
JNE matchlen_match1_match_nolit_encodeSnappyBetterBlockAsm10B
- SUBL $0x02, DI
LEAL 2(R11), R11
+ SUBL $0x02, DI
+ JZ match_nolit_end_encodeSnappyBetterBlockAsm10B
matchlen_match1_match_nolit_encodeSnappyBetterBlockAsm10B:
- CMPL DI, $0x01
- JB match_nolit_end_encodeSnappyBetterBlockAsm10B
MOVB (R8)(R11*1), R10
CMPB (R9)(R11*1), R10
JNE match_nolit_end_encodeSnappyBetterBlockAsm10B
@@ -16477,24 +16464,26 @@ match_nolit_dst_ok_encodeSnappyBetterBlockAsm10B:
MOVL R8, 24(SP)(R11*4)
MOVL DI, 16408(SP)(R10*4)
MOVL R13, 16408(SP)(R12*4)
+ LEAQ 1(R8)(SI*1), DI
+ SHRQ $0x01, DI
ADDQ $0x01, SI
SUBQ $0x01, R8
index_loop_encodeSnappyBetterBlockAsm10B:
- CMPQ SI, R8
+ CMPQ DI, R8
JAE search_loop_encodeSnappyBetterBlockAsm10B
- MOVQ (DX)(SI*1), DI
- MOVQ (DX)(R8*1), R9
- SHLQ $0x10, DI
- IMULQ BX, DI
- SHRQ $0x34, DI
+ MOVQ (DX)(SI*1), R9
+ MOVQ (DX)(DI*1), R10
SHLQ $0x10, R9
IMULQ BX, R9
SHRQ $0x34, R9
- MOVL SI, 24(SP)(DI*4)
- MOVL R8, 24(SP)(R9*4)
+ SHLQ $0x10, R10
+ IMULQ BX, R10
+ SHRQ $0x34, R10
+ MOVL SI, 24(SP)(R9*4)
+ MOVL DI, 24(SP)(R10*4)
ADDQ $0x02, SI
- SUBQ $0x02, R8
+ ADDQ $0x02, DI
JMP index_loop_encodeSnappyBetterBlockAsm10B
emit_remainder_encodeSnappyBetterBlockAsm10B:
@@ -16806,7 +16795,6 @@ matchlen_loop_match_nolit_encodeSnappyBetterBlockAsm8B:
LEAL 8(R11), R11
CMPL DI, $0x08
JAE matchlen_loopback_match_nolit_encodeSnappyBetterBlockAsm8B
- JZ match_nolit_end_encodeSnappyBetterBlockAsm8B
matchlen_match4_match_nolit_encodeSnappyBetterBlockAsm8B:
CMPL DI, $0x04
@@ -16814,21 +16802,21 @@ matchlen_match4_match_nolit_encodeSnappyBetterBlockAsm8B:
MOVL (R8)(R11*1), R10
CMPL (R9)(R11*1), R10
JNE matchlen_match2_match_nolit_encodeSnappyBetterBlockAsm8B
- SUBL $0x04, DI
+ LEAL -4(DI), DI
LEAL 4(R11), R11
matchlen_match2_match_nolit_encodeSnappyBetterBlockAsm8B:
- CMPL DI, $0x02
- JB matchlen_match1_match_nolit_encodeSnappyBetterBlockAsm8B
+ CMPL DI, $0x01
+ JE matchlen_match1_match_nolit_encodeSnappyBetterBlockAsm8B
+ JB match_nolit_end_encodeSnappyBetterBlockAsm8B
MOVW (R8)(R11*1), R10
CMPW (R9)(R11*1), R10
JNE matchlen_match1_match_nolit_encodeSnappyBetterBlockAsm8B
- SUBL $0x02, DI
LEAL 2(R11), R11
+ SUBL $0x02, DI
+ JZ match_nolit_end_encodeSnappyBetterBlockAsm8B
matchlen_match1_match_nolit_encodeSnappyBetterBlockAsm8B:
- CMPL DI, $0x01
- JB match_nolit_end_encodeSnappyBetterBlockAsm8B
MOVB (R8)(R11*1), R10
CMPB (R9)(R11*1), R10
JNE match_nolit_end_encodeSnappyBetterBlockAsm8B
@@ -17032,24 +17020,26 @@ match_nolit_dst_ok_encodeSnappyBetterBlockAsm8B:
MOVL R8, 24(SP)(R11*4)
MOVL DI, 4120(SP)(R10*4)
MOVL R13, 4120(SP)(R12*4)
+ LEAQ 1(R8)(SI*1), DI
+ SHRQ $0x01, DI
ADDQ $0x01, SI
SUBQ $0x01, R8
index_loop_encodeSnappyBetterBlockAsm8B:
- CMPQ SI, R8
+ CMPQ DI, R8
JAE search_loop_encodeSnappyBetterBlockAsm8B
- MOVQ (DX)(SI*1), DI
- MOVQ (DX)(R8*1), R9
- SHLQ $0x10, DI
- IMULQ BX, DI
- SHRQ $0x36, DI
+ MOVQ (DX)(SI*1), R9
+ MOVQ (DX)(DI*1), R10
SHLQ $0x10, R9
IMULQ BX, R9
SHRQ $0x36, R9
- MOVL SI, 24(SP)(DI*4)
- MOVL R8, 24(SP)(R9*4)
+ SHLQ $0x10, R10
+ IMULQ BX, R10
+ SHRQ $0x36, R10
+ MOVL SI, 24(SP)(R9*4)
+ MOVL DI, 24(SP)(R10*4)
ADDQ $0x02, SI
- SUBQ $0x02, R8
+ ADDQ $0x02, DI
JMP index_loop_encodeSnappyBetterBlockAsm8B
emit_remainder_encodeSnappyBetterBlockAsm8B:
@@ -17378,7 +17368,6 @@ matchlen_loop_repeat_extend_calcBlockSize:
LEAL 8(R10), R10
CMPL DI, $0x08
JAE matchlen_loopback_repeat_extend_calcBlockSize
- JZ repeat_extend_forward_end_calcBlockSize
matchlen_match4_repeat_extend_calcBlockSize:
CMPL DI, $0x04
@@ -17386,21 +17375,21 @@ matchlen_match4_repeat_extend_calcBlockSize:
MOVL (R8)(R10*1), R9
CMPL (BX)(R10*1), R9
JNE matchlen_match2_repeat_extend_calcBlockSize
- SUBL $0x04, DI
+ LEAL -4(DI), DI
LEAL 4(R10), R10
matchlen_match2_repeat_extend_calcBlockSize:
- CMPL DI, $0x02
- JB matchlen_match1_repeat_extend_calcBlockSize
+ CMPL DI, $0x01
+ JE matchlen_match1_repeat_extend_calcBlockSize
+ JB repeat_extend_forward_end_calcBlockSize
MOVW (R8)(R10*1), R9
CMPW (BX)(R10*1), R9
JNE matchlen_match1_repeat_extend_calcBlockSize
- SUBL $0x02, DI
LEAL 2(R10), R10
+ SUBL $0x02, DI
+ JZ repeat_extend_forward_end_calcBlockSize
matchlen_match1_repeat_extend_calcBlockSize:
- CMPL DI, $0x01
- JB repeat_extend_forward_end_calcBlockSize
MOVB (R8)(R10*1), R9
CMPB (BX)(R10*1), R9
JNE repeat_extend_forward_end_calcBlockSize
@@ -17590,7 +17579,6 @@ matchlen_loop_match_nolit_calcBlockSize:
LEAL 8(R9), R9
CMPL SI, $0x08
JAE matchlen_loopback_match_nolit_calcBlockSize
- JZ match_nolit_end_calcBlockSize
matchlen_match4_match_nolit_calcBlockSize:
CMPL SI, $0x04
@@ -17598,21 +17586,21 @@ matchlen_match4_match_nolit_calcBlockSize:
MOVL (DI)(R9*1), R8
CMPL (BX)(R9*1), R8
JNE matchlen_match2_match_nolit_calcBlockSize
- SUBL $0x04, SI
+ LEAL -4(SI), SI
LEAL 4(R9), R9
matchlen_match2_match_nolit_calcBlockSize:
- CMPL SI, $0x02
- JB matchlen_match1_match_nolit_calcBlockSize
+ CMPL SI, $0x01
+ JE matchlen_match1_match_nolit_calcBlockSize
+ JB match_nolit_end_calcBlockSize
MOVW (DI)(R9*1), R8
CMPW (BX)(R9*1), R8
JNE matchlen_match1_match_nolit_calcBlockSize
- SUBL $0x02, SI
LEAL 2(R9), R9
+ SUBL $0x02, SI
+ JZ match_nolit_end_calcBlockSize
matchlen_match1_match_nolit_calcBlockSize:
- CMPL SI, $0x01
- JB match_nolit_end_calcBlockSize
MOVB (DI)(R9*1), R8
CMPB (BX)(R9*1), R8
JNE match_nolit_end_calcBlockSize
@@ -17909,7 +17897,6 @@ matchlen_loop_repeat_extend_calcBlockSizeSmall:
LEAL 8(R10), R10
CMPL DI, $0x08
JAE matchlen_loopback_repeat_extend_calcBlockSizeSmall
- JZ repeat_extend_forward_end_calcBlockSizeSmall
matchlen_match4_repeat_extend_calcBlockSizeSmall:
CMPL DI, $0x04
@@ -17917,21 +17904,21 @@ matchlen_match4_repeat_extend_calcBlockSizeSmall:
MOVL (R8)(R10*1), R9
CMPL (BX)(R10*1), R9
JNE matchlen_match2_repeat_extend_calcBlockSizeSmall
- SUBL $0x04, DI
+ LEAL -4(DI), DI
LEAL 4(R10), R10
matchlen_match2_repeat_extend_calcBlockSizeSmall:
- CMPL DI, $0x02
- JB matchlen_match1_repeat_extend_calcBlockSizeSmall
+ CMPL DI, $0x01
+ JE matchlen_match1_repeat_extend_calcBlockSizeSmall
+ JB repeat_extend_forward_end_calcBlockSizeSmall
MOVW (R8)(R10*1), R9
CMPW (BX)(R10*1), R9
JNE matchlen_match1_repeat_extend_calcBlockSizeSmall
- SUBL $0x02, DI
LEAL 2(R10), R10
+ SUBL $0x02, DI
+ JZ repeat_extend_forward_end_calcBlockSizeSmall
matchlen_match1_repeat_extend_calcBlockSizeSmall:
- CMPL DI, $0x01
- JB repeat_extend_forward_end_calcBlockSizeSmall
MOVB (R8)(R10*1), R9
CMPB (BX)(R10*1), R9
JNE repeat_extend_forward_end_calcBlockSizeSmall
@@ -18091,7 +18078,6 @@ matchlen_loop_match_nolit_calcBlockSizeSmall:
LEAL 8(R9), R9
CMPL SI, $0x08
JAE matchlen_loopback_match_nolit_calcBlockSizeSmall
- JZ match_nolit_end_calcBlockSizeSmall
matchlen_match4_match_nolit_calcBlockSizeSmall:
CMPL SI, $0x04
@@ -18099,21 +18085,21 @@ matchlen_match4_match_nolit_calcBlockSizeSmall:
MOVL (DI)(R9*1), R8
CMPL (BX)(R9*1), R8
JNE matchlen_match2_match_nolit_calcBlockSizeSmall
- SUBL $0x04, SI
+ LEAL -4(SI), SI
LEAL 4(R9), R9
matchlen_match2_match_nolit_calcBlockSizeSmall:
- CMPL SI, $0x02
- JB matchlen_match1_match_nolit_calcBlockSizeSmall
+ CMPL SI, $0x01
+ JE matchlen_match1_match_nolit_calcBlockSizeSmall
+ JB match_nolit_end_calcBlockSizeSmall
MOVW (DI)(R9*1), R8
CMPW (BX)(R9*1), R8
JNE matchlen_match1_match_nolit_calcBlockSizeSmall
- SUBL $0x02, SI
LEAL 2(R9), R9
+ SUBL $0x02, SI
+ JZ match_nolit_end_calcBlockSizeSmall
matchlen_match1_match_nolit_calcBlockSizeSmall:
- CMPL SI, $0x01
- JB match_nolit_end_calcBlockSizeSmall
MOVB (DI)(R9*1), R8
CMPB (BX)(R9*1), R8
JNE match_nolit_end_calcBlockSizeSmall
@@ -18879,7 +18865,6 @@ matchlen_loop_standalone:
LEAL 8(SI), SI
CMPL DX, $0x08
JAE matchlen_loopback_standalone
- JZ gen_match_len_end
matchlen_match4_standalone:
CMPL DX, $0x04
@@ -18887,21 +18872,21 @@ matchlen_match4_standalone:
MOVL (AX)(SI*1), BX
CMPL (CX)(SI*1), BX
JNE matchlen_match2_standalone
- SUBL $0x04, DX
+ LEAL -4(DX), DX
LEAL 4(SI), SI
matchlen_match2_standalone:
- CMPL DX, $0x02
- JB matchlen_match1_standalone
+ CMPL DX, $0x01
+ JE matchlen_match1_standalone
+ JB gen_match_len_end
MOVW (AX)(SI*1), BX
CMPW (CX)(SI*1), BX
JNE matchlen_match1_standalone
- SUBL $0x02, DX
LEAL 2(SI), SI
+ SUBL $0x02, DX
+ JZ gen_match_len_end
matchlen_match1_standalone:
- CMPL DX, $0x01
- JB gen_match_len_end
MOVB (AX)(SI*1), BL
CMPB (CX)(SI*1), BL
JNE gen_match_len_end
diff --git a/vendor/github.com/klauspost/compress/s2/writer.go b/vendor/github.com/klauspost/compress/s2/writer.go
index 5a944068..089cd36d 100644
--- a/vendor/github.com/klauspost/compress/s2/writer.go
+++ b/vendor/github.com/klauspost/compress/s2/writer.go
@@ -771,7 +771,7 @@ func (w *Writer) closeIndex(idx bool) ([]byte, error) {
}
var index []byte
- if w.err(nil) == nil && w.writer != nil {
+ if w.err(err) == nil && w.writer != nil {
// Create index.
if idx {
compSize := int64(-1)
diff --git a/vendor/github.com/klauspost/cpuid/v2/README.md b/vendor/github.com/klauspost/cpuid/v2/README.md
index 37b5167d..accd7aba 100644
--- a/vendor/github.com/klauspost/cpuid/v2/README.md
+++ b/vendor/github.com/klauspost/cpuid/v2/README.md
@@ -435,6 +435,7 @@ Exit Code 1
| SYSCALL | System-Call Extension (SCE): SYSCALL and SYSRET instructions. |
| SYSEE | SYSENTER and SYSEXIT instructions |
| TBM | AMD Trailing Bit Manipulation |
+| TDX_GUEST | Intel Trust Domain Extensions Guest |
| TLB_FLUSH_NESTED | AMD: Flushing includes all the nested translations for guest translations |
| TME | Intel Total Memory Encryption. The following MSRs are supported: IA32_TME_CAPABILITY, IA32_TME_ACTIVATE, IA32_TME_EXCLUDE_MASK, and IA32_TME_EXCLUDE_BASE. |
| TOPEXT | TopologyExtensions: topology extensions support. Indicates support for CPUID Fn8000_001D_EAX_x[N:0]-CPUID Fn8000_001E_EDX. |
diff --git a/vendor/github.com/klauspost/cpuid/v2/cpuid.go b/vendor/github.com/klauspost/cpuid/v2/cpuid.go
index 89a861d4..d015c744 100644
--- a/vendor/github.com/klauspost/cpuid/v2/cpuid.go
+++ b/vendor/github.com/klauspost/cpuid/v2/cpuid.go
@@ -226,6 +226,7 @@ const (
SYSCALL // System-Call Extension (SCE): SYSCALL and SYSRET instructions.
SYSEE // SYSENTER and SYSEXIT instructions
TBM // AMD Trailing Bit Manipulation
+ TDX_GUEST // Intel Trust Domain Extensions Guest
TLB_FLUSH_NESTED // AMD: Flushing includes all the nested translations for guest translations
TME // Intel Total Memory Encryption. The following MSRs are supported: IA32_TME_CAPABILITY, IA32_TME_ACTIVATE, IA32_TME_EXCLUDE_MASK, and IA32_TME_EXCLUDE_BASE.
TOPEXT // TopologyExtensions: topology extensions support. Indicates support for CPUID Fn8000_001D_EAX_x[N:0]-CPUID Fn8000_001E_EDX.
@@ -1186,13 +1187,8 @@ func support() flagSet {
fs.setIf(edx&(1<<30) != 0, IA32_CORE_CAP)
fs.setIf(edx&(1<<31) != 0, SPEC_CTRL_SSBD)
- // CPUID.(EAX=7, ECX=1).EDX
- fs.setIf(edx&(1<<4) != 0, AVXVNNIINT8)
- fs.setIf(edx&(1<<5) != 0, AVXNECONVERT)
- fs.setIf(edx&(1<<14) != 0, PREFETCHI)
-
// CPUID.(EAX=7, ECX=1).EAX
- eax1, _, _, _ := cpuidex(7, 1)
+ eax1, _, _, edx1 := cpuidex(7, 1)
fs.setIf(fs.inSet(AVX) && eax1&(1<<4) != 0, AVXVNNI)
fs.setIf(eax1&(1<<7) != 0, CMPCCXADD)
fs.setIf(eax1&(1<<10) != 0, MOVSB_ZL)
@@ -1202,6 +1198,11 @@ func support() flagSet {
fs.setIf(eax1&(1<<23) != 0, AVXIFMA)
fs.setIf(eax1&(1<<26) != 0, LAM)
+ // CPUID.(EAX=7, ECX=1).EDX
+ fs.setIf(edx1&(1<<4) != 0, AVXVNNIINT8)
+ fs.setIf(edx1&(1<<5) != 0, AVXNECONVERT)
+ fs.setIf(edx1&(1<<14) != 0, PREFETCHI)
+
// Only detect AVX-512 features if XGETBV is supported
if c&((1<<26)|(1<<27)) == (1<<26)|(1<<27) {
// Check for OS support
@@ -1393,6 +1394,13 @@ func support() flagSet {
fs.setIf((a>>24)&1 == 1, VMSA_REGPROT)
}
+ if mfi >= 0x21 {
+ // Intel Trusted Domain Extensions Guests have their own cpuid leaf (0x21).
+ _, ebx, ecx, edx := cpuid(0x21)
+ identity := string(valAsString(ebx, edx, ecx))
+ fs.setIf(identity == "IntelTDX ", TDX_GUEST)
+ }
+
return fs
}
diff --git a/vendor/github.com/klauspost/cpuid/v2/featureid_string.go b/vendor/github.com/klauspost/cpuid/v2/featureid_string.go
index 2a27f44d..024c706a 100644
--- a/vendor/github.com/klauspost/cpuid/v2/featureid_string.go
+++ b/vendor/github.com/klauspost/cpuid/v2/featureid_string.go
@@ -166,59 +166,60 @@ func _() {
_ = x[SYSCALL-156]
_ = x[SYSEE-157]
_ = x[TBM-158]
- _ = x[TLB_FLUSH_NESTED-159]
- _ = x[TME-160]
- _ = x[TOPEXT-161]
- _ = x[TSCRATEMSR-162]
- _ = x[TSXLDTRK-163]
- _ = x[VAES-164]
- _ = x[VMCBCLEAN-165]
- _ = x[VMPL-166]
- _ = x[VMSA_REGPROT-167]
- _ = x[VMX-168]
- _ = x[VPCLMULQDQ-169]
- _ = x[VTE-170]
- _ = x[WAITPKG-171]
- _ = x[WBNOINVD-172]
- _ = x[WRMSRNS-173]
- _ = x[X87-174]
- _ = x[XGETBV1-175]
- _ = x[XOP-176]
- _ = x[XSAVE-177]
- _ = x[XSAVEC-178]
- _ = x[XSAVEOPT-179]
- _ = x[XSAVES-180]
- _ = x[AESARM-181]
- _ = x[ARMCPUID-182]
- _ = x[ASIMD-183]
- _ = x[ASIMDDP-184]
- _ = x[ASIMDHP-185]
- _ = x[ASIMDRDM-186]
- _ = x[ATOMICS-187]
- _ = x[CRC32-188]
- _ = x[DCPOP-189]
- _ = x[EVTSTRM-190]
- _ = x[FCMA-191]
- _ = x[FP-192]
- _ = x[FPHP-193]
- _ = x[GPA-194]
- _ = x[JSCVT-195]
- _ = x[LRCPC-196]
- _ = x[PMULL-197]
- _ = x[SHA1-198]
- _ = x[SHA2-199]
- _ = x[SHA3-200]
- _ = x[SHA512-201]
- _ = x[SM3-202]
- _ = x[SM4-203]
- _ = x[SVE-204]
- _ = x[lastID-205]
+ _ = x[TDX_GUEST-159]
+ _ = x[TLB_FLUSH_NESTED-160]
+ _ = x[TME-161]
+ _ = x[TOPEXT-162]
+ _ = x[TSCRATEMSR-163]
+ _ = x[TSXLDTRK-164]
+ _ = x[VAES-165]
+ _ = x[VMCBCLEAN-166]
+ _ = x[VMPL-167]
+ _ = x[VMSA_REGPROT-168]
+ _ = x[VMX-169]
+ _ = x[VPCLMULQDQ-170]
+ _ = x[VTE-171]
+ _ = x[WAITPKG-172]
+ _ = x[WBNOINVD-173]
+ _ = x[WRMSRNS-174]
+ _ = x[X87-175]
+ _ = x[XGETBV1-176]
+ _ = x[XOP-177]
+ _ = x[XSAVE-178]
+ _ = x[XSAVEC-179]
+ _ = x[XSAVEOPT-180]
+ _ = x[XSAVES-181]
+ _ = x[AESARM-182]
+ _ = x[ARMCPUID-183]
+ _ = x[ASIMD-184]
+ _ = x[ASIMDDP-185]
+ _ = x[ASIMDHP-186]
+ _ = x[ASIMDRDM-187]
+ _ = x[ATOMICS-188]
+ _ = x[CRC32-189]
+ _ = x[DCPOP-190]
+ _ = x[EVTSTRM-191]
+ _ = x[FCMA-192]
+ _ = x[FP-193]
+ _ = x[FPHP-194]
+ _ = x[GPA-195]
+ _ = x[JSCVT-196]
+ _ = x[LRCPC-197]
+ _ = x[PMULL-198]
+ _ = x[SHA1-199]
+ _ = x[SHA2-200]
+ _ = x[SHA3-201]
+ _ = x[SHA512-202]
+ _ = x[SM3-203]
+ _ = x[SM4-204]
+ _ = x[SVE-205]
+ _ = x[lastID-206]
_ = x[firstID-0]
}
-const _FeatureID_name = "firstIDADXAESNIAMD3DNOWAMD3DNOWEXTAMXBF16AMXFP16AMXINT8AMXTILEAVXAVX2AVX512BF16AVX512BITALGAVX512BWAVX512CDAVX512DQAVX512ERAVX512FAVX512FP16AVX512IFMAAVX512PFAVX512VBMIAVX512VBMI2AVX512VLAVX512VNNIAVX512VP2INTERSECTAVX512VPOPCNTDQAVXIFMAAVXNECONVERTAVXSLOWAVXVNNIAVXVNNIINT8BHI_CTRLBMI1BMI2CETIBTCETSSCLDEMOTECLMULCLZEROCMOVCMPCCXADDCMPSB_SCADBS_SHORTCMPXCHG8CPBOOSTCPPCCX16EFER_LMSLE_UNSENQCMDERMSF16CFLUSH_L1DFMA3FMA4FP128FP256FSRMFXSRFXSROPTGFNIHLEHRESETHTTHWAHYBRID_CPUHYPERVISORIA32_ARCH_CAPIA32_CORE_CAPIBPBIBRSIBRS_PREFERREDIBRS_PROVIDES_SMPIBSIBSBRNTRGTIBSFETCHSAMIBSFFVIBSOPCNTIBSOPCNTEXTIBSOPSAMIBSRDWROPCNTIBSRIPINVALIDCHKIBS_FETCH_CTLXIBS_OPDATA4IBS_OPFUSEIBS_PREVENTHOSTIBS_ZEN4IDPRED_CTRLINT_WBINVDINVLPGBLAHFLAMLBRVIRTLZCNTMCAOVERFLOWMCDT_NOMCOMMITMD_CLEARMMXMMXEXTMOVBEMOVDIR64BMOVDIRIMOVSB_ZLMOVUMPXMSRIRCMSRLISTMSR_PAGEFLUSHNRIPSNXOSXSAVEPCONFIGPOPCNTPPINPREFETCHIPSFDRDPRURDRANDRDSEEDRDTSCPRRSBA_CTRLRTMRTM_ALWAYS_ABORTSERIALIZESEVSEV_64BITSEV_ALTERNATIVESEV_DEBUGSWAPSEV_ESSEV_RESTRICTEDSEV_SNPSGXSGXLCSHASMESME_COHERENTSPEC_CTRL_SSBDSRBDS_CTRLSSESSE2SSE3SSE4SSE42SSE4ASSSE3STIBPSTIBP_ALWAYSONSTOSB_SHORTSUCCORSVMSVMDASVMFBASIDSVMLSVMNPSVMPFSVMPFTSYSCALLSYSEETBMTLB_FLUSH_NESTEDTMETOPEXTTSCRATEMSRTSXLDTRKVAESVMCBCLEANVMPLVMSA_REGPROTVMXVPCLMULQDQVTEWAITPKGWBNOINVDWRMSRNSX87XGETBV1XOPXSAVEXSAVECXSAVEOPTXSAVESAESARMARMCPUIDASIMDASIMDDPASIMDHPASIMDRDMATOMICSCRC32DCPOPEVTSTRMFCMAFPFPHPGPAJSCVTLRCPCPMULLSHA1SHA2SHA3SHA512SM3SM4SVElastID"
+const _FeatureID_name = "firstIDADXAESNIAMD3DNOWAMD3DNOWEXTAMXBF16AMXFP16AMXINT8AMXTILEAVXAVX2AVX512BF16AVX512BITALGAVX512BWAVX512CDAVX512DQAVX512ERAVX512FAVX512FP16AVX512IFMAAVX512PFAVX512VBMIAVX512VBMI2AVX512VLAVX512VNNIAVX512VP2INTERSECTAVX512VPOPCNTDQAVXIFMAAVXNECONVERTAVXSLOWAVXVNNIAVXVNNIINT8BHI_CTRLBMI1BMI2CETIBTCETSSCLDEMOTECLMULCLZEROCMOVCMPCCXADDCMPSB_SCADBS_SHORTCMPXCHG8CPBOOSTCPPCCX16EFER_LMSLE_UNSENQCMDERMSF16CFLUSH_L1DFMA3FMA4FP128FP256FSRMFXSRFXSROPTGFNIHLEHRESETHTTHWAHYBRID_CPUHYPERVISORIA32_ARCH_CAPIA32_CORE_CAPIBPBIBRSIBRS_PREFERREDIBRS_PROVIDES_SMPIBSIBSBRNTRGTIBSFETCHSAMIBSFFVIBSOPCNTIBSOPCNTEXTIBSOPSAMIBSRDWROPCNTIBSRIPINVALIDCHKIBS_FETCH_CTLXIBS_OPDATA4IBS_OPFUSEIBS_PREVENTHOSTIBS_ZEN4IDPRED_CTRLINT_WBINVDINVLPGBLAHFLAMLBRVIRTLZCNTMCAOVERFLOWMCDT_NOMCOMMITMD_CLEARMMXMMXEXTMOVBEMOVDIR64BMOVDIRIMOVSB_ZLMOVUMPXMSRIRCMSRLISTMSR_PAGEFLUSHNRIPSNXOSXSAVEPCONFIGPOPCNTPPINPREFETCHIPSFDRDPRURDRANDRDSEEDRDTSCPRRSBA_CTRLRTMRTM_ALWAYS_ABORTSERIALIZESEVSEV_64BITSEV_ALTERNATIVESEV_DEBUGSWAPSEV_ESSEV_RESTRICTEDSEV_SNPSGXSGXLCSHASMESME_COHERENTSPEC_CTRL_SSBDSRBDS_CTRLSSESSE2SSE3SSE4SSE42SSE4ASSSE3STIBPSTIBP_ALWAYSONSTOSB_SHORTSUCCORSVMSVMDASVMFBASIDSVMLSVMNPSVMPFSVMPFTSYSCALLSYSEETBMTDX_GUESTTLB_FLUSH_NESTEDTMETOPEXTTSCRATEMSRTSXLDTRKVAESVMCBCLEANVMPLVMSA_REGPROTVMXVPCLMULQDQVTEWAITPKGWBNOINVDWRMSRNSX87XGETBV1XOPXSAVEXSAVECXSAVEOPTXSAVESAESARMARMCPUIDASIMDASIMDDPASIMDHPASIMDRDMATOMICSCRC32DCPOPEVTSTRMFCMAFPFPHPGPAJSCVTLRCPCPMULLSHA1SHA2SHA3SHA512SM3SM4SVElastID"
-var _FeatureID_index = [...]uint16{0, 7, 10, 15, 23, 34, 41, 48, 55, 62, 65, 69, 79, 91, 99, 107, 115, 123, 130, 140, 150, 158, 168, 179, 187, 197, 215, 230, 237, 249, 256, 263, 274, 282, 286, 290, 296, 301, 309, 314, 320, 324, 333, 351, 359, 366, 370, 374, 388, 394, 398, 402, 411, 415, 419, 424, 429, 433, 437, 444, 448, 451, 457, 460, 463, 473, 483, 496, 509, 513, 517, 531, 548, 551, 561, 572, 578, 586, 597, 605, 617, 633, 647, 658, 668, 683, 691, 702, 712, 719, 723, 726, 733, 738, 749, 756, 763, 771, 774, 780, 785, 794, 801, 809, 813, 816, 822, 829, 842, 847, 849, 856, 863, 869, 873, 882, 886, 891, 897, 903, 909, 919, 922, 938, 947, 950, 959, 974, 987, 993, 1007, 1014, 1017, 1022, 1025, 1028, 1040, 1054, 1064, 1067, 1071, 1075, 1079, 1084, 1089, 1094, 1099, 1113, 1124, 1130, 1133, 1138, 1147, 1151, 1156, 1161, 1167, 1174, 1179, 1182, 1198, 1201, 1207, 1217, 1225, 1229, 1238, 1242, 1254, 1257, 1267, 1270, 1277, 1285, 1292, 1295, 1302, 1305, 1310, 1316, 1324, 1330, 1336, 1344, 1349, 1356, 1363, 1371, 1378, 1383, 1388, 1395, 1399, 1401, 1405, 1408, 1413, 1418, 1423, 1427, 1431, 1435, 1441, 1444, 1447, 1450, 1456}
+var _FeatureID_index = [...]uint16{0, 7, 10, 15, 23, 34, 41, 48, 55, 62, 65, 69, 79, 91, 99, 107, 115, 123, 130, 140, 150, 158, 168, 179, 187, 197, 215, 230, 237, 249, 256, 263, 274, 282, 286, 290, 296, 301, 309, 314, 320, 324, 333, 351, 359, 366, 370, 374, 388, 394, 398, 402, 411, 415, 419, 424, 429, 433, 437, 444, 448, 451, 457, 460, 463, 473, 483, 496, 509, 513, 517, 531, 548, 551, 561, 572, 578, 586, 597, 605, 617, 633, 647, 658, 668, 683, 691, 702, 712, 719, 723, 726, 733, 738, 749, 756, 763, 771, 774, 780, 785, 794, 801, 809, 813, 816, 822, 829, 842, 847, 849, 856, 863, 869, 873, 882, 886, 891, 897, 903, 909, 919, 922, 938, 947, 950, 959, 974, 987, 993, 1007, 1014, 1017, 1022, 1025, 1028, 1040, 1054, 1064, 1067, 1071, 1075, 1079, 1084, 1089, 1094, 1099, 1113, 1124, 1130, 1133, 1138, 1147, 1151, 1156, 1161, 1167, 1174, 1179, 1182, 1191, 1207, 1210, 1216, 1226, 1234, 1238, 1247, 1251, 1263, 1266, 1276, 1279, 1286, 1294, 1301, 1304, 1311, 1314, 1319, 1325, 1333, 1339, 1345, 1353, 1358, 1365, 1372, 1380, 1387, 1392, 1397, 1404, 1408, 1410, 1414, 1417, 1422, 1427, 1432, 1436, 1440, 1444, 1450, 1453, 1456, 1459, 1465}
func (i FeatureID) String() string {
if i < 0 || i >= FeatureID(len(_FeatureID_index)-1) {
diff --git a/vendor/github.com/minio/minio-go/v7/api-put-object-fan-out.go b/vendor/github.com/minio/minio-go/v7/api-put-object-fan-out.go
index 9016ec4b..0ae9142e 100644
--- a/vendor/github.com/minio/minio-go/v7/api-put-object-fan-out.go
+++ b/vendor/github.com/minio/minio-go/v7/api-put-object-fan-out.go
@@ -62,7 +62,7 @@ type PutObjectFanOutResponse struct {
ETag string `json:"etag,omitempty"`
VersionID string `json:"versionId,omitempty"`
LastModified *time.Time `json:"lastModified,omitempty"`
- Error error `json:"error,omitempty"`
+ Error string `json:"error,omitempty"`
}
// PutObjectFanOut - is a variant of PutObject instead of writing a single object from a single
diff --git a/vendor/github.com/minio/minio-go/v7/api-put-object-multipart.go b/vendor/github.com/minio/minio-go/v7/api-put-object-multipart.go
index 85d6c70a..5f117afa 100644
--- a/vendor/github.com/minio/minio-go/v7/api-put-object-multipart.go
+++ b/vendor/github.com/minio/minio-go/v7/api-put-object-multipart.go
@@ -389,8 +389,9 @@ func (c *Client) completeMultipartUpload(ctx context.Context, bucketName, object
headers := opts.Header()
if s3utils.IsAmazonEndpoint(*c.endpointURL) {
- headers.Del(encrypt.SseKmsKeyID) // Remove X-Amz-Server-Side-Encryption-Aws-Kms-Key-Id not supported in CompleteMultipartUpload
- headers.Del(encrypt.SseGenericHeader) // Remove X-Amz-Server-Side-Encryption not supported in CompleteMultipartUpload
+ headers.Del(encrypt.SseKmsKeyID) // Remove X-Amz-Server-Side-Encryption-Aws-Kms-Key-Id not supported in CompleteMultipartUpload
+ headers.Del(encrypt.SseGenericHeader) // Remove X-Amz-Server-Side-Encryption not supported in CompleteMultipartUpload
+ headers.Del(encrypt.SseEncryptionContext) // Remove X-Amz-Server-Side-Encryption-Context not supported in CompleteMultipartUpload
}
// Instantiate all the complete multipart buffer.
diff --git a/vendor/github.com/minio/minio-go/v7/api.go b/vendor/github.com/minio/minio-go/v7/api.go
index 0546b1ac..712fe2fd 100644
--- a/vendor/github.com/minio/minio-go/v7/api.go
+++ b/vendor/github.com/minio/minio-go/v7/api.go
@@ -124,7 +124,7 @@ type Options struct {
// Global constants.
const (
libraryName = "minio-go"
- libraryVersion = "v7.0.55"
+ libraryVersion = "v7.0.57"
)
// User Agent should always following the below style.
@@ -919,7 +919,7 @@ func (c *Client) makeTargetURL(bucketName, objectName, bucketLocation string, is
if h, p, err := net.SplitHostPort(host); err == nil {
if scheme == "http" && p == "80" || scheme == "https" && p == "443" {
host = h
- if ip := net.ParseIP(h); ip != nil && ip.To16() != nil {
+ if ip := net.ParseIP(h); ip != nil && ip.To4() == nil {
host = "[" + h + "]"
}
}
diff --git a/vendor/github.com/minio/minio-go/v7/functional_tests.go b/vendor/github.com/minio/minio-go/v7/functional_tests.go
index ed1b7340..2bc6b864 100644
--- a/vendor/github.com/minio/minio-go/v7/functional_tests.go
+++ b/vendor/github.com/minio/minio-go/v7/functional_tests.go
@@ -2539,13 +2539,13 @@ func testTrailingChecksums() {
test.ChecksumCRC32C = hashMultiPart(b, int(test.PO.PartSize), test.hasher)
// Set correct CRC.
- c.TraceOn(os.Stdout)
+ // c.TraceOn(os.Stderr)
resp, err := c.PutObject(context.Background(), bucketName, objectName, bytes.NewReader(b), int64(bufSize), test.PO)
if err != nil {
logError(testName, function, args, startTime, "", "PutObject failed", err)
return
}
- c.TraceOff()
+ // c.TraceOff()
cmpChecksum(resp.ChecksumSHA256, test.ChecksumSHA256)
cmpChecksum(resp.ChecksumSHA1, test.ChecksumSHA1)
cmpChecksum(resp.ChecksumCRC32, test.ChecksumCRC32)
@@ -2655,8 +2655,8 @@ func testPutObjectWithAutomaticChecksums() {
}
// Enable tracing, write to stderr.
- c.TraceOn(os.Stderr)
- defer c.TraceOff()
+ // c.TraceOn(os.Stderr)
+ // defer c.TraceOff()
for i, test := range tests {
bufSize := dataFileMap["datafile-10-kB"]
@@ -4821,6 +4821,11 @@ func testPresignedPostPolicy() {
policy.SetContentType("binary/octet-stream")
policy.SetContentLengthRange(10, 1024*1024)
policy.SetUserMetadata(metadataKey, metadataValue)
+
+ // Add CRC32C
+ checksum := minio.ChecksumCRC32C.ChecksumBytes(buf)
+ policy.SetChecksum(checksum)
+
args["policy"] = policy.String()
presignedPostPolicyURL, formData, err := c.PresignedPostPolicy(context.Background(), policy)
@@ -4888,6 +4893,7 @@ func testPresignedPostPolicy() {
Timeout: 30 * time.Second,
Transport: transport,
}
+ args["url"] = presignedPostPolicyURL.String()
req, err := http.NewRequest(http.MethodPost, presignedPostPolicyURL.String(), bytes.NewReader(formBuf.Bytes()))
if err != nil {
@@ -4920,13 +4926,21 @@ func testPresignedPostPolicy() {
expectedLocation := scheme + os.Getenv(serverEndpoint) + "/" + bucketName + "/" + objectName
expectedLocationBucketDNS := scheme + bucketName + "." + os.Getenv(serverEndpoint) + "/" + objectName
- if val, ok := res.Header["Location"]; ok {
- if val[0] != expectedLocation && val[0] != expectedLocationBucketDNS {
- logError(testName, function, args, startTime, "", "Location in header response is incorrect", err)
+ if !strings.Contains(expectedLocation, "s3.amazonaws.com/") {
+ // Test when not against AWS S3.
+ if val, ok := res.Header["Location"]; ok {
+ if val[0] != expectedLocation && val[0] != expectedLocationBucketDNS {
+ logError(testName, function, args, startTime, "", fmt.Sprintf("Location in header response is incorrect. Want %q or %q, got %q", expectedLocation, expectedLocationBucketDNS, val[0]), err)
+ return
+ }
+ } else {
+ logError(testName, function, args, startTime, "", "Location not found in header response", err)
return
}
- } else {
- logError(testName, function, args, startTime, "", "Location not found in header response", err)
+ }
+ want := checksum.Encoded()
+ if got := res.Header.Get("X-Amz-Checksum-Crc32c"); got != want {
+ logError(testName, function, args, startTime, "", fmt.Sprintf("Want checksum %q, got %q", want, got), nil)
return
}
diff --git a/vendor/github.com/prometheus/client_golang/prometheus/desc.go b/vendor/github.com/prometheus/client_golang/prometheus/desc.go
index 12331542..deedc2df 100644
--- a/vendor/github.com/prometheus/client_golang/prometheus/desc.go
+++ b/vendor/github.com/prometheus/client_golang/prometheus/desc.go
@@ -18,12 +18,12 @@ import (
"sort"
"strings"
- "github.com/prometheus/client_golang/prometheus/internal"
-
"github.com/cespare/xxhash/v2"
dto "github.com/prometheus/client_model/go"
"github.com/prometheus/common/model"
"google.golang.org/protobuf/proto"
+
+ "github.com/prometheus/client_golang/prometheus/internal"
)
// Desc is the descriptor used by every Prometheus Metric. It is essentially
diff --git a/vendor/github.com/prometheus/client_golang/prometheus/histogram.go b/vendor/github.com/prometheus/client_golang/prometheus/histogram.go
index 5b69965b..8d818afe 100644
--- a/vendor/github.com/prometheus/client_golang/prometheus/histogram.go
+++ b/vendor/github.com/prometheus/client_golang/prometheus/histogram.go
@@ -401,7 +401,7 @@ type HistogramOpts struct {
// Histogram by a Prometheus server with that feature enabled (requires
// Prometheus v2.40+). Sparse buckets are exponential buckets covering
// the whole float64 range (with the exception of the “zero” bucket, see
- // SparseBucketsZeroThreshold below). From any one bucket to the next,
+ // NativeHistogramZeroThreshold below). From any one bucket to the next,
// the width of the bucket grows by a constant
// factor. NativeHistogramBucketFactor provides an upper bound for this
// factor (exception see below). The smaller
@@ -432,7 +432,7 @@ type HistogramOpts struct {
// bucket. For best results, this should be close to a bucket
// boundary. This is usually the case if picking a power of two. If
// NativeHistogramZeroThreshold is left at zero,
- // DefSparseBucketsZeroThreshold is used as the threshold. To configure
+ // DefNativeHistogramZeroThreshold is used as the threshold. To configure
// a zero bucket with an actual threshold of zero (i.e. only
// observations of precisely zero will go into the zero bucket), set
// NativeHistogramZeroThreshold to the NativeHistogramZeroThresholdZero
@@ -639,8 +639,8 @@ func (hc *histogramCounts) observe(v float64, bucket int, doSparse bool) {
if frac == 0.5 {
key--
}
- div := 1 << -schema
- key = (key + div - 1) / div
+ offset := (1 << -schema) - 1
+ key = (key + offset) >> -schema
}
if isInf {
key++
@@ -817,7 +817,7 @@ func (h *histogram) observe(v float64, bucket int) {
}
}
-// limitSparsebuckets applies a strategy to limit the number of populated sparse
+// limitBuckets applies a strategy to limit the number of populated sparse
// buckets. It's generally best effort, and there are situations where the
// number can go higher (if even the lowest resolution isn't enough to reduce
// the number sufficiently, or if the provided counts aren't fully updated yet
diff --git a/vendor/github.com/prometheus/client_golang/prometheus/promhttp/http.go b/vendor/github.com/prometheus/client_golang/prometheus/promhttp/http.go
index a4cc9810..09b8d2fb 100644
--- a/vendor/github.com/prometheus/client_golang/prometheus/promhttp/http.go
+++ b/vendor/github.com/prometheus/client_golang/prometheus/promhttp/http.go
@@ -37,6 +37,7 @@ import (
"fmt"
"io"
"net/http"
+ "strconv"
"strings"
"sync"
"time"
@@ -47,9 +48,10 @@ import (
)
const (
- contentTypeHeader = "Content-Type"
- contentEncodingHeader = "Content-Encoding"
- acceptEncodingHeader = "Accept-Encoding"
+ contentTypeHeader = "Content-Type"
+ contentEncodingHeader = "Content-Encoding"
+ acceptEncodingHeader = "Accept-Encoding"
+ processStartTimeHeader = "Process-Start-Time-Unix"
)
var gzipPool = sync.Pool{
@@ -121,6 +123,9 @@ func HandlerForTransactional(reg prometheus.TransactionalGatherer, opts HandlerO
}
h := http.HandlerFunc(func(rsp http.ResponseWriter, req *http.Request) {
+ if !opts.ProcessStartTime.IsZero() {
+ rsp.Header().Set(processStartTimeHeader, strconv.FormatInt(opts.ProcessStartTime.Unix(), 10))
+ }
if inFlightSem != nil {
select {
case inFlightSem <- struct{}{}: // All good, carry on.
@@ -366,6 +371,14 @@ type HandlerOpts struct {
// (which changes the identity of the resulting series on the Prometheus
// server).
EnableOpenMetrics bool
+ // ProcessStartTime allows setting process start timevalue that will be exposed
+ // with "Process-Start-Time-Unix" response header along with the metrics
+ // payload. This allow callers to have efficient transformations to cumulative
+ // counters (e.g. OpenTelemetry) or generally _created timestamp estimation per
+ // scrape target.
+ // NOTE: This feature is experimental and not covered by OpenMetrics or Prometheus
+ // exposition format.
+ ProcessStartTime time.Time
}
// gzipAccepted returns whether the client will accept gzip-encoded content.
diff --git a/vendor/github.com/prometheus/client_golang/prometheus/vec.go b/vendor/github.com/prometheus/client_golang/prometheus/vec.go
index 386fb2d2..f0d0015a 100644
--- a/vendor/github.com/prometheus/client_golang/prometheus/vec.go
+++ b/vendor/github.com/prometheus/client_golang/prometheus/vec.go
@@ -20,6 +20,24 @@ import (
"github.com/prometheus/common/model"
)
+var labelsPool = &sync.Pool{
+ New: func() interface{} {
+ return make(Labels)
+ },
+}
+
+func getLabelsFromPool() Labels {
+ return labelsPool.Get().(Labels)
+}
+
+func putLabelsToPool(labels Labels) {
+ for k := range labels {
+ delete(labels, k)
+ }
+
+ labelsPool.Put(labels)
+}
+
// MetricVec is a Collector to bundle metrics of the same name that differ in
// their label values. MetricVec is not used directly but as a building block
// for implementations of vectors of a given metric type, like GaugeVec,
@@ -93,6 +111,8 @@ func (m *MetricVec) DeleteLabelValues(lvs ...string) bool {
// there for pros and cons of the two methods.
func (m *MetricVec) Delete(labels Labels) bool {
labels = constrainLabels(m.desc, labels)
+ defer putLabelsToPool(labels)
+
h, err := m.hashLabels(labels)
if err != nil {
return false
@@ -109,6 +129,8 @@ func (m *MetricVec) Delete(labels Labels) bool {
// To match curried labels with DeletePartialMatch, it must be called on the base vector.
func (m *MetricVec) DeletePartialMatch(labels Labels) int {
labels = constrainLabels(m.desc, labels)
+ defer putLabelsToPool(labels)
+
return m.metricMap.deleteByLabels(labels, m.curry)
}
@@ -229,6 +251,8 @@ func (m *MetricVec) GetMetricWithLabelValues(lvs ...string) (Metric, error) {
// for example GaugeVec.
func (m *MetricVec) GetMetricWith(labels Labels) (Metric, error) {
labels = constrainLabels(m.desc, labels)
+ defer putLabelsToPool(labels)
+
h, err := m.hashLabels(labels)
if err != nil {
return nil, err
@@ -647,15 +671,16 @@ func inlineLabelValues(lvs []string, curry []curriedLabelValue) []string {
}
func constrainLabels(desc *Desc, labels Labels) Labels {
- constrainedValues := make(Labels, len(labels))
+ constrainedLabels := getLabelsFromPool()
for l, v := range labels {
if i, ok := indexOf(l, desc.variableLabels.labelNames()); ok {
- constrainedValues[l] = desc.variableLabels[i].Constrain(v)
- continue
+ v = desc.variableLabels[i].Constrain(v)
}
- constrainedValues[l] = v
+
+ constrainedLabels[l] = v
}
- return constrainedValues
+
+ return constrainedLabels
}
func constrainLabelValues(desc *Desc, lvs []string, curry []curriedLabelValue) []string {
diff --git a/vendor/github.com/shirou/gopsutil/v3/internal/common/sleep.go b/vendor/github.com/shirou/gopsutil/v3/internal/common/sleep.go
index 8c35b172..9bed2419 100644
--- a/vendor/github.com/shirou/gopsutil/v3/internal/common/sleep.go
+++ b/vendor/github.com/shirou/gopsutil/v3/internal/common/sleep.go
@@ -11,6 +11,9 @@ func Sleep(ctx context.Context, interval time.Duration) error {
timer := time.NewTimer(interval)
select {
case <-ctx.Done():
+ if !timer.Stop() {
+ <-timer.C
+ }
return ctx.Err()
case <-timer.C:
return nil
diff --git a/vendor/github.com/shirou/gopsutil/v3/mem/mem_linux.go b/vendor/github.com/shirou/gopsutil/v3/mem/mem_linux.go
index 56fb1cc6..059518dc 100644
--- a/vendor/github.com/shirou/gopsutil/v3/mem/mem_linux.go
+++ b/vendor/github.com/shirou/gopsutil/v3/mem/mem_linux.go
@@ -154,13 +154,13 @@ func fillFromMeminfoWithContext() (*VirtualMemoryStat, *VirtualMemoryExStat, err
return ret, retEx, err
}
retEx.Unevictable = t * 1024
- case "WriteBack":
+ case "Writeback":
t, err := strconv.ParseUint(value, 10, 64)
if err != nil {
return ret, retEx, err
}
ret.WriteBack = t * 1024
- case "WriteBackTmp":
+ case "WritebackTmp":
t, err := strconv.ParseUint(value, 10, 64)
if err != nil {
return ret, retEx, err
diff --git a/vendor/github.com/shirou/gopsutil/v3/net/net_darwin.go b/vendor/github.com/shirou/gopsutil/v3/net/net_darwin.go
index 1c8d4f4e..4d2cfbcd 100644
--- a/vendor/github.com/shirou/gopsutil/v3/net/net_darwin.go
+++ b/vendor/github.com/shirou/gopsutil/v3/net/net_darwin.go
@@ -278,7 +278,7 @@ func ConntrackStatsWithContext(ctx context.Context, percpu bool) ([]ConntrackSta
return nil, common.ErrNotImplementedError
}
-// NetProtoCounters returns network statistics for the entire system
+// ProtoCounters returns network statistics for the entire system
// If protocols is empty then all protocols are returned, otherwise
// just the protocols in the list are returned.
// Not Implemented for Darwin
diff --git a/vendor/github.com/shirou/gopsutil/v3/net/net_freebsd.go b/vendor/github.com/shirou/gopsutil/v3/net/net_freebsd.go
index 7f31851e..bf8baf09 100644
--- a/vendor/github.com/shirou/gopsutil/v3/net/net_freebsd.go
+++ b/vendor/github.com/shirou/gopsutil/v3/net/net_freebsd.go
@@ -115,7 +115,7 @@ func ConntrackStatsWithContext(ctx context.Context, percpu bool) ([]ConntrackSta
return nil, common.ErrNotImplementedError
}
-// NetProtoCounters returns network statistics for the entire system
+// ProtoCounters returns network statistics for the entire system
// If protocols is empty then all protocols are returned, otherwise
// just the protocols in the list are returned.
// Not Implemented for FreeBSD
diff --git a/vendor/github.com/shirou/gopsutil/v3/net/net_linux.go b/vendor/github.com/shirou/gopsutil/v3/net/net_linux.go
index c7cd0db1..dd62d479 100644
--- a/vendor/github.com/shirou/gopsutil/v3/net/net_linux.go
+++ b/vendor/github.com/shirou/gopsutil/v3/net/net_linux.go
@@ -157,7 +157,7 @@ var netProtocols = []string{
"udplite",
}
-// NetProtoCounters returns network statistics for the entire system
+// ProtoCounters returns network statistics for the entire system
// If protocols is empty then all protocols are returned, otherwise
// just the protocols in the list are returned.
// Available protocols:
diff --git a/vendor/github.com/shirou/gopsutil/v3/net/net_openbsd.go b/vendor/github.com/shirou/gopsutil/v3/net/net_openbsd.go
index 5f066a09..cf48f53e 100644
--- a/vendor/github.com/shirou/gopsutil/v3/net/net_openbsd.go
+++ b/vendor/github.com/shirou/gopsutil/v3/net/net_openbsd.go
@@ -164,7 +164,7 @@ func ConntrackStatsWithContext(ctx context.Context, percpu bool) ([]ConntrackSta
return nil, common.ErrNotImplementedError
}
-// NetProtoCounters returns network statistics for the entire system
+// ProtoCounters returns network statistics for the entire system
// If protocols is empty then all protocols are returned, otherwise
// just the protocols in the list are returned.
// Not Implemented for OpenBSD
diff --git a/vendor/github.com/shirou/gopsutil/v3/net/net_windows.go b/vendor/github.com/shirou/gopsutil/v3/net/net_windows.go
index 68b26bdc..5d384342 100644
--- a/vendor/github.com/shirou/gopsutil/v3/net/net_windows.go
+++ b/vendor/github.com/shirou/gopsutil/v3/net/net_windows.go
@@ -338,7 +338,7 @@ func ConntrackStatsWithContext(ctx context.Context, percpu bool) ([]ConntrackSta
return nil, common.ErrNotImplementedError
}
-// NetProtoCounters returns network statistics for the entire system
+// ProtoCounters returns network statistics for the entire system
// If protocols is empty then all protocols are returned, otherwise
// just the protocols in the list are returned.
// Not Implemented for Windows
diff --git a/vendor/github.com/shirou/gopsutil/v3/process/process.go b/vendor/github.com/shirou/gopsutil/v3/process/process.go
index 0ca26c21..1a7fe1b8 100644
--- a/vendor/github.com/shirou/gopsutil/v3/process/process.go
+++ b/vendor/github.com/shirou/gopsutil/v3/process/process.go
@@ -335,7 +335,7 @@ func (p *Process) MemoryPercentWithContext(ctx context.Context) (float32, error)
return (100 * float32(used) / float32(total)), nil
}
-// CPU_Percent returns how many percent of the CPU time this process uses
+// CPUPercent returns how many percent of the CPU time this process uses
func (p *Process) CPUPercent() (float64, error) {
return p.CPUPercentWithContext(context.Background())
}
@@ -507,7 +507,7 @@ func (p *Process) MemoryInfoEx() (*MemoryInfoExStat, error) {
return p.MemoryInfoExWithContext(context.Background())
}
-// PageFaultsInfo returns the process's page fault counters.
+// PageFaults returns the process's page fault counters.
func (p *Process) PageFaults() (*PageFaultsStat, error) {
return p.PageFaultsWithContext(context.Background())
}
@@ -530,7 +530,7 @@ func (p *Process) Connections() ([]net.ConnectionStat, error) {
return p.ConnectionsWithContext(context.Background())
}
-// Connections returns a slice of net.ConnectionStat used by the process at most `max`.
+// ConnectionsMax returns a slice of net.ConnectionStat used by the process at most `max`.
func (p *Process) ConnectionsMax(max int) ([]net.ConnectionStat, error) {
return p.ConnectionsMaxWithContext(context.Background(), max)
}
diff --git a/vendor/github.com/sirupsen/logrus/writer.go b/vendor/github.com/sirupsen/logrus/writer.go
index 72e8e3a1..074fd4b8 100644
--- a/vendor/github.com/sirupsen/logrus/writer.go
+++ b/vendor/github.com/sirupsen/logrus/writer.go
@@ -4,6 +4,7 @@ import (
"bufio"
"io"
"runtime"
+ "strings"
)
// Writer at INFO level. See WriterLevel for details.
@@ -20,15 +21,18 @@ func (logger *Logger) WriterLevel(level Level) *io.PipeWriter {
return NewEntry(logger).WriterLevel(level)
}
+// Writer returns an io.Writer that writes to the logger at the info log level
func (entry *Entry) Writer() *io.PipeWriter {
return entry.WriterLevel(InfoLevel)
}
+// WriterLevel returns an io.Writer that writes to the logger at the given log level
func (entry *Entry) WriterLevel(level Level) *io.PipeWriter {
reader, writer := io.Pipe()
var printFunc func(args ...interface{})
+ // Determine which log function to use based on the specified log level
switch level {
case TraceLevel:
printFunc = entry.Trace
@@ -48,23 +52,51 @@ func (entry *Entry) WriterLevel(level Level) *io.PipeWriter {
printFunc = entry.Print
}
+ // Start a new goroutine to scan the input and write it to the logger using the specified print function.
+ // It splits the input into chunks of up to 64KB to avoid buffer overflows.
go entry.writerScanner(reader, printFunc)
+
+ // Set a finalizer function to close the writer when it is garbage collected
runtime.SetFinalizer(writer, writerFinalizer)
return writer
}
+// writerScanner scans the input from the reader and writes it to the logger
func (entry *Entry) writerScanner(reader *io.PipeReader, printFunc func(args ...interface{})) {
scanner := bufio.NewScanner(reader)
- for scanner.Scan() {
- printFunc(scanner.Text())
+
+ // Set the buffer size to the maximum token size to avoid buffer overflows
+ scanner.Buffer(make([]byte, bufio.MaxScanTokenSize), bufio.MaxScanTokenSize)
+
+ // Define a split function to split the input into chunks of up to 64KB
+ chunkSize := bufio.MaxScanTokenSize // 64KB
+ splitFunc := func(data []byte, atEOF bool) (int, []byte, error) {
+ if len(data) >= chunkSize {
+ return chunkSize, data[:chunkSize], nil
+ }
+
+ return bufio.ScanLines(data, atEOF)
}
+
+ // Use the custom split function to split the input
+ scanner.Split(splitFunc)
+
+ // Scan the input and write it to the logger using the specified print function
+ for scanner.Scan() {
+ printFunc(strings.TrimRight(scanner.Text(), "\r\n"))
+ }
+
+ // If there was an error while scanning the input, log an error
if err := scanner.Err(); err != nil {
entry.Errorf("Error while reading from Writer: %s", err)
}
+
+ // Close the reader when we are done
reader.Close()
}
+// WriterFinalizer is a finalizer function that closes then given writer when it is garbage collected
func writerFinalizer(writer *io.PipeWriter) {
writer.Close()
}
diff --git a/vendor/github.com/tklauser/numcpus/.cirrus.yml b/vendor/github.com/tklauser/numcpus/.cirrus.yml
index 53c0110b..69c6ced5 100644
--- a/vendor/github.com/tklauser/numcpus/.cirrus.yml
+++ b/vendor/github.com/tklauser/numcpus/.cirrus.yml
@@ -1,6 +1,6 @@
env:
CIRRUS_CLONE_DEPTH: 1
- GO_VERSION: go1.19.1
+ GO_VERSION: go1.20
freebsd_12_task:
freebsd_instance:
diff --git a/vendor/github.com/urfave/cli/v2/app.go b/vendor/github.com/urfave/cli/v2/app.go
index 4b6675a2..19b76c9b 100644
--- a/vendor/github.com/urfave/cli/v2/app.go
+++ b/vendor/github.com/urfave/cli/v2/app.go
@@ -332,11 +332,18 @@ func (a *App) RunContext(ctx context.Context, arguments []string) (err error) {
return a.rootCommand.Run(cCtx, arguments...)
}
-// This is a stub function to keep public API unchanged from old code
-//
-// Deprecated: use App.Run or App.RunContext
+// RunAsSubcommand is for legacy/compatibility purposes only. New code should only
+// use App.RunContext. This function is slated to be removed in v3.
func (a *App) RunAsSubcommand(ctx *Context) (err error) {
- return a.RunContext(ctx.Context, ctx.Args().Slice())
+ a.Setup()
+
+ cCtx := NewContext(a, nil, ctx)
+ cCtx.shellComplete = ctx.shellComplete
+
+ a.rootCommand = a.newRootCommand()
+ cCtx.Command = a.rootCommand
+
+ return a.rootCommand.Run(cCtx, ctx.Args().Slice()...)
}
func (a *App) suggestFlagFromError(err error, command string) (string, error) {
diff --git a/vendor/github.com/urfave/cli/v2/command.go b/vendor/github.com/urfave/cli/v2/command.go
index f978b4a4..69a0fdf6 100644
--- a/vendor/github.com/urfave/cli/v2/command.go
+++ b/vendor/github.com/urfave/cli/v2/command.go
@@ -135,6 +135,7 @@ func (c *Command) setup(ctx *Context) {
if scmd.HelpName == "" {
scmd.HelpName = fmt.Sprintf("%s %s", c.HelpName, scmd.Name)
}
+ scmd.separator = c.separator
newCmds = append(newCmds, scmd)
}
c.Subcommands = newCmds
diff --git a/vendor/github.com/urfave/cli/v2/context.go b/vendor/github.com/urfave/cli/v2/context.go
index dbf50e49..a45c120b 100644
--- a/vendor/github.com/urfave/cli/v2/context.go
+++ b/vendor/github.com/urfave/cli/v2/context.go
@@ -56,6 +56,7 @@ func (cCtx *Context) Set(name, value string) error {
// IsSet determines if the flag was actually set
func (cCtx *Context) IsSet(name string) bool {
+
if fs := cCtx.lookupFlagSet(name); fs != nil {
isSet := false
fs.Visit(func(f *flag.Flag) {
@@ -72,7 +73,23 @@ func (cCtx *Context) IsSet(name string) bool {
return false
}
- return f.IsSet()
+ if f.IsSet() {
+ return true
+ }
+
+ // now redo flagset search on aliases
+ aliases := f.Names()
+ fs.Visit(func(f *flag.Flag) {
+ for _, alias := range aliases {
+ if f.Name == alias {
+ isSet = true
+ }
+ }
+ })
+
+ if isSet {
+ return true
+ }
}
return false
@@ -204,9 +221,10 @@ func (cCtx *Context) checkRequiredFlags(flags []Flag) requiredFlagsErr {
var flagPresent bool
var flagName string
- for _, key := range f.Names() {
- flagName = key
+ flagNames := f.Names()
+ flagName = flagNames[0]
+ for _, key := range flagNames {
if cCtx.IsSet(strings.TrimSpace(key)) {
flagPresent = true
}
diff --git a/vendor/github.com/urfave/cli/v2/docs.go b/vendor/github.com/urfave/cli/v2/docs.go
index 8b1c9c8a..6cd0624a 100644
--- a/vendor/github.com/urfave/cli/v2/docs.go
+++ b/vendor/github.com/urfave/cli/v2/docs.go
@@ -153,9 +153,14 @@ func prepareFlags(
// flagDetails returns a string containing the flags metadata
func flagDetails(flag DocGenerationFlag) string {
description := flag.GetUsage()
- value := flag.GetValue()
- if value != "" {
- description += " (default: " + value + ")"
+ if flag.TakesValue() {
+ defaultText := flag.GetDefaultText()
+ if defaultText == "" {
+ defaultText = flag.GetValue()
+ }
+ if defaultText != "" {
+ description += " (default: " + defaultText + ")"
+ }
}
return ": " + description
}
diff --git a/vendor/github.com/urfave/cli/v2/flag_bool.go b/vendor/github.com/urfave/cli/v2/flag_bool.go
index f64d1cd9..369d18b7 100644
--- a/vendor/github.com/urfave/cli/v2/flag_bool.go
+++ b/vendor/github.com/urfave/cli/v2/flag_bool.go
@@ -52,7 +52,7 @@ func (b *boolValue) String() string {
func (b *boolValue) IsBoolFlag() bool { return true }
func (b *boolValue) Count() int {
- if b.count != nil {
+ if b.count != nil && *b.count > 0 {
return *b.count
}
return 0
@@ -130,6 +130,11 @@ func (f *BoolFlag) Apply(set *flag.FlagSet) error {
if count == nil {
count = new(int)
}
+
+ // since count will be incremented for each alias as well
+ // subtract number of aliases from overall count
+ *count -= len(f.Aliases)
+
if dest == nil {
dest = new(bool)
}
diff --git a/vendor/github.com/urfave/cli/v2/flag_generic.go b/vendor/github.com/urfave/cli/v2/flag_generic.go
index 4f9ac0a7..039ffdfe 100644
--- a/vendor/github.com/urfave/cli/v2/flag_generic.go
+++ b/vendor/github.com/urfave/cli/v2/flag_generic.go
@@ -117,13 +117,8 @@ func (cCtx *Context) Generic(name string) interface{} {
}
func lookupGeneric(name string, set *flag.FlagSet) interface{} {
- f := set.Lookup(name)
- if f != nil {
- parsed, err := f.Value, error(nil)
- if err != nil {
- return nil
- }
- return parsed
+ if f := set.Lookup(name); f != nil {
+ return f.Value
}
return nil
}
diff --git a/vendor/github.com/urfave/cli/v2/flag_path.go b/vendor/github.com/urfave/cli/v2/flag_path.go
index 6434d322..c4986779 100644
--- a/vendor/github.com/urfave/cli/v2/flag_path.go
+++ b/vendor/github.com/urfave/cli/v2/flag_path.go
@@ -90,13 +90,8 @@ func (cCtx *Context) Path(name string) string {
}
func lookupPath(name string, set *flag.FlagSet) string {
- f := set.Lookup(name)
- if f != nil {
- parsed, err := f.Value.String(), error(nil)
- if err != nil {
- return ""
- }
- return parsed
+ if f := set.Lookup(name); f != nil {
+ return f.Value.String()
}
return ""
}
diff --git a/vendor/github.com/urfave/cli/v2/flag_string.go b/vendor/github.com/urfave/cli/v2/flag_string.go
index 3050086e..4e55a2ca 100644
--- a/vendor/github.com/urfave/cli/v2/flag_string.go
+++ b/vendor/github.com/urfave/cli/v2/flag_string.go
@@ -87,10 +87,8 @@ func (cCtx *Context) String(name string) string {
}
func lookupString(name string, set *flag.FlagSet) string {
- f := set.Lookup(name)
- if f != nil {
- parsed := f.Value.String()
- return parsed
+ if f := set.Lookup(name); f != nil {
+ return f.Value.String()
}
return ""
}
diff --git a/vendor/github.com/urfave/cli/v2/godoc-current.txt b/vendor/github.com/urfave/cli/v2/godoc-current.txt
index bd5e1def..6016bd82 100644
--- a/vendor/github.com/urfave/cli/v2/godoc-current.txt
+++ b/vendor/github.com/urfave/cli/v2/godoc-current.txt
@@ -141,7 +141,7 @@ USAGE:
DESCRIPTION:
{{template "descriptionTemplate" .}}{{end}}{{if .VisibleCommands}}
-COMMANDS:{{template "visibleCommandTemplate" .}}{{end}}{{if .VisibleFlagCategories}}
+COMMANDS:{{template "visibleCommandCategoryTemplate" .}}{{end}}{{if .VisibleFlagCategories}}
OPTIONS:{{template "visibleFlagCategoryTemplate" .}}{{else if .VisibleFlags}}
@@ -357,9 +357,8 @@ func (a *App) RunAndExitOnError()
code in the cli.ExitCoder
func (a *App) RunAsSubcommand(ctx *Context) (err error)
- This is a stub function to keep public API unchanged from old code
-
- Deprecated: use App.Run or App.RunContext
+ RunAsSubcommand is for legacy/compatibility purposes only. New code should
+ only use App.RunContext. This function is slated to be removed in v3.
func (a *App) RunContext(ctx context.Context, arguments []string) (err error)
RunContext is like Run except it takes a Context that will be passed to
diff --git a/vendor/github.com/urfave/cli/v2/help.go b/vendor/github.com/urfave/cli/v2/help.go
index c7b8f55a..a71fceb7 100644
--- a/vendor/github.com/urfave/cli/v2/help.go
+++ b/vendor/github.com/urfave/cli/v2/help.go
@@ -42,6 +42,7 @@ var helpCommand = &Command{
// 3 $ app foo
// 4 $ app help foo
// 5 $ app foo help
+ // 6 $ app foo -h (with no other sub-commands nor flags defined)
// Case 4. when executing a help command set the context to parent
// to allow resolution of subsequent args. This will transform
@@ -77,6 +78,8 @@ var helpCommand = &Command{
HelpPrinter(cCtx.App.Writer, templ, cCtx.Command)
return nil
}
+
+ // Case 6, handling incorporated in the callee itself
return ShowSubcommandHelp(cCtx)
},
}
@@ -292,8 +295,12 @@ func ShowSubcommandHelp(cCtx *Context) error {
if cCtx == nil {
return nil
}
-
- HelpPrinter(cCtx.App.Writer, SubcommandHelpTemplate, cCtx.Command)
+ // use custom template when provided (fixes #1703)
+ templ := SubcommandHelpTemplate
+ if cCtx.Command != nil && cCtx.Command.CustomHelpTemplate != "" {
+ templ = cCtx.Command.CustomHelpTemplate
+ }
+ HelpPrinter(cCtx.App.Writer, templ, cCtx.Command)
return nil
}
diff --git a/vendor/github.com/urfave/cli/v2/sliceflag.go b/vendor/github.com/urfave/cli/v2/sliceflag.go
index 7dea3576..b2ca5904 100644
--- a/vendor/github.com/urfave/cli/v2/sliceflag.go
+++ b/vendor/github.com/urfave/cli/v2/sliceflag.go
@@ -1,6 +1,3 @@
-//go:build go1.18
-// +build go1.18
-
package cli
import (
diff --git a/vendor/github.com/urfave/cli/v2/sliceflag_pre18.go b/vendor/github.com/urfave/cli/v2/sliceflag_pre18.go
deleted file mode 100644
index 1173ae74..00000000
--- a/vendor/github.com/urfave/cli/v2/sliceflag_pre18.go
+++ /dev/null
@@ -1,10 +0,0 @@
-//go:build !go1.18
-// +build !go1.18
-
-package cli
-
-import (
- "flag"
-)
-
-func unwrapFlagValue(v flag.Value) flag.Value { return v }
diff --git a/vendor/github.com/urfave/cli/v2/template.go b/vendor/github.com/urfave/cli/v2/template.go
index b565ba61..da98890e 100644
--- a/vendor/github.com/urfave/cli/v2/template.go
+++ b/vendor/github.com/urfave/cli/v2/template.go
@@ -88,7 +88,7 @@ USAGE:
DESCRIPTION:
{{template "descriptionTemplate" .}}{{end}}{{if .VisibleCommands}}
-COMMANDS:{{template "visibleCommandTemplate" .}}{{end}}{{if .VisibleFlagCategories}}
+COMMANDS:{{template "visibleCommandCategoryTemplate" .}}{{end}}{{if .VisibleFlagCategories}}
OPTIONS:{{template "visibleFlagCategoryTemplate" .}}{{else if .VisibleFlags}}
diff --git a/vendor/github.com/vektah/gqlparser/v2/.go-version b/vendor/github.com/vektah/gqlparser/v2/.go-version
new file mode 100644
index 00000000..66e2ae6c
--- /dev/null
+++ b/vendor/github.com/vektah/gqlparser/v2/.go-version
@@ -0,0 +1 @@
+1.19.1
diff --git a/vendor/github.com/vektah/gqlparser/v2/.golangci.yaml b/vendor/github.com/vektah/gqlparser/v2/.golangci.yaml
new file mode 100644
index 00000000..accb83fa
--- /dev/null
+++ b/vendor/github.com/vektah/gqlparser/v2/.golangci.yaml
@@ -0,0 +1,45 @@
+run:
+ timeout: 10m
+linters:
+ disable-all: true
+ enable:
+ - ineffassign
+ - typecheck
+ - varcheck
+ - unused
+ - structcheck
+ - deadcode
+ - gosimple
+ - goimports
+ - errcheck
+ - staticcheck
+ - stylecheck
+ - gosec
+ - asciicheck
+ - bodyclose
+ - exportloopref
+ - rowserrcheck
+ - makezero
+ - durationcheck
+ - prealloc
+ - predeclared
+
+linters-settings:
+ staticcheck:
+ checks: ["S1002","S1004","S1007","S1009","S1010","S1012","S1019","S1020","S1021","S1024","S1030","SA2*","SA3*","SA4009","SA5*","SA6000","SA6001","SA6005", "-SA2002"]
+ stylecheck:
+ checks: ["-ST1003"]
+ gosec:
+ severity: "low"
+ confidence: "low"
+ excludes:
+ - G101
+ - G112
+issues:
+ exclude-rules:
+ - path: _test\.go
+ linters:
+ - errcheck
+ - gosec
+ - rowserrcheck
+ - makezero
diff --git a/vendor/github.com/vektah/gqlparser/v2/ast/path.go b/vendor/github.com/vektah/gqlparser/v2/ast/path.go
index 9af16843..be1a9e4e 100644
--- a/vendor/github.com/vektah/gqlparser/v2/ast/path.go
+++ b/vendor/github.com/vektah/gqlparser/v2/ast/path.go
@@ -60,8 +60,8 @@ func (path *Path) UnmarshalJSON(b []byte) error {
type PathIndex int
-func (_ PathIndex) isPathElement() {}
+func (PathIndex) isPathElement() {}
type PathName string
-func (_ PathName) isPathElement() {}
+func (PathName) isPathElement() {}
diff --git a/vendor/github.com/vektah/gqlparser/v2/ast/selection.go b/vendor/github.com/vektah/gqlparser/v2/ast/selection.go
index 159db844..5ef26c6a 100644
--- a/vendor/github.com/vektah/gqlparser/v2/ast/selection.go
+++ b/vendor/github.com/vektah/gqlparser/v2/ast/selection.go
@@ -34,6 +34,6 @@ type Argument struct {
Position *Position `dump:"-"`
}
-func (f *Field) ArgumentMap(vars map[string]interface{}) map[string]interface{} {
- return arg2map(f.Definition.Arguments, f.Arguments, vars)
+func (s *Field) ArgumentMap(vars map[string]interface{}) map[string]interface{} {
+ return arg2map(s.Definition.Arguments, s.Arguments, vars)
}
diff --git a/vendor/github.com/vektah/gqlparser/v2/ast/type.go b/vendor/github.com/vektah/gqlparser/v2/ast/type.go
index 9577fdb4..5f77bc7c 100644
--- a/vendor/github.com/vektah/gqlparser/v2/ast/type.go
+++ b/vendor/github.com/vektah/gqlparser/v2/ast/type.go
@@ -63,6 +63,6 @@ func (t *Type) IsCompatible(other *Type) bool {
return true
}
-func (v *Type) Dump() string {
- return v.String()
+func (t *Type) Dump() string {
+ return t.String()
}
diff --git a/vendor/github.com/vektah/gqlparser/v2/gqlerror/error.go b/vendor/github.com/vektah/gqlparser/v2/gqlerror/error.go
index 8145061a..79e9e0d1 100644
--- a/vendor/github.com/vektah/gqlparser/v2/gqlerror/error.go
+++ b/vendor/github.com/vektah/gqlparser/v2/gqlerror/error.go
@@ -9,7 +9,7 @@ import (
"github.com/vektah/gqlparser/v2/ast"
)
-// Error is the standard graphql error type described in https://facebook.github.io/graphql/draft/#sec-Errors
+// Error is the standard graphql error type described in https://spec.graphql.org/draft/#sec-Errors
type Error struct {
err error `json:"-"`
Message string `json:"message"`
@@ -107,6 +107,13 @@ func WrapPath(path ast.Path, err error) *Error {
}
}
+func Wrap(err error) *Error {
+ return &Error{
+ err: err,
+ Message: err.Error(),
+ }
+}
+
func Errorf(message string, args ...interface{}) *Error {
return &Error{
Message: fmt.Sprintf(message, args...),
diff --git a/vendor/github.com/vektah/gqlparser/v2/gqlparser.go b/vendor/github.com/vektah/gqlparser/v2/gqlparser.go
index e242a896..3a6e2d13 100644
--- a/vendor/github.com/vektah/gqlparser/v2/gqlparser.go
+++ b/vendor/github.com/vektah/gqlparser/v2/gqlparser.go
@@ -5,11 +5,21 @@ import (
"github.com/vektah/gqlparser/v2/gqlerror"
"github.com/vektah/gqlparser/v2/parser"
"github.com/vektah/gqlparser/v2/validator"
+
+ // Blank import is used to load up the validator rules.
_ "github.com/vektah/gqlparser/v2/validator/rules"
)
func LoadSchema(str ...*ast.Source) (*ast.Schema, error) {
- return validator.LoadSchema(append([]*ast.Source{validator.Prelude}, str...)...)
+ ast, err := validator.LoadSchema(append([]*ast.Source{validator.Prelude}, str...)...)
+ gqlErr, ok := err.(*gqlerror.Error)
+ if ok {
+ return ast, gqlErr
+ }
+ if err != nil {
+ return ast, gqlerror.Wrap(err)
+ }
+ return ast, nil
}
func MustLoadSchema(str ...*ast.Source) *ast.Schema {
@@ -23,11 +33,14 @@ func MustLoadSchema(str ...*ast.Source) *ast.Schema {
func LoadQuery(schema *ast.Schema, str string) (*ast.QueryDocument, gqlerror.List) {
query, err := parser.ParseQuery(&ast.Source{Input: str})
if err != nil {
- gqlErr := err.(*gqlerror.Error)
- return nil, gqlerror.List{gqlErr}
+ gqlErr, ok := err.(*gqlerror.Error)
+ if ok {
+ return nil, gqlerror.List{gqlErr}
+ }
+ return nil, gqlerror.List{gqlerror.Wrap(err)}
}
errs := validator.Validate(schema, query)
- if errs != nil {
+ if len(errs) > 0 {
return nil, errs
}
diff --git a/vendor/github.com/vektah/gqlparser/v2/lexer/lexer.go b/vendor/github.com/vektah/gqlparser/v2/lexer/lexer.go
index 25dcdcb9..8ce04fd2 100644
--- a/vendor/github.com/vektah/gqlparser/v2/lexer/lexer.go
+++ b/vendor/github.com/vektah/gqlparser/v2/lexer/lexer.go
@@ -121,7 +121,9 @@ func (s *Lexer) ReadToken() (token Token, err error) {
case '|':
return s.makeValueToken(Pipe, "")
case '#':
- s.readComment()
+ if comment, err := s.readComment(); err != nil {
+ return comment, err
+ }
return s.ReadToken()
case '_', 'a', 'b', 'c', 'd', 'e', 'f', 'g', 'h', 'i', 'j', 'k', 'l', 'm', 'n', 'o', 'p', 'q', 'r', 's', 't', 'u', 'v', 'w', 'x', 'y', 'z', 'A', 'B', 'C', 'D', 'E', 'F', 'G', 'H', 'I', 'J', 'K', 'L', 'M', 'N', 'O', 'P', 'Q', 'R', 'S', 'T', 'U', 'V', 'W', 'X', 'Y', 'Z':
@@ -254,9 +256,9 @@ func (s *Lexer) readNumber() (Token, error) {
if float {
return s.makeToken(Float)
- } else {
- return s.makeToken(Int)
}
+ return s.makeToken(Int)
+
}
// acceptByte if it matches any of given bytes, returning true if it found anything
@@ -393,8 +395,8 @@ func (s *Lexer) readString() (Token, error) {
case 't':
buf.WriteByte('\t')
default:
- s.end += 1
- s.endRunes += 1
+ s.end++
+ s.endRunes++
return s.makeError("Invalid character escape sequence: \\%s.", string(escape))
}
s.end += 2
diff --git a/vendor/github.com/vektah/gqlparser/v2/lexer/lexer_test.yml b/vendor/github.com/vektah/gqlparser/v2/lexer/lexer_test.yml
index 5c4d5f0f..d85afb41 100644
--- a/vendor/github.com/vektah/gqlparser/v2/lexer/lexer_test.yml
+++ b/vendor/github.com/vektah/gqlparser/v2/lexer/lexer_test.yml
@@ -674,7 +674,6 @@ lex reports useful unknown character error:
- name: question mark
input: "?"
error:
- message: 'Cannot parse the unexpected character "?".'
message: 'Cannot parse the unexpected character "?".'
locations: [{ line: 1, column: 1 }]
diff --git a/vendor/github.com/vektah/gqlparser/v2/parser/query.go b/vendor/github.com/vektah/gqlparser/v2/parser/query.go
index a38d982a..123423bb 100644
--- a/vendor/github.com/vektah/gqlparser/v2/parser/query.go
+++ b/vendor/github.com/vektah/gqlparser/v2/parser/query.go
@@ -3,6 +3,7 @@ package parser
import (
"github.com/vektah/gqlparser/v2/lexer"
+ //nolint:revive
. "github.com/vektah/gqlparser/v2/ast"
)
diff --git a/vendor/github.com/vektah/gqlparser/v2/parser/schema.go b/vendor/github.com/vektah/gqlparser/v2/parser/schema.go
index aec08a97..9656bcca 100644
--- a/vendor/github.com/vektah/gqlparser/v2/parser/schema.go
+++ b/vendor/github.com/vektah/gqlparser/v2/parser/schema.go
@@ -1,6 +1,7 @@
package parser
import (
+ //nolint:revive
. "github.com/vektah/gqlparser/v2/ast"
"github.com/vektah/gqlparser/v2/lexer"
)
diff --git a/vendor/github.com/vektah/gqlparser/v2/validator/prelude.go b/vendor/github.com/vektah/gqlparser/v2/validator/prelude.go
index c354ec0d..43766f22 100644
--- a/vendor/github.com/vektah/gqlparser/v2/validator/prelude.go
+++ b/vendor/github.com/vektah/gqlparser/v2/validator/prelude.go
@@ -2,6 +2,7 @@ package validator
import (
_ "embed"
+
"github.com/vektah/gqlparser/v2/ast"
)
diff --git a/vendor/github.com/vektah/gqlparser/v2/validator/prelude.graphql b/vendor/github.com/vektah/gqlparser/v2/validator/prelude.graphql
index bdca0096..e199da5d 100644
--- a/vendor/github.com/vektah/gqlparser/v2/validator/prelude.graphql
+++ b/vendor/github.com/vektah/gqlparser/v2/validator/prelude.graphql
@@ -27,6 +27,9 @@ directive @deprecated(reason: String = "No longer supported") on FIELD_DEFINITIO
"The @specifiedBy built-in directive is used within the type system definition language to provide a scalar specification URL for specifying the behavior of custom scalar types."
directive @specifiedBy(url: String!) on SCALAR
+"The @defer directive may be specified on a fragment spread to imply de-prioritization, that causes the fragment to be omitted in the initial response, and delivered as a subsequent response afterward. A query with @defer directive will cause the request to potentially return multiple responses, where non-deferred data is delivered in the initial response and data deferred delivered in a subsequent response. @include and @skip take precedence over @defer."
+directive @defer(if: Boolean = true, label: String) on FRAGMENT_SPREAD | INLINE_FRAGMENT
+
type __Schema {
description: String
types: [__Type!]!
diff --git a/vendor/github.com/vektah/gqlparser/v2/validator/rules/fields_on_correct_type.go b/vendor/github.com/vektah/gqlparser/v2/validator/rules/fields_on_correct_type.go
index aa83c696..77c3fdac 100644
--- a/vendor/github.com/vektah/gqlparser/v2/validator/rules/fields_on_correct_type.go
+++ b/vendor/github.com/vektah/gqlparser/v2/validator/rules/fields_on_correct_type.go
@@ -6,6 +6,8 @@ import (
"strings"
"github.com/vektah/gqlparser/v2/ast"
+
+ //nolint:revive // Validator rules each use dot imports for convenience.
. "github.com/vektah/gqlparser/v2/validator"
)
@@ -41,11 +43,12 @@ func getSuggestedTypeNames(walker *Walker, parent *ast.Definition, name string)
return nil
}
- var suggestedObjectTypes []string
+ possibleTypes := walker.Schema.GetPossibleTypes(parent)
+ var suggestedObjectTypes = make([]string, 0, len(possibleTypes))
var suggestedInterfaceTypes []string
interfaceUsageCount := map[string]int{}
- for _, possibleType := range walker.Schema.GetPossibleTypes(parent) {
+ for _, possibleType := range possibleTypes {
field := possibleType.Fields.ForName(name)
if field == nil {
continue
@@ -85,7 +88,7 @@ func getSuggestedFieldNames(parent *ast.Definition, name string) []string {
return nil
}
- var possibleFieldNames []string
+ var possibleFieldNames = make([]string, 0, len(parent.Fields))
for _, field := range parent.Fields {
possibleFieldNames = append(possibleFieldNames, field.Name)
}
diff --git a/vendor/github.com/vektah/gqlparser/v2/validator/rules/fragments_on_composite_types.go b/vendor/github.com/vektah/gqlparser/v2/validator/rules/fragments_on_composite_types.go
index 5215f697..81ef861b 100644
--- a/vendor/github.com/vektah/gqlparser/v2/validator/rules/fragments_on_composite_types.go
+++ b/vendor/github.com/vektah/gqlparser/v2/validator/rules/fragments_on_composite_types.go
@@ -4,6 +4,8 @@ import (
"fmt"
"github.com/vektah/gqlparser/v2/ast"
+
+ //nolint:revive // Validator rules each use dot imports for convenience.
. "github.com/vektah/gqlparser/v2/validator"
)
diff --git a/vendor/github.com/vektah/gqlparser/v2/validator/rules/known_argument_names.go b/vendor/github.com/vektah/gqlparser/v2/validator/rules/known_argument_names.go
index da5a7962..c187dabf 100644
--- a/vendor/github.com/vektah/gqlparser/v2/validator/rules/known_argument_names.go
+++ b/vendor/github.com/vektah/gqlparser/v2/validator/rules/known_argument_names.go
@@ -2,6 +2,8 @@ package validator
import (
"github.com/vektah/gqlparser/v2/ast"
+
+ //nolint:revive // Validator rules each use dot imports for convenience.
. "github.com/vektah/gqlparser/v2/validator"
)
diff --git a/vendor/github.com/vektah/gqlparser/v2/validator/rules/known_directives.go b/vendor/github.com/vektah/gqlparser/v2/validator/rules/known_directives.go
index 18fe41fd..9b5f28db 100644
--- a/vendor/github.com/vektah/gqlparser/v2/validator/rules/known_directives.go
+++ b/vendor/github.com/vektah/gqlparser/v2/validator/rules/known_directives.go
@@ -2,6 +2,8 @@ package validator
import (
"github.com/vektah/gqlparser/v2/ast"
+
+ //nolint:revive // Validator rules each use dot imports for convenience.
. "github.com/vektah/gqlparser/v2/validator"
)
@@ -12,7 +14,7 @@ func init() {
Line int
Column int
}
- var seen map[mayNotBeUsedDirective]bool = map[mayNotBeUsedDirective]bool{}
+ var seen = map[mayNotBeUsedDirective]bool{}
observers.OnDirective(func(walker *Walker, directive *ast.Directive) {
if directive.Definition == nil {
addError(
diff --git a/vendor/github.com/vektah/gqlparser/v2/validator/rules/known_fragment_names.go b/vendor/github.com/vektah/gqlparser/v2/validator/rules/known_fragment_names.go
index b7427d0d..3afd9c1c 100644
--- a/vendor/github.com/vektah/gqlparser/v2/validator/rules/known_fragment_names.go
+++ b/vendor/github.com/vektah/gqlparser/v2/validator/rules/known_fragment_names.go
@@ -2,6 +2,8 @@ package validator
import (
"github.com/vektah/gqlparser/v2/ast"
+
+ //nolint:revive // Validator rules each use dot imports for convenience.
. "github.com/vektah/gqlparser/v2/validator"
)
diff --git a/vendor/github.com/vektah/gqlparser/v2/validator/rules/known_root_type.go b/vendor/github.com/vektah/gqlparser/v2/validator/rules/known_root_type.go
index 4c60c8d8..60bc0d52 100644
--- a/vendor/github.com/vektah/gqlparser/v2/validator/rules/known_root_type.go
+++ b/vendor/github.com/vektah/gqlparser/v2/validator/rules/known_root_type.go
@@ -4,6 +4,8 @@ import (
"fmt"
"github.com/vektah/gqlparser/v2/ast"
+
+ //nolint:revive // Validator rules each use dot imports for convenience.
. "github.com/vektah/gqlparser/v2/validator"
)
diff --git a/vendor/github.com/vektah/gqlparser/v2/validator/rules/known_type_names.go b/vendor/github.com/vektah/gqlparser/v2/validator/rules/known_type_names.go
index 7abfbf62..902939d3 100644
--- a/vendor/github.com/vektah/gqlparser/v2/validator/rules/known_type_names.go
+++ b/vendor/github.com/vektah/gqlparser/v2/validator/rules/known_type_names.go
@@ -2,6 +2,8 @@ package validator
import (
"github.com/vektah/gqlparser/v2/ast"
+
+ //nolint:revive // Validator rules each use dot imports for convenience.
. "github.com/vektah/gqlparser/v2/validator"
)
diff --git a/vendor/github.com/vektah/gqlparser/v2/validator/rules/lone_anonymous_operation.go b/vendor/github.com/vektah/gqlparser/v2/validator/rules/lone_anonymous_operation.go
index d2752854..fe8bb203 100644
--- a/vendor/github.com/vektah/gqlparser/v2/validator/rules/lone_anonymous_operation.go
+++ b/vendor/github.com/vektah/gqlparser/v2/validator/rules/lone_anonymous_operation.go
@@ -2,6 +2,8 @@ package validator
import (
"github.com/vektah/gqlparser/v2/ast"
+
+ //nolint:revive // Validator rules each use dot imports for convenience.
. "github.com/vektah/gqlparser/v2/validator"
)
diff --git a/vendor/github.com/vektah/gqlparser/v2/validator/rules/no_fragment_cycles.go b/vendor/github.com/vektah/gqlparser/v2/validator/rules/no_fragment_cycles.go
index da73f349..a953174f 100644
--- a/vendor/github.com/vektah/gqlparser/v2/validator/rules/no_fragment_cycles.go
+++ b/vendor/github.com/vektah/gqlparser/v2/validator/rules/no_fragment_cycles.go
@@ -5,6 +5,8 @@ import (
"strings"
"github.com/vektah/gqlparser/v2/ast"
+
+ //nolint:revive // Validator rules each use dot imports for convenience.
. "github.com/vektah/gqlparser/v2/validator"
)
diff --git a/vendor/github.com/vektah/gqlparser/v2/validator/rules/no_undefined_variables.go b/vendor/github.com/vektah/gqlparser/v2/validator/rules/no_undefined_variables.go
index 91df727a..46c18d12 100644
--- a/vendor/github.com/vektah/gqlparser/v2/validator/rules/no_undefined_variables.go
+++ b/vendor/github.com/vektah/gqlparser/v2/validator/rules/no_undefined_variables.go
@@ -2,6 +2,8 @@ package validator
import (
"github.com/vektah/gqlparser/v2/ast"
+
+ //nolint:revive // Validator rules each use dot imports for convenience.
. "github.com/vektah/gqlparser/v2/validator"
)
diff --git a/vendor/github.com/vektah/gqlparser/v2/validator/rules/no_unused_fragments.go b/vendor/github.com/vektah/gqlparser/v2/validator/rules/no_unused_fragments.go
index dfc89672..218ffa77 100644
--- a/vendor/github.com/vektah/gqlparser/v2/validator/rules/no_unused_fragments.go
+++ b/vendor/github.com/vektah/gqlparser/v2/validator/rules/no_unused_fragments.go
@@ -2,6 +2,8 @@ package validator
import (
"github.com/vektah/gqlparser/v2/ast"
+
+ //nolint:revive // Validator rules each use dot imports for convenience.
. "github.com/vektah/gqlparser/v2/validator"
)
diff --git a/vendor/github.com/vektah/gqlparser/v2/validator/rules/no_unused_variables.go b/vendor/github.com/vektah/gqlparser/v2/validator/rules/no_unused_variables.go
index df2e5f4b..d3088109 100644
--- a/vendor/github.com/vektah/gqlparser/v2/validator/rules/no_unused_variables.go
+++ b/vendor/github.com/vektah/gqlparser/v2/validator/rules/no_unused_variables.go
@@ -2,6 +2,8 @@ package validator
import (
"github.com/vektah/gqlparser/v2/ast"
+
+ //nolint:revive // Validator rules each use dot imports for convenience.
. "github.com/vektah/gqlparser/v2/validator"
)
diff --git a/vendor/github.com/vektah/gqlparser/v2/validator/rules/overlapping_fields_can_be_merged.go b/vendor/github.com/vektah/gqlparser/v2/validator/rules/overlapping_fields_can_be_merged.go
index 38e1efa1..2ffc3dd1 100644
--- a/vendor/github.com/vektah/gqlparser/v2/validator/rules/overlapping_fields_can_be_merged.go
+++ b/vendor/github.com/vektah/gqlparser/v2/validator/rules/overlapping_fields_can_be_merged.go
@@ -6,6 +6,8 @@ import (
"reflect"
"github.com/vektah/gqlparser/v2/ast"
+
+ //nolint:revive // Validator rules each use dot imports for convenience.
. "github.com/vektah/gqlparser/v2/validator"
)
diff --git a/vendor/github.com/vektah/gqlparser/v2/validator/rules/possible_fragment_spreads.go b/vendor/github.com/vektah/gqlparser/v2/validator/rules/possible_fragment_spreads.go
index a3f795c9..bed70289 100644
--- a/vendor/github.com/vektah/gqlparser/v2/validator/rules/possible_fragment_spreads.go
+++ b/vendor/github.com/vektah/gqlparser/v2/validator/rules/possible_fragment_spreads.go
@@ -2,6 +2,8 @@ package validator
import (
"github.com/vektah/gqlparser/v2/ast"
+
+ //nolint:revive // Validator rules each use dot imports for convenience.
. "github.com/vektah/gqlparser/v2/validator"
)
diff --git a/vendor/github.com/vektah/gqlparser/v2/validator/rules/provided_required_arguments.go b/vendor/github.com/vektah/gqlparser/v2/validator/rules/provided_required_arguments.go
index d8ed6520..ab79163b 100644
--- a/vendor/github.com/vektah/gqlparser/v2/validator/rules/provided_required_arguments.go
+++ b/vendor/github.com/vektah/gqlparser/v2/validator/rules/provided_required_arguments.go
@@ -2,6 +2,8 @@ package validator
import (
"github.com/vektah/gqlparser/v2/ast"
+
+ //nolint:revive // Validator rules each use dot imports for convenience.
. "github.com/vektah/gqlparser/v2/validator"
)
diff --git a/vendor/github.com/vektah/gqlparser/v2/validator/rules/scalar_leafs.go b/vendor/github.com/vektah/gqlparser/v2/validator/rules/scalar_leafs.go
index 718bc683..605ab9e8 100644
--- a/vendor/github.com/vektah/gqlparser/v2/validator/rules/scalar_leafs.go
+++ b/vendor/github.com/vektah/gqlparser/v2/validator/rules/scalar_leafs.go
@@ -2,6 +2,8 @@ package validator
import (
"github.com/vektah/gqlparser/v2/ast"
+
+ //nolint:revive // Validator rules each use dot imports for convenience.
. "github.com/vektah/gqlparser/v2/validator"
)
diff --git a/vendor/github.com/vektah/gqlparser/v2/validator/rules/single_field_subscriptions.go b/vendor/github.com/vektah/gqlparser/v2/validator/rules/single_field_subscriptions.go
index a9e5bf63..7d4c6843 100644
--- a/vendor/github.com/vektah/gqlparser/v2/validator/rules/single_field_subscriptions.go
+++ b/vendor/github.com/vektah/gqlparser/v2/validator/rules/single_field_subscriptions.go
@@ -5,6 +5,8 @@ import (
"strings"
"github.com/vektah/gqlparser/v2/ast"
+
+ //nolint:revive // Validator rules each use dot imports for convenience.
. "github.com/vektah/gqlparser/v2/validator"
)
diff --git a/vendor/github.com/vektah/gqlparser/v2/validator/rules/unique_argument_names.go b/vendor/github.com/vektah/gqlparser/v2/validator/rules/unique_argument_names.go
index 1d9a50ab..e977d638 100644
--- a/vendor/github.com/vektah/gqlparser/v2/validator/rules/unique_argument_names.go
+++ b/vendor/github.com/vektah/gqlparser/v2/validator/rules/unique_argument_names.go
@@ -2,6 +2,8 @@ package validator
import (
"github.com/vektah/gqlparser/v2/ast"
+
+ //nolint:revive // Validator rules each use dot imports for convenience.
. "github.com/vektah/gqlparser/v2/validator"
)
diff --git a/vendor/github.com/vektah/gqlparser/v2/validator/rules/unique_directives_per_location.go b/vendor/github.com/vektah/gqlparser/v2/validator/rules/unique_directives_per_location.go
index 52dfb21e..47971ee1 100644
--- a/vendor/github.com/vektah/gqlparser/v2/validator/rules/unique_directives_per_location.go
+++ b/vendor/github.com/vektah/gqlparser/v2/validator/rules/unique_directives_per_location.go
@@ -2,6 +2,8 @@ package validator
import (
"github.com/vektah/gqlparser/v2/ast"
+
+ //nolint:revive // Validator rules each use dot imports for convenience.
. "github.com/vektah/gqlparser/v2/validator"
)
diff --git a/vendor/github.com/vektah/gqlparser/v2/validator/rules/unique_fragment_names.go b/vendor/github.com/vektah/gqlparser/v2/validator/rules/unique_fragment_names.go
index 8c348aea..2c44a437 100644
--- a/vendor/github.com/vektah/gqlparser/v2/validator/rules/unique_fragment_names.go
+++ b/vendor/github.com/vektah/gqlparser/v2/validator/rules/unique_fragment_names.go
@@ -2,6 +2,8 @@ package validator
import (
"github.com/vektah/gqlparser/v2/ast"
+
+ //nolint:revive // Validator rules each use dot imports for convenience.
. "github.com/vektah/gqlparser/v2/validator"
)
diff --git a/vendor/github.com/vektah/gqlparser/v2/validator/rules/unique_input_field_names.go b/vendor/github.com/vektah/gqlparser/v2/validator/rules/unique_input_field_names.go
index 092be671..c5fce8ff 100644
--- a/vendor/github.com/vektah/gqlparser/v2/validator/rules/unique_input_field_names.go
+++ b/vendor/github.com/vektah/gqlparser/v2/validator/rules/unique_input_field_names.go
@@ -2,6 +2,8 @@ package validator
import (
"github.com/vektah/gqlparser/v2/ast"
+
+ //nolint:revive // Validator rules each use dot imports for convenience.
. "github.com/vektah/gqlparser/v2/validator"
)
diff --git a/vendor/github.com/vektah/gqlparser/v2/validator/rules/unique_operation_names.go b/vendor/github.com/vektah/gqlparser/v2/validator/rules/unique_operation_names.go
index 4d41b60a..49ffbe47 100644
--- a/vendor/github.com/vektah/gqlparser/v2/validator/rules/unique_operation_names.go
+++ b/vendor/github.com/vektah/gqlparser/v2/validator/rules/unique_operation_names.go
@@ -2,6 +2,8 @@ package validator
import (
"github.com/vektah/gqlparser/v2/ast"
+
+ //nolint:revive // Validator rules each use dot imports for convenience.
. "github.com/vektah/gqlparser/v2/validator"
)
diff --git a/vendor/github.com/vektah/gqlparser/v2/validator/rules/unique_variable_names.go b/vendor/github.com/vektah/gqlparser/v2/validator/rules/unique_variable_names.go
index 6481ef4c..c93948c1 100644
--- a/vendor/github.com/vektah/gqlparser/v2/validator/rules/unique_variable_names.go
+++ b/vendor/github.com/vektah/gqlparser/v2/validator/rules/unique_variable_names.go
@@ -2,6 +2,8 @@ package validator
import (
"github.com/vektah/gqlparser/v2/ast"
+
+ //nolint:revive // Validator rules each use dot imports for convenience.
. "github.com/vektah/gqlparser/v2/validator"
)
diff --git a/vendor/github.com/vektah/gqlparser/v2/validator/rules/values_of_correct_type.go b/vendor/github.com/vektah/gqlparser/v2/validator/rules/values_of_correct_type.go
index 22bea771..7ba6928b 100644
--- a/vendor/github.com/vektah/gqlparser/v2/validator/rules/values_of_correct_type.go
+++ b/vendor/github.com/vektah/gqlparser/v2/validator/rules/values_of_correct_type.go
@@ -6,6 +6,8 @@ import (
"strconv"
"github.com/vektah/gqlparser/v2/ast"
+
+ //nolint:revive // Validator rules each use dot imports for convenience.
. "github.com/vektah/gqlparser/v2/validator"
)
diff --git a/vendor/github.com/vektah/gqlparser/v2/validator/rules/variables_are_input_types.go b/vendor/github.com/vektah/gqlparser/v2/validator/rules/variables_are_input_types.go
index 4ea94e5a..d16ee021 100644
--- a/vendor/github.com/vektah/gqlparser/v2/validator/rules/variables_are_input_types.go
+++ b/vendor/github.com/vektah/gqlparser/v2/validator/rules/variables_are_input_types.go
@@ -2,6 +2,8 @@ package validator
import (
"github.com/vektah/gqlparser/v2/ast"
+
+ //nolint:revive // Validator rules each use dot imports for convenience.
. "github.com/vektah/gqlparser/v2/validator"
)
diff --git a/vendor/github.com/vektah/gqlparser/v2/validator/rules/variables_in_allowed_position.go b/vendor/github.com/vektah/gqlparser/v2/validator/rules/variables_in_allowed_position.go
index eef74354..e3fd6fbb 100644
--- a/vendor/github.com/vektah/gqlparser/v2/validator/rules/variables_in_allowed_position.go
+++ b/vendor/github.com/vektah/gqlparser/v2/validator/rules/variables_in_allowed_position.go
@@ -2,6 +2,8 @@ package validator
import (
"github.com/vektah/gqlparser/v2/ast"
+
+ //nolint:revive // Validator rules each use dot imports for convenience.
. "github.com/vektah/gqlparser/v2/validator"
)
diff --git a/vendor/github.com/vektah/gqlparser/v2/validator/schema.go b/vendor/github.com/vektah/gqlparser/v2/validator/schema.go
index 976ed830..21eb51a5 100644
--- a/vendor/github.com/vektah/gqlparser/v2/validator/schema.go
+++ b/vendor/github.com/vektah/gqlparser/v2/validator/schema.go
@@ -5,6 +5,7 @@ import (
"strconv"
"strings"
+ //nolint:revive
. "github.com/vektah/gqlparser/v2/ast"
"github.com/vektah/gqlparser/v2/gqlerror"
"github.com/vektah/gqlparser/v2/parser"
@@ -85,7 +86,7 @@ func ValidateSchemaDocument(ast *SchemaDocument) (*Schema, error) {
// scalars, it may (§3.13) define builtin directives. Here we check for
// that, and reject doubly-defined directives otherwise.
switch dir.Name {
- case "include", "skip", "deprecated", "specifiedBy": // the builtins
+ case "include", "skip", "deprecated", "specifiedBy", "defer": // the builtins
// In principle here we might want to validate that the
// directives are the same. But they might not be, if the
// server has an older spec than we do. (Plus, validating this
@@ -283,6 +284,9 @@ func validateDefinition(schema *Schema, def *Definition) *gqlerror.Error {
return gqlerror.ErrorPosf(def.Position, "%s %s: non-enum value %s.", def.Kind, def.Name, value.Name)
}
}
+ if err := validateDirectives(schema, value.Directives, LocationEnumValue, nil); err != nil {
+ return err
+ }
}
case InputObject:
if len(def.Fields) == 0 {
@@ -358,11 +362,12 @@ func validateDirectives(schema *Schema, dirs DirectiveList, location DirectiveLo
if currentDirective != nil && dir.Name == currentDirective.Name {
return gqlerror.ErrorPosf(dir.Position, "Directive %s cannot refer to itself.", currentDirective.Name)
}
- if schema.Directives[dir.Name] == nil {
+ dirDefinition := schema.Directives[dir.Name]
+ if dirDefinition == nil {
return gqlerror.ErrorPosf(dir.Position, "Undefined directive %s.", dir.Name)
}
validKind := false
- for _, dirLocation := range schema.Directives[dir.Name].Locations {
+ for _, dirLocation := range dirDefinition.Locations {
if dirLocation == location {
validKind = true
break
@@ -371,6 +376,18 @@ func validateDirectives(schema *Schema, dirs DirectiveList, location DirectiveLo
if !validKind {
return gqlerror.ErrorPosf(dir.Position, "Directive %s is not applicable on %s.", dir.Name, location)
}
+ for _, arg := range dir.Arguments {
+ if dirDefinition.Arguments.ForName(arg.Name) == nil {
+ return gqlerror.ErrorPosf(arg.Position, "Undefined argument %s for directive %s.", arg.Name, dir.Name)
+ }
+ }
+ for _, schemaArg := range dirDefinition.Arguments {
+ if schemaArg.Type.NonNull {
+ if arg := dir.Arguments.ForName(schemaArg.Name); arg == nil || arg.Value.Kind == NullValue {
+ return gqlerror.ErrorPosf(dir.Position, "Argument %s for directive %s cannot be null.", schemaArg.Name, dir.Name)
+ }
+ }
+ }
dir.Definition = schema.Directives[dir.Name]
}
return nil
@@ -378,7 +395,7 @@ func validateDirectives(schema *Schema, dirs DirectiveList, location DirectiveLo
func validateImplements(schema *Schema, def *Definition, intfName string) *gqlerror.Error {
// see validation rules at the bottom of
- // https://facebook.github.io/graphql/October2021/#sec-Objects
+ // https://spec.graphql.org/October2021/#sec-Objects
intf := schema.Types[intfName]
if intf == nil {
return gqlerror.ErrorPosf(def.Position, "Undefined type %s.", strconv.Quote(intfName))
diff --git a/vendor/github.com/vektah/gqlparser/v2/validator/schema_test.yml b/vendor/github.com/vektah/gqlparser/v2/validator/schema_test.yml
index 7034a469..c16caabb 100644
--- a/vendor/github.com/vektah/gqlparser/v2/validator/schema_test.yml
+++ b/vendor/github.com/vektah/gqlparser/v2/validator/schema_test.yml
@@ -528,7 +528,16 @@ directives:
directive @skip(if: Boolean!) on FIELD | FRAGMENT_SPREAD | INLINE_FRAGMENT
directive @skip(if: Boolean!) on FIELD | FRAGMENT_SPREAD | INLINE_FRAGMENT
- - name: must be declared
+ - name: must be declared (type)
+ input: |
+ type User @foo {
+ name: String
+ }
+ error:
+ message: "Undefined directive foo."
+ locations: [{line: 1, column: 12}]
+
+ - name: must be declared (field)
input: |
type User {
name: String @foo
@@ -537,6 +546,15 @@ directives:
message: "Undefined directive foo."
locations: [{line: 2, column: 17}]
+ - name: must be declared (enum)
+ input: |
+ enum Unit {
+ METER @foo
+ }
+ error:
+ message: "Undefined directive foo."
+ locations: [{line: 2, column: 10}]
+
- name: cannot be self-referential
input: |
directive @A(foo: Int! @A) on FIELD_DEFINITION
@@ -604,6 +622,32 @@ directives:
type P { name: String @testField }
interface I { id: ID @testField }
+ - name: Invalid directive argument not allowed
+ input: |
+ directive @foo(bla: Int!) on FIELD_DEFINITION
+ type P {f: Int @foo(foobla: 11)}
+
+ error:
+ message: 'Undefined argument foobla for directive foo.'
+ locations: [{line: 2, column: 21}]
+
+ - name: non-null argument must be provided
+ input: |
+ directive @foo(bla: Int!) on FIELD_DEFINITION
+ type P {f: Int @foo }
+
+ error:
+ message: 'Argument bla for directive foo cannot be null.'
+ locations: [{line: 2, column: 17}]
+
+ - name: non-null argument must not be null
+ input: |
+ directive @foo(bla: Int!) on FIELD_DEFINITION
+ type P {f: Int @foo(bla: null) }
+
+ error:
+ message: 'Argument bla for directive foo cannot be null.'
+ locations: [{line: 2, column: 17}]
entry points:
- name: multiple schema entry points
diff --git a/vendor/github.com/vektah/gqlparser/v2/validator/validator.go b/vendor/github.com/vektah/gqlparser/v2/validator/validator.go
index 34bf93db..b4f37ce2 100644
--- a/vendor/github.com/vektah/gqlparser/v2/validator/validator.go
+++ b/vendor/github.com/vektah/gqlparser/v2/validator/validator.go
@@ -1,6 +1,7 @@
package validator
import (
+ //nolint:revive
. "github.com/vektah/gqlparser/v2/ast"
"github.com/vektah/gqlparser/v2/gqlerror"
)
@@ -24,7 +25,15 @@ func AddRule(name string, f ruleFunc) {
func Validate(schema *Schema, doc *QueryDocument) gqlerror.List {
var errs gqlerror.List
-
+ if schema == nil {
+ errs = append(errs, gqlerror.Errorf("cannot validate as Schema is nil"))
+ }
+ if doc == nil {
+ errs = append(errs, gqlerror.Errorf("cannot validate as QueryDocument is nil"))
+ }
+ if len(errs) > 0 {
+ return errs
+ }
observers := &Events{}
for i := range rules {
rule := rules[i]
diff --git a/vendor/github.com/vektah/gqlparser/v2/validator/vars.go b/vendor/github.com/vektah/gqlparser/v2/validator/vars.go
index 8dbb05bc..df530234 100644
--- a/vendor/github.com/vektah/gqlparser/v2/validator/vars.go
+++ b/vendor/github.com/vektah/gqlparser/v2/validator/vars.go
@@ -11,7 +11,7 @@ import (
"github.com/vektah/gqlparser/v2/gqlerror"
)
-var UnexpectedType = fmt.Errorf("Unexpected Type")
+var ErrUnexpectedType = fmt.Errorf("Unexpected Type")
// VariableValues coerces and validates variable values
func VariableValues(schema *ast.Schema, op *ast.OperationDefinition, variables map[string]interface{}) (map[string]interface{}, error) {
@@ -53,8 +53,8 @@ func VariableValues(schema *ast.Schema, op *ast.OperationDefinition, variables m
} else {
rv := reflect.ValueOf(val)
- jsonNumber, isJsonNumber := val.(json.Number)
- if isJsonNumber {
+ jsonNumber, isJSONNumber := val.(json.Number)
+ if isJSONNumber {
if v.Type.NamedType == "Int" {
n, err := jsonNumber.Int64()
if err != nil {
diff --git a/vendor/golang.org/x/net/http2/h2c/h2c.go b/vendor/golang.org/x/net/http2/h2c/h2c.go
index a72bbed1..2d6bf861 100644
--- a/vendor/golang.org/x/net/http2/h2c/h2c.go
+++ b/vendor/golang.org/x/net/http2/h2c/h2c.go
@@ -44,7 +44,7 @@ func init() {
// HTTP/1, but unlikely to occur in practice and (2) Upgrading from HTTP/1 to
// h2c - this works by using the HTTP/1 Upgrade header to request an upgrade to
// h2c. When either of those situations occur we hijack the HTTP/1 connection,
-// convert it to a HTTP/2 connection and pass the net.Conn to http2.ServeConn.
+// convert it to an HTTP/2 connection and pass the net.Conn to http2.ServeConn.
type h2cHandler struct {
Handler http.Handler
s *http2.Server
diff --git a/vendor/golang.org/x/net/http2/server.go b/vendor/golang.org/x/net/http2/server.go
index cd057f39..033b6e6d 100644
--- a/vendor/golang.org/x/net/http2/server.go
+++ b/vendor/golang.org/x/net/http2/server.go
@@ -441,7 +441,7 @@ func (s *Server) ServeConn(c net.Conn, opts *ServeConnOpts) {
if s.NewWriteScheduler != nil {
sc.writeSched = s.NewWriteScheduler()
} else {
- sc.writeSched = NewPriorityWriteScheduler(nil)
+ sc.writeSched = newRoundRobinWriteScheduler()
}
// These start at the RFC-specified defaults. If there is a higher
@@ -2429,7 +2429,7 @@ type requestBody struct {
conn *serverConn
closeOnce sync.Once // for use by Close only
sawEOF bool // for use by Read only
- pipe *pipe // non-nil if we have a HTTP entity message body
+ pipe *pipe // non-nil if we have an HTTP entity message body
needsContinue bool // need to send a 100-continue
}
@@ -2569,7 +2569,8 @@ func (rws *responseWriterState) writeChunk(p []byte) (n int, err error) {
clen = ""
}
}
- if clen == "" && rws.handlerDone && bodyAllowedForStatus(rws.status) && (len(p) > 0 || !isHeadResp) {
+ _, hasContentLength := rws.snapHeader["Content-Length"]
+ if !hasContentLength && clen == "" && rws.handlerDone && bodyAllowedForStatus(rws.status) && (len(p) > 0 || !isHeadResp) {
clen = strconv.Itoa(len(p))
}
_, hasContentType := rws.snapHeader["Content-Type"]
@@ -2774,7 +2775,7 @@ func (w *responseWriter) FlushError() error {
err = rws.bw.Flush()
} else {
// The bufio.Writer won't call chunkWriter.Write
- // (writeChunk with zero bytes, so we have to do it
+ // (writeChunk with zero bytes), so we have to do it
// ourselves to force the HTTP response header and/or
// final DATA frame (with END_STREAM) to be sent.
_, err = chunkWriter{rws}.Write(nil)
diff --git a/vendor/golang.org/x/net/http2/transport.go b/vendor/golang.org/x/net/http2/transport.go
index ac90a263..4f08ccba 100644
--- a/vendor/golang.org/x/net/http2/transport.go
+++ b/vendor/golang.org/x/net/http2/transport.go
@@ -1268,8 +1268,8 @@ func (cc *ClientConn) RoundTrip(req *http.Request) (*http.Response, error) {
cancelRequest := func(cs *clientStream, err error) error {
cs.cc.mu.Lock()
- defer cs.cc.mu.Unlock()
cs.abortStreamLocked(err)
+ bodyClosed := cs.reqBodyClosed
if cs.ID != 0 {
// This request may have failed because of a problem with the connection,
// or for some unrelated reason. (For example, the user might have canceled
@@ -1284,6 +1284,23 @@ func (cc *ClientConn) RoundTrip(req *http.Request) (*http.Response, error) {
// will not help.
cs.cc.doNotReuse = true
}
+ cs.cc.mu.Unlock()
+ // Wait for the request body to be closed.
+ //
+ // If nothing closed the body before now, abortStreamLocked
+ // will have started a goroutine to close it.
+ //
+ // Closing the body before returning avoids a race condition
+ // with net/http checking its readTrackingBody to see if the
+ // body was read from or closed. See golang/go#60041.
+ //
+ // The body is closed in a separate goroutine without the
+ // connection mutex held, but dropping the mutex before waiting
+ // will keep us from holding it indefinitely if the body
+ // close is slow for some reason.
+ if bodyClosed != nil {
+ <-bodyClosed
+ }
return err
}
@@ -1899,7 +1916,7 @@ func (cc *ClientConn) encodeHeaders(req *http.Request, addGzipHeader bool, trail
// 8.1.2.3 Request Pseudo-Header Fields
// The :path pseudo-header field includes the path and query parts of the
// target URI (the path-absolute production and optionally a '?' character
- // followed by the query production (see Sections 3.3 and 3.4 of
+ // followed by the query production, see Sections 3.3 and 3.4 of
// [RFC3986]).
f(":authority", host)
m := req.Method
diff --git a/vendor/golang.org/x/net/http2/writesched.go b/vendor/golang.org/x/net/http2/writesched.go
index c7cd0017..cc893adc 100644
--- a/vendor/golang.org/x/net/http2/writesched.go
+++ b/vendor/golang.org/x/net/http2/writesched.go
@@ -184,7 +184,8 @@ func (wr *FrameWriteRequest) replyToWriter(err error) {
// writeQueue is used by implementations of WriteScheduler.
type writeQueue struct {
- s []FrameWriteRequest
+ s []FrameWriteRequest
+ prev, next *writeQueue
}
func (q *writeQueue) empty() bool { return len(q.s) == 0 }
diff --git a/vendor/golang.org/x/net/http2/writesched_roundrobin.go b/vendor/golang.org/x/net/http2/writesched_roundrobin.go
new file mode 100644
index 00000000..54fe8632
--- /dev/null
+++ b/vendor/golang.org/x/net/http2/writesched_roundrobin.go
@@ -0,0 +1,119 @@
+// Copyright 2023 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+package http2
+
+import (
+ "fmt"
+ "math"
+)
+
+type roundRobinWriteScheduler struct {
+ // control contains control frames (SETTINGS, PING, etc.).
+ control writeQueue
+
+ // streams maps stream ID to a queue.
+ streams map[uint32]*writeQueue
+
+ // stream queues are stored in a circular linked list.
+ // head is the next stream to write, or nil if there are no streams open.
+ head *writeQueue
+
+ // pool of empty queues for reuse.
+ queuePool writeQueuePool
+}
+
+// newRoundRobinWriteScheduler constructs a new write scheduler.
+// The round robin scheduler priorizes control frames
+// like SETTINGS and PING over DATA frames.
+// When there are no control frames to send, it performs a round-robin
+// selection from the ready streams.
+func newRoundRobinWriteScheduler() WriteScheduler {
+ ws := &roundRobinWriteScheduler{
+ streams: make(map[uint32]*writeQueue),
+ }
+ return ws
+}
+
+func (ws *roundRobinWriteScheduler) OpenStream(streamID uint32, options OpenStreamOptions) {
+ if ws.streams[streamID] != nil {
+ panic(fmt.Errorf("stream %d already opened", streamID))
+ }
+ q := ws.queuePool.get()
+ ws.streams[streamID] = q
+ if ws.head == nil {
+ ws.head = q
+ q.next = q
+ q.prev = q
+ } else {
+ // Queues are stored in a ring.
+ // Insert the new stream before ws.head, putting it at the end of the list.
+ q.prev = ws.head.prev
+ q.next = ws.head
+ q.prev.next = q
+ q.next.prev = q
+ }
+}
+
+func (ws *roundRobinWriteScheduler) CloseStream(streamID uint32) {
+ q := ws.streams[streamID]
+ if q == nil {
+ return
+ }
+ if q.next == q {
+ // This was the only open stream.
+ ws.head = nil
+ } else {
+ q.prev.next = q.next
+ q.next.prev = q.prev
+ if ws.head == q {
+ ws.head = q.next
+ }
+ }
+ delete(ws.streams, streamID)
+ ws.queuePool.put(q)
+}
+
+func (ws *roundRobinWriteScheduler) AdjustStream(streamID uint32, priority PriorityParam) {}
+
+func (ws *roundRobinWriteScheduler) Push(wr FrameWriteRequest) {
+ if wr.isControl() {
+ ws.control.push(wr)
+ return
+ }
+ q := ws.streams[wr.StreamID()]
+ if q == nil {
+ // This is a closed stream.
+ // wr should not be a HEADERS or DATA frame.
+ // We push the request onto the control queue.
+ if wr.DataSize() > 0 {
+ panic("add DATA on non-open stream")
+ }
+ ws.control.push(wr)
+ return
+ }
+ q.push(wr)
+}
+
+func (ws *roundRobinWriteScheduler) Pop() (FrameWriteRequest, bool) {
+ // Control and RST_STREAM frames first.
+ if !ws.control.empty() {
+ return ws.control.shift(), true
+ }
+ if ws.head == nil {
+ return FrameWriteRequest{}, false
+ }
+ q := ws.head
+ for {
+ if wr, ok := q.consume(math.MaxInt32); ok {
+ ws.head = q.next
+ return wr, true
+ }
+ q = q.next
+ if q == ws.head {
+ break
+ }
+ }
+ return FrameWriteRequest{}, false
+}
diff --git a/vendor/golang.org/x/sys/cpu/endian_little.go b/vendor/golang.org/x/sys/cpu/endian_little.go
index fe545966..55db853e 100644
--- a/vendor/golang.org/x/sys/cpu/endian_little.go
+++ b/vendor/golang.org/x/sys/cpu/endian_little.go
@@ -2,8 +2,8 @@
// Use of this source code is governed by a BSD-style
// license that can be found in the LICENSE file.
-//go:build 386 || amd64 || amd64p32 || alpha || arm || arm64 || loong64 || mipsle || mips64le || mips64p32le || nios2 || ppc64le || riscv || riscv64 || sh
-// +build 386 amd64 amd64p32 alpha arm arm64 loong64 mipsle mips64le mips64p32le nios2 ppc64le riscv riscv64 sh
+//go:build 386 || amd64 || amd64p32 || alpha || arm || arm64 || loong64 || mipsle || mips64le || mips64p32le || nios2 || ppc64le || riscv || riscv64 || sh || wasm
+// +build 386 amd64 amd64p32 alpha arm arm64 loong64 mipsle mips64le mips64p32le nios2 ppc64le riscv riscv64 sh wasm
package cpu
diff --git a/vendor/golang.org/x/sys/unix/mkall.sh b/vendor/golang.org/x/sys/unix/mkall.sh
index 8e3947c3..e6f31d37 100644
--- a/vendor/golang.org/x/sys/unix/mkall.sh
+++ b/vendor/golang.org/x/sys/unix/mkall.sh
@@ -50,7 +50,7 @@ if [[ "$GOOS" = "linux" ]]; then
# Use the Docker-based build system
# Files generated through docker (use $cmd so you can Ctl-C the build or run)
$cmd docker build --tag generate:$GOOS $GOOS
- $cmd docker run --interactive --tty --volume $(cd -- "$(dirname -- "$0")/.." && /bin/pwd):/build generate:$GOOS
+ $cmd docker run --interactive --tty --volume $(cd -- "$(dirname -- "$0")/.." && pwd):/build generate:$GOOS
exit
fi
diff --git a/vendor/golang.org/x/sys/unix/mkerrors.sh b/vendor/golang.org/x/sys/unix/mkerrors.sh
index be0423e6..31564627 100644
--- a/vendor/golang.org/x/sys/unix/mkerrors.sh
+++ b/vendor/golang.org/x/sys/unix/mkerrors.sh
@@ -741,7 +741,8 @@ main(void)
e = errors[i].num;
if(i > 0 && errors[i-1].num == e)
continue;
- strcpy(buf, strerror(e));
+ strncpy(buf, strerror(e), sizeof(buf) - 1);
+ buf[sizeof(buf) - 1] = '\0';
// lowercase first letter: Bad -> bad, but STREAM -> STREAM.
if(A <= buf[0] && buf[0] <= Z && a <= buf[1] && buf[1] <= z)
buf[0] += a - A;
@@ -760,7 +761,8 @@ main(void)
e = signals[i].num;
if(i > 0 && signals[i-1].num == e)
continue;
- strcpy(buf, strsignal(e));
+ strncpy(buf, strsignal(e), sizeof(buf) - 1);
+ buf[sizeof(buf) - 1] = '\0';
// lowercase first letter: Bad -> bad, but STREAM -> STREAM.
if(A <= buf[0] && buf[0] <= Z && a <= buf[1] && buf[1] <= z)
buf[0] += a - A;
diff --git a/vendor/golang.org/x/sys/unix/syscall_linux.go b/vendor/golang.org/x/sys/unix/syscall_linux.go
index fbaeb5ff..6de486be 100644
--- a/vendor/golang.org/x/sys/unix/syscall_linux.go
+++ b/vendor/golang.org/x/sys/unix/syscall_linux.go
@@ -1699,12 +1699,23 @@ func PtracePokeUser(pid int, addr uintptr, data []byte) (count int, err error) {
return ptracePoke(PTRACE_POKEUSR, PTRACE_PEEKUSR, pid, addr, data)
}
+// elfNT_PRSTATUS is a copy of the debug/elf.NT_PRSTATUS constant so
+// x/sys/unix doesn't need to depend on debug/elf and thus
+// compress/zlib, debug/dwarf, and other packages.
+const elfNT_PRSTATUS = 1
+
func PtraceGetRegs(pid int, regsout *PtraceRegs) (err error) {
- return ptracePtr(PTRACE_GETREGS, pid, 0, unsafe.Pointer(regsout))
+ var iov Iovec
+ iov.Base = (*byte)(unsafe.Pointer(regsout))
+ iov.SetLen(int(unsafe.Sizeof(*regsout)))
+ return ptracePtr(PTRACE_GETREGSET, pid, uintptr(elfNT_PRSTATUS), unsafe.Pointer(&iov))
}
func PtraceSetRegs(pid int, regs *PtraceRegs) (err error) {
- return ptracePtr(PTRACE_SETREGS, pid, 0, unsafe.Pointer(regs))
+ var iov Iovec
+ iov.Base = (*byte)(unsafe.Pointer(regs))
+ iov.SetLen(int(unsafe.Sizeof(*regs)))
+ return ptracePtr(PTRACE_SETREGSET, pid, uintptr(elfNT_PRSTATUS), unsafe.Pointer(&iov))
}
func PtraceSetOptions(pid int, options int) (err error) {
@@ -2420,6 +2431,21 @@ func PthreadSigmask(how int, set, oldset *Sigset_t) error {
return rtSigprocmask(how, set, oldset, _C__NSIG/8)
}
+//sysnb getresuid(ruid *_C_int, euid *_C_int, suid *_C_int)
+//sysnb getresgid(rgid *_C_int, egid *_C_int, sgid *_C_int)
+
+func Getresuid() (ruid, euid, suid int) {
+ var r, e, s _C_int
+ getresuid(&r, &e, &s)
+ return int(r), int(e), int(s)
+}
+
+func Getresgid() (rgid, egid, sgid int) {
+ var r, e, s _C_int
+ getresgid(&r, &e, &s)
+ return int(r), int(e), int(s)
+}
+
/*
* Unimplemented
*/
diff --git a/vendor/golang.org/x/sys/unix/syscall_openbsd.go b/vendor/golang.org/x/sys/unix/syscall_openbsd.go
index f9c7a966..c5f166a1 100644
--- a/vendor/golang.org/x/sys/unix/syscall_openbsd.go
+++ b/vendor/golang.org/x/sys/unix/syscall_openbsd.go
@@ -151,6 +151,21 @@ func Getfsstat(buf []Statfs_t, flags int) (n int, err error) {
return
}
+//sysnb getresuid(ruid *_C_int, euid *_C_int, suid *_C_int)
+//sysnb getresgid(rgid *_C_int, egid *_C_int, sgid *_C_int)
+
+func Getresuid() (ruid, euid, suid int) {
+ var r, e, s _C_int
+ getresuid(&r, &e, &s)
+ return int(r), int(e), int(s)
+}
+
+func Getresgid() (rgid, egid, sgid int) {
+ var r, e, s _C_int
+ getresgid(&r, &e, &s)
+ return int(r), int(e), int(s)
+}
+
//sys ioctl(fd int, req uint, arg uintptr) (err error)
//sys ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) = SYS_IOCTL
@@ -338,8 +353,6 @@ func Uname(uname *Utsname) error {
// getgid
// getitimer
// getlogin
-// getresgid
-// getresuid
// getthrid
// ktrace
// lfs_bmapv
diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_sparc64.go b/vendor/golang.org/x/sys/unix/zerrors_linux_sparc64.go
index f6192526..48984202 100644
--- a/vendor/golang.org/x/sys/unix/zerrors_linux_sparc64.go
+++ b/vendor/golang.org/x/sys/unix/zerrors_linux_sparc64.go
@@ -329,6 +329,54 @@ const (
SCM_WIFI_STATUS = 0x25
SFD_CLOEXEC = 0x400000
SFD_NONBLOCK = 0x4000
+ SF_FP = 0x38
+ SF_I0 = 0x20
+ SF_I1 = 0x24
+ SF_I2 = 0x28
+ SF_I3 = 0x2c
+ SF_I4 = 0x30
+ SF_I5 = 0x34
+ SF_L0 = 0x0
+ SF_L1 = 0x4
+ SF_L2 = 0x8
+ SF_L3 = 0xc
+ SF_L4 = 0x10
+ SF_L5 = 0x14
+ SF_L6 = 0x18
+ SF_L7 = 0x1c
+ SF_PC = 0x3c
+ SF_RETP = 0x40
+ SF_V9_FP = 0x70
+ SF_V9_I0 = 0x40
+ SF_V9_I1 = 0x48
+ SF_V9_I2 = 0x50
+ SF_V9_I3 = 0x58
+ SF_V9_I4 = 0x60
+ SF_V9_I5 = 0x68
+ SF_V9_L0 = 0x0
+ SF_V9_L1 = 0x8
+ SF_V9_L2 = 0x10
+ SF_V9_L3 = 0x18
+ SF_V9_L4 = 0x20
+ SF_V9_L5 = 0x28
+ SF_V9_L6 = 0x30
+ SF_V9_L7 = 0x38
+ SF_V9_PC = 0x78
+ SF_V9_RETP = 0x80
+ SF_V9_XARG0 = 0x88
+ SF_V9_XARG1 = 0x90
+ SF_V9_XARG2 = 0x98
+ SF_V9_XARG3 = 0xa0
+ SF_V9_XARG4 = 0xa8
+ SF_V9_XARG5 = 0xb0
+ SF_V9_XXARG = 0xb8
+ SF_XARG0 = 0x44
+ SF_XARG1 = 0x48
+ SF_XARG2 = 0x4c
+ SF_XARG3 = 0x50
+ SF_XARG4 = 0x54
+ SF_XARG5 = 0x58
+ SF_XXARG = 0x5c
SIOCATMARK = 0x8905
SIOCGPGRP = 0x8904
SIOCGSTAMPNS_NEW = 0x40108907
diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux.go b/vendor/golang.org/x/sys/unix/zsyscall_linux.go
index da63d9d7..722c29a0 100644
--- a/vendor/golang.org/x/sys/unix/zsyscall_linux.go
+++ b/vendor/golang.org/x/sys/unix/zsyscall_linux.go
@@ -2172,3 +2172,17 @@ func rtSigprocmask(how int, set *Sigset_t, oldset *Sigset_t, sigsetsize uintptr)
}
return
}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func getresuid(ruid *_C_int, euid *_C_int, suid *_C_int) {
+ RawSyscallNoError(SYS_GETRESUID, uintptr(unsafe.Pointer(ruid)), uintptr(unsafe.Pointer(euid)), uintptr(unsafe.Pointer(suid)))
+ return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func getresgid(rgid *_C_int, egid *_C_int, sgid *_C_int) {
+ RawSyscallNoError(SYS_GETRESGID, uintptr(unsafe.Pointer(rgid)), uintptr(unsafe.Pointer(egid)), uintptr(unsafe.Pointer(sgid)))
+ return
+}
diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_386.go b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_386.go
index 6699a783..9ab9abf7 100644
--- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_386.go
+++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_386.go
@@ -519,6 +519,28 @@ var libc_getcwd_trampoline_addr uintptr
// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+func getresuid(ruid *_C_int, euid *_C_int, suid *_C_int) {
+ syscall_rawSyscall(libc_getresuid_trampoline_addr, uintptr(unsafe.Pointer(ruid)), uintptr(unsafe.Pointer(euid)), uintptr(unsafe.Pointer(suid)))
+ return
+}
+
+var libc_getresuid_trampoline_addr uintptr
+
+//go:cgo_import_dynamic libc_getresuid getresuid "libc.so"
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func getresgid(rgid *_C_int, egid *_C_int, sgid *_C_int) {
+ syscall_rawSyscall(libc_getresgid_trampoline_addr, uintptr(unsafe.Pointer(rgid)), uintptr(unsafe.Pointer(egid)), uintptr(unsafe.Pointer(sgid)))
+ return
+}
+
+var libc_getresgid_trampoline_addr uintptr
+
+//go:cgo_import_dynamic libc_getresgid getresgid "libc.so"
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
func ioctl(fd int, req uint, arg uintptr) (err error) {
_, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg))
if e1 != 0 {
diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_386.s b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_386.s
index 04f0de34..3dcacd30 100644
--- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_386.s
+++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_386.s
@@ -158,6 +158,16 @@ TEXT libc_getcwd_trampoline<>(SB),NOSPLIT,$0-0
GLOBL ·libc_getcwd_trampoline_addr(SB), RODATA, $4
DATA ·libc_getcwd_trampoline_addr(SB)/4, $libc_getcwd_trampoline<>(SB)
+TEXT libc_getresuid_trampoline<>(SB),NOSPLIT,$0-0
+ JMP libc_getresuid(SB)
+GLOBL ·libc_getresuid_trampoline_addr(SB), RODATA, $4
+DATA ·libc_getresuid_trampoline_addr(SB)/4, $libc_getresuid_trampoline<>(SB)
+
+TEXT libc_getresgid_trampoline<>(SB),NOSPLIT,$0-0
+ JMP libc_getresgid(SB)
+GLOBL ·libc_getresgid_trampoline_addr(SB), RODATA, $4
+DATA ·libc_getresgid_trampoline_addr(SB)/4, $libc_getresgid_trampoline<>(SB)
+
TEXT libc_ioctl_trampoline<>(SB),NOSPLIT,$0-0
JMP libc_ioctl(SB)
GLOBL ·libc_ioctl_trampoline_addr(SB), RODATA, $4
diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_amd64.go b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_amd64.go
index 1e775fe0..915761ea 100644
--- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_amd64.go
+++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_amd64.go
@@ -519,15 +519,29 @@ var libc_getcwd_trampoline_addr uintptr
// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
-func ioctl(fd int, req uint, arg uintptr) (err error) {
- _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg))
- if e1 != 0 {
- err = errnoErr(e1)
- }
+func getresuid(ruid *_C_int, euid *_C_int, suid *_C_int) {
+ syscall_rawSyscall(libc_getresuid_trampoline_addr, uintptr(unsafe.Pointer(ruid)), uintptr(unsafe.Pointer(euid)), uintptr(unsafe.Pointer(suid)))
return
}
-func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) {
+var libc_getresuid_trampoline_addr uintptr
+
+//go:cgo_import_dynamic libc_getresuid getresuid "libc.so"
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func getresgid(rgid *_C_int, egid *_C_int, sgid *_C_int) {
+ syscall_rawSyscall(libc_getresgid_trampoline_addr, uintptr(unsafe.Pointer(rgid)), uintptr(unsafe.Pointer(egid)), uintptr(unsafe.Pointer(sgid)))
+ return
+}
+
+var libc_getresgid_trampoline_addr uintptr
+
+//go:cgo_import_dynamic libc_getresgid getresgid "libc.so"
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func ioctl(fd int, req uint, arg uintptr) (err error) {
_, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg))
if e1 != 0 {
err = errnoErr(e1)
@@ -541,6 +555,16 @@ var libc_ioctl_trampoline_addr uintptr
// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) {
+ _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg))
+ if e1 != 0 {
+ err = errnoErr(e1)
+ }
+ return
+}
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
func sysctl(mib []_C_int, old *byte, oldlen *uintptr, new *byte, newlen uintptr) (err error) {
var _p0 unsafe.Pointer
if len(mib) > 0 {
diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_amd64.s b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_amd64.s
index 27b6f4df..2763620b 100644
--- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_amd64.s
+++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_amd64.s
@@ -158,6 +158,16 @@ TEXT libc_getcwd_trampoline<>(SB),NOSPLIT,$0-0
GLOBL ·libc_getcwd_trampoline_addr(SB), RODATA, $8
DATA ·libc_getcwd_trampoline_addr(SB)/8, $libc_getcwd_trampoline<>(SB)
+TEXT libc_getresuid_trampoline<>(SB),NOSPLIT,$0-0
+ JMP libc_getresuid(SB)
+GLOBL ·libc_getresuid_trampoline_addr(SB), RODATA, $8
+DATA ·libc_getresuid_trampoline_addr(SB)/8, $libc_getresuid_trampoline<>(SB)
+
+TEXT libc_getresgid_trampoline<>(SB),NOSPLIT,$0-0
+ JMP libc_getresgid(SB)
+GLOBL ·libc_getresgid_trampoline_addr(SB), RODATA, $8
+DATA ·libc_getresgid_trampoline_addr(SB)/8, $libc_getresgid_trampoline<>(SB)
+
TEXT libc_ioctl_trampoline<>(SB),NOSPLIT,$0-0
JMP libc_ioctl(SB)
GLOBL ·libc_ioctl_trampoline_addr(SB), RODATA, $8
diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm.go b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm.go
index 7f642789..8e87fdf1 100644
--- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm.go
+++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm.go
@@ -519,6 +519,28 @@ var libc_getcwd_trampoline_addr uintptr
// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+func getresuid(ruid *_C_int, euid *_C_int, suid *_C_int) {
+ syscall_rawSyscall(libc_getresuid_trampoline_addr, uintptr(unsafe.Pointer(ruid)), uintptr(unsafe.Pointer(euid)), uintptr(unsafe.Pointer(suid)))
+ return
+}
+
+var libc_getresuid_trampoline_addr uintptr
+
+//go:cgo_import_dynamic libc_getresuid getresuid "libc.so"
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func getresgid(rgid *_C_int, egid *_C_int, sgid *_C_int) {
+ syscall_rawSyscall(libc_getresgid_trampoline_addr, uintptr(unsafe.Pointer(rgid)), uintptr(unsafe.Pointer(egid)), uintptr(unsafe.Pointer(sgid)))
+ return
+}
+
+var libc_getresgid_trampoline_addr uintptr
+
+//go:cgo_import_dynamic libc_getresgid getresgid "libc.so"
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
func ioctl(fd int, req uint, arg uintptr) (err error) {
_, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg))
if e1 != 0 {
diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm.s b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm.s
index b797045f..c9223140 100644
--- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm.s
+++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm.s
@@ -158,6 +158,16 @@ TEXT libc_getcwd_trampoline<>(SB),NOSPLIT,$0-0
GLOBL ·libc_getcwd_trampoline_addr(SB), RODATA, $4
DATA ·libc_getcwd_trampoline_addr(SB)/4, $libc_getcwd_trampoline<>(SB)
+TEXT libc_getresuid_trampoline<>(SB),NOSPLIT,$0-0
+ JMP libc_getresuid(SB)
+GLOBL ·libc_getresuid_trampoline_addr(SB), RODATA, $4
+DATA ·libc_getresuid_trampoline_addr(SB)/4, $libc_getresuid_trampoline<>(SB)
+
+TEXT libc_getresgid_trampoline<>(SB),NOSPLIT,$0-0
+ JMP libc_getresgid(SB)
+GLOBL ·libc_getresgid_trampoline_addr(SB), RODATA, $4
+DATA ·libc_getresgid_trampoline_addr(SB)/4, $libc_getresgid_trampoline<>(SB)
+
TEXT libc_ioctl_trampoline<>(SB),NOSPLIT,$0-0
JMP libc_ioctl(SB)
GLOBL ·libc_ioctl_trampoline_addr(SB), RODATA, $4
diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm64.go b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm64.go
index 756ef7b1..12a7a216 100644
--- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm64.go
+++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm64.go
@@ -519,6 +519,28 @@ var libc_getcwd_trampoline_addr uintptr
// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+func getresuid(ruid *_C_int, euid *_C_int, suid *_C_int) {
+ syscall_rawSyscall(libc_getresuid_trampoline_addr, uintptr(unsafe.Pointer(ruid)), uintptr(unsafe.Pointer(euid)), uintptr(unsafe.Pointer(suid)))
+ return
+}
+
+var libc_getresuid_trampoline_addr uintptr
+
+//go:cgo_import_dynamic libc_getresuid getresuid "libc.so"
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func getresgid(rgid *_C_int, egid *_C_int, sgid *_C_int) {
+ syscall_rawSyscall(libc_getresgid_trampoline_addr, uintptr(unsafe.Pointer(rgid)), uintptr(unsafe.Pointer(egid)), uintptr(unsafe.Pointer(sgid)))
+ return
+}
+
+var libc_getresgid_trampoline_addr uintptr
+
+//go:cgo_import_dynamic libc_getresgid getresgid "libc.so"
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
func ioctl(fd int, req uint, arg uintptr) (err error) {
_, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg))
if e1 != 0 {
diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm64.s b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm64.s
index a8712662..a6bc32c9 100644
--- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm64.s
+++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm64.s
@@ -158,6 +158,16 @@ TEXT libc_getcwd_trampoline<>(SB),NOSPLIT,$0-0
GLOBL ·libc_getcwd_trampoline_addr(SB), RODATA, $8
DATA ·libc_getcwd_trampoline_addr(SB)/8, $libc_getcwd_trampoline<>(SB)
+TEXT libc_getresuid_trampoline<>(SB),NOSPLIT,$0-0
+ JMP libc_getresuid(SB)
+GLOBL ·libc_getresuid_trampoline_addr(SB), RODATA, $8
+DATA ·libc_getresuid_trampoline_addr(SB)/8, $libc_getresuid_trampoline<>(SB)
+
+TEXT libc_getresgid_trampoline<>(SB),NOSPLIT,$0-0
+ JMP libc_getresgid(SB)
+GLOBL ·libc_getresgid_trampoline_addr(SB), RODATA, $8
+DATA ·libc_getresgid_trampoline_addr(SB)/8, $libc_getresgid_trampoline<>(SB)
+
TEXT libc_ioctl_trampoline<>(SB),NOSPLIT,$0-0
JMP libc_ioctl(SB)
GLOBL ·libc_ioctl_trampoline_addr(SB), RODATA, $8
diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_mips64.go b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_mips64.go
index 7bc2e24e..b19e8aa0 100644
--- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_mips64.go
+++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_mips64.go
@@ -519,6 +519,28 @@ var libc_getcwd_trampoline_addr uintptr
// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+func getresuid(ruid *_C_int, euid *_C_int, suid *_C_int) {
+ syscall_rawSyscall(libc_getresuid_trampoline_addr, uintptr(unsafe.Pointer(ruid)), uintptr(unsafe.Pointer(euid)), uintptr(unsafe.Pointer(suid)))
+ return
+}
+
+var libc_getresuid_trampoline_addr uintptr
+
+//go:cgo_import_dynamic libc_getresuid getresuid "libc.so"
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func getresgid(rgid *_C_int, egid *_C_int, sgid *_C_int) {
+ syscall_rawSyscall(libc_getresgid_trampoline_addr, uintptr(unsafe.Pointer(rgid)), uintptr(unsafe.Pointer(egid)), uintptr(unsafe.Pointer(sgid)))
+ return
+}
+
+var libc_getresgid_trampoline_addr uintptr
+
+//go:cgo_import_dynamic libc_getresgid getresgid "libc.so"
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
func ioctl(fd int, req uint, arg uintptr) (err error) {
_, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg))
if e1 != 0 {
diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_mips64.s b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_mips64.s
index 05d4bffd..b4e7bcea 100644
--- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_mips64.s
+++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_mips64.s
@@ -158,6 +158,16 @@ TEXT libc_getcwd_trampoline<>(SB),NOSPLIT,$0-0
GLOBL ·libc_getcwd_trampoline_addr(SB), RODATA, $8
DATA ·libc_getcwd_trampoline_addr(SB)/8, $libc_getcwd_trampoline<>(SB)
+TEXT libc_getresuid_trampoline<>(SB),NOSPLIT,$0-0
+ JMP libc_getresuid(SB)
+GLOBL ·libc_getresuid_trampoline_addr(SB), RODATA, $8
+DATA ·libc_getresuid_trampoline_addr(SB)/8, $libc_getresuid_trampoline<>(SB)
+
+TEXT libc_getresgid_trampoline<>(SB),NOSPLIT,$0-0
+ JMP libc_getresgid(SB)
+GLOBL ·libc_getresgid_trampoline_addr(SB), RODATA, $8
+DATA ·libc_getresgid_trampoline_addr(SB)/8, $libc_getresgid_trampoline<>(SB)
+
TEXT libc_ioctl_trampoline<>(SB),NOSPLIT,$0-0
JMP libc_ioctl(SB)
GLOBL ·libc_ioctl_trampoline_addr(SB), RODATA, $8
diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_ppc64.go b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_ppc64.go
index 739be621..fb99594c 100644
--- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_ppc64.go
+++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_ppc64.go
@@ -519,6 +519,28 @@ var libc_getcwd_trampoline_addr uintptr
// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+func getresuid(ruid *_C_int, euid *_C_int, suid *_C_int) {
+ syscall_rawSyscall(libc_getresuid_trampoline_addr, uintptr(unsafe.Pointer(ruid)), uintptr(unsafe.Pointer(euid)), uintptr(unsafe.Pointer(suid)))
+ return
+}
+
+var libc_getresuid_trampoline_addr uintptr
+
+//go:cgo_import_dynamic libc_getresuid getresuid "libc.so"
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func getresgid(rgid *_C_int, egid *_C_int, sgid *_C_int) {
+ syscall_rawSyscall(libc_getresgid_trampoline_addr, uintptr(unsafe.Pointer(rgid)), uintptr(unsafe.Pointer(egid)), uintptr(unsafe.Pointer(sgid)))
+ return
+}
+
+var libc_getresgid_trampoline_addr uintptr
+
+//go:cgo_import_dynamic libc_getresgid getresgid "libc.so"
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
func ioctl(fd int, req uint, arg uintptr) (err error) {
_, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg))
if e1 != 0 {
diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_ppc64.s b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_ppc64.s
index 74a25f8d..ca3f7660 100644
--- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_ppc64.s
+++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_ppc64.s
@@ -189,6 +189,18 @@ TEXT libc_getcwd_trampoline<>(SB),NOSPLIT,$0-0
GLOBL ·libc_getcwd_trampoline_addr(SB), RODATA, $8
DATA ·libc_getcwd_trampoline_addr(SB)/8, $libc_getcwd_trampoline<>(SB)
+TEXT libc_getresuid_trampoline<>(SB),NOSPLIT,$0-0
+ CALL libc_getresuid(SB)
+ RET
+GLOBL ·libc_getresuid_trampoline_addr(SB), RODATA, $8
+DATA ·libc_getresuid_trampoline_addr(SB)/8, $libc_getresuid_trampoline<>(SB)
+
+TEXT libc_getresgid_trampoline<>(SB),NOSPLIT,$0-0
+ CALL libc_getresgid(SB)
+ RET
+GLOBL ·libc_getresgid_trampoline_addr(SB), RODATA, $8
+DATA ·libc_getresgid_trampoline_addr(SB)/8, $libc_getresgid_trampoline<>(SB)
+
TEXT libc_ioctl_trampoline<>(SB),NOSPLIT,$0-0
CALL libc_ioctl(SB)
RET
diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_riscv64.go b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_riscv64.go
index 7d95a197..32cbbbc5 100644
--- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_riscv64.go
+++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_riscv64.go
@@ -519,6 +519,28 @@ var libc_getcwd_trampoline_addr uintptr
// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+func getresuid(ruid *_C_int, euid *_C_int, suid *_C_int) {
+ syscall_rawSyscall(libc_getresuid_trampoline_addr, uintptr(unsafe.Pointer(ruid)), uintptr(unsafe.Pointer(euid)), uintptr(unsafe.Pointer(suid)))
+ return
+}
+
+var libc_getresuid_trampoline_addr uintptr
+
+//go:cgo_import_dynamic libc_getresuid getresuid "libc.so"
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
+func getresgid(rgid *_C_int, egid *_C_int, sgid *_C_int) {
+ syscall_rawSyscall(libc_getresgid_trampoline_addr, uintptr(unsafe.Pointer(rgid)), uintptr(unsafe.Pointer(egid)), uintptr(unsafe.Pointer(sgid)))
+ return
+}
+
+var libc_getresgid_trampoline_addr uintptr
+
+//go:cgo_import_dynamic libc_getresgid getresgid "libc.so"
+
+// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT
+
func ioctl(fd int, req uint, arg uintptr) (err error) {
_, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg))
if e1 != 0 {
diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_riscv64.s b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_riscv64.s
index 990be245..477a7d5b 100644
--- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_riscv64.s
+++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_riscv64.s
@@ -158,6 +158,16 @@ TEXT libc_getcwd_trampoline<>(SB),NOSPLIT,$0-0
GLOBL ·libc_getcwd_trampoline_addr(SB), RODATA, $8
DATA ·libc_getcwd_trampoline_addr(SB)/8, $libc_getcwd_trampoline<>(SB)
+TEXT libc_getresuid_trampoline<>(SB),NOSPLIT,$0-0
+ JMP libc_getresuid(SB)
+GLOBL ·libc_getresuid_trampoline_addr(SB), RODATA, $8
+DATA ·libc_getresuid_trampoline_addr(SB)/8, $libc_getresuid_trampoline<>(SB)
+
+TEXT libc_getresgid_trampoline<>(SB),NOSPLIT,$0-0
+ JMP libc_getresgid(SB)
+GLOBL ·libc_getresgid_trampoline_addr(SB), RODATA, $8
+DATA ·libc_getresgid_trampoline_addr(SB)/8, $libc_getresgid_trampoline<>(SB)
+
TEXT libc_ioctl_trampoline<>(SB),NOSPLIT,$0-0
JMP libc_ioctl(SB)
GLOBL ·libc_ioctl_trampoline_addr(SB), RODATA, $8
diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux.go b/vendor/golang.org/x/sys/unix/ztypes_linux.go
index ca84727c..00c3b8c2 100644
--- a/vendor/golang.org/x/sys/unix/ztypes_linux.go
+++ b/vendor/golang.org/x/sys/unix/ztypes_linux.go
@@ -2555,6 +2555,11 @@ const (
BPF_REG_8 = 0x8
BPF_REG_9 = 0x9
BPF_REG_10 = 0xa
+ BPF_CGROUP_ITER_ORDER_UNSPEC = 0x0
+ BPF_CGROUP_ITER_SELF_ONLY = 0x1
+ BPF_CGROUP_ITER_DESCENDANTS_PRE = 0x2
+ BPF_CGROUP_ITER_DESCENDANTS_POST = 0x3
+ BPF_CGROUP_ITER_ANCESTORS_UP = 0x4
BPF_MAP_CREATE = 0x0
BPF_MAP_LOOKUP_ELEM = 0x1
BPF_MAP_UPDATE_ELEM = 0x2
@@ -2566,6 +2571,7 @@ const (
BPF_PROG_ATTACH = 0x8
BPF_PROG_DETACH = 0x9
BPF_PROG_TEST_RUN = 0xa
+ BPF_PROG_RUN = 0xa
BPF_PROG_GET_NEXT_ID = 0xb
BPF_MAP_GET_NEXT_ID = 0xc
BPF_PROG_GET_FD_BY_ID = 0xd
@@ -2610,6 +2616,7 @@ const (
BPF_MAP_TYPE_CPUMAP = 0x10
BPF_MAP_TYPE_XSKMAP = 0x11
BPF_MAP_TYPE_SOCKHASH = 0x12
+ BPF_MAP_TYPE_CGROUP_STORAGE_DEPRECATED = 0x13
BPF_MAP_TYPE_CGROUP_STORAGE = 0x13
BPF_MAP_TYPE_REUSEPORT_SOCKARRAY = 0x14
BPF_MAP_TYPE_PERCPU_CGROUP_STORAGE = 0x15
@@ -2620,6 +2627,10 @@ const (
BPF_MAP_TYPE_STRUCT_OPS = 0x1a
BPF_MAP_TYPE_RINGBUF = 0x1b
BPF_MAP_TYPE_INODE_STORAGE = 0x1c
+ BPF_MAP_TYPE_TASK_STORAGE = 0x1d
+ BPF_MAP_TYPE_BLOOM_FILTER = 0x1e
+ BPF_MAP_TYPE_USER_RINGBUF = 0x1f
+ BPF_MAP_TYPE_CGRP_STORAGE = 0x20
BPF_PROG_TYPE_UNSPEC = 0x0
BPF_PROG_TYPE_SOCKET_FILTER = 0x1
BPF_PROG_TYPE_KPROBE = 0x2
@@ -2651,6 +2662,7 @@ const (
BPF_PROG_TYPE_EXT = 0x1c
BPF_PROG_TYPE_LSM = 0x1d
BPF_PROG_TYPE_SK_LOOKUP = 0x1e
+ BPF_PROG_TYPE_SYSCALL = 0x1f
BPF_CGROUP_INET_INGRESS = 0x0
BPF_CGROUP_INET_EGRESS = 0x1
BPF_CGROUP_INET_SOCK_CREATE = 0x2
@@ -2689,6 +2701,12 @@ const (
BPF_XDP_CPUMAP = 0x23
BPF_SK_LOOKUP = 0x24
BPF_XDP = 0x25
+ BPF_SK_SKB_VERDICT = 0x26
+ BPF_SK_REUSEPORT_SELECT = 0x27
+ BPF_SK_REUSEPORT_SELECT_OR_MIGRATE = 0x28
+ BPF_PERF_EVENT = 0x29
+ BPF_TRACE_KPROBE_MULTI = 0x2a
+ BPF_LSM_CGROUP = 0x2b
BPF_LINK_TYPE_UNSPEC = 0x0
BPF_LINK_TYPE_RAW_TRACEPOINT = 0x1
BPF_LINK_TYPE_TRACING = 0x2
@@ -2696,6 +2714,9 @@ const (
BPF_LINK_TYPE_ITER = 0x4
BPF_LINK_TYPE_NETNS = 0x5
BPF_LINK_TYPE_XDP = 0x6
+ BPF_LINK_TYPE_PERF_EVENT = 0x7
+ BPF_LINK_TYPE_KPROBE_MULTI = 0x8
+ BPF_LINK_TYPE_STRUCT_OPS = 0x9
BPF_ANY = 0x0
BPF_NOEXIST = 0x1
BPF_EXIST = 0x2
@@ -2733,6 +2754,7 @@ const (
BPF_F_ZERO_CSUM_TX = 0x2
BPF_F_DONT_FRAGMENT = 0x4
BPF_F_SEQ_NUMBER = 0x8
+ BPF_F_TUNINFO_FLAGS = 0x10
BPF_F_INDEX_MASK = 0xffffffff
BPF_F_CURRENT_CPU = 0xffffffff
BPF_F_CTXLEN_MASK = 0xfffff00000000
@@ -2747,6 +2769,7 @@ const (
BPF_F_ADJ_ROOM_ENCAP_L4_GRE = 0x8
BPF_F_ADJ_ROOM_ENCAP_L4_UDP = 0x10
BPF_F_ADJ_ROOM_NO_CSUM_RESET = 0x20
+ BPF_F_ADJ_ROOM_ENCAP_L2_ETH = 0x40
BPF_ADJ_ROOM_ENCAP_L2_MASK = 0xff
BPF_ADJ_ROOM_ENCAP_L2_SHIFT = 0x38
BPF_F_SYSCTL_BASE_NAME = 0x1
@@ -2771,10 +2794,16 @@ const (
BPF_LWT_ENCAP_SEG6 = 0x0
BPF_LWT_ENCAP_SEG6_INLINE = 0x1
BPF_LWT_ENCAP_IP = 0x2
+ BPF_F_BPRM_SECUREEXEC = 0x1
+ BPF_F_BROADCAST = 0x8
+ BPF_F_EXCLUDE_INGRESS = 0x10
+ BPF_SKB_TSTAMP_UNSPEC = 0x0
+ BPF_SKB_TSTAMP_DELIVERY_MONO = 0x1
BPF_OK = 0x0
BPF_DROP = 0x2
BPF_REDIRECT = 0x7
BPF_LWT_REROUTE = 0x80
+ BPF_FLOW_DISSECTOR_CONTINUE = 0x81
BPF_SOCK_OPS_RTO_CB_FLAG = 0x1
BPF_SOCK_OPS_RETRANS_CB_FLAG = 0x2
BPF_SOCK_OPS_STATE_CB_FLAG = 0x4
@@ -2838,6 +2867,10 @@ const (
BPF_FIB_LKUP_RET_UNSUPP_LWT = 0x6
BPF_FIB_LKUP_RET_NO_NEIGH = 0x7
BPF_FIB_LKUP_RET_FRAG_NEEDED = 0x8
+ BPF_MTU_CHK_SEGS = 0x1
+ BPF_MTU_CHK_RET_SUCCESS = 0x0
+ BPF_MTU_CHK_RET_FRAG_NEEDED = 0x1
+ BPF_MTU_CHK_RET_SEGS_TOOBIG = 0x2
BPF_FD_TYPE_RAW_TRACEPOINT = 0x0
BPF_FD_TYPE_TRACEPOINT = 0x1
BPF_FD_TYPE_KPROBE = 0x2
@@ -2847,6 +2880,19 @@ const (
BPF_FLOW_DISSECTOR_F_PARSE_1ST_FRAG = 0x1
BPF_FLOW_DISSECTOR_F_STOP_AT_FLOW_LABEL = 0x2
BPF_FLOW_DISSECTOR_F_STOP_AT_ENCAP = 0x4
+ BPF_CORE_FIELD_BYTE_OFFSET = 0x0
+ BPF_CORE_FIELD_BYTE_SIZE = 0x1
+ BPF_CORE_FIELD_EXISTS = 0x2
+ BPF_CORE_FIELD_SIGNED = 0x3
+ BPF_CORE_FIELD_LSHIFT_U64 = 0x4
+ BPF_CORE_FIELD_RSHIFT_U64 = 0x5
+ BPF_CORE_TYPE_ID_LOCAL = 0x6
+ BPF_CORE_TYPE_ID_TARGET = 0x7
+ BPF_CORE_TYPE_EXISTS = 0x8
+ BPF_CORE_TYPE_SIZE = 0x9
+ BPF_CORE_ENUMVAL_EXISTS = 0xa
+ BPF_CORE_ENUMVAL_VALUE = 0xb
+ BPF_CORE_TYPE_MATCHES = 0xc
)
const (
diff --git a/vendor/golang.org/x/sys/windows/syscall_windows.go b/vendor/golang.org/x/sys/windows/syscall_windows.go
index 3723b2c2..96459007 100644
--- a/vendor/golang.org/x/sys/windows/syscall_windows.go
+++ b/vendor/golang.org/x/sys/windows/syscall_windows.go
@@ -405,7 +405,7 @@ func NewCallbackCDecl(fn interface{}) uintptr {
//sys VerQueryValue(block unsafe.Pointer, subBlock string, pointerToBufferPointer unsafe.Pointer, bufSize *uint32) (err error) = version.VerQueryValueW
// Process Status API (PSAPI)
-//sys EnumProcesses(processIds []uint32, bytesReturned *uint32) (err error) = psapi.EnumProcesses
+//sys enumProcesses(processIds *uint32, nSize uint32, bytesReturned *uint32) (err error) = psapi.EnumProcesses
//sys EnumProcessModules(process Handle, module *Handle, cb uint32, cbNeeded *uint32) (err error) = psapi.EnumProcessModules
//sys EnumProcessModulesEx(process Handle, module *Handle, cb uint32, cbNeeded *uint32, filterFlag uint32) (err error) = psapi.EnumProcessModulesEx
//sys GetModuleInformation(process Handle, module Handle, modinfo *ModuleInfo, cb uint32) (err error) = psapi.GetModuleInformation
@@ -1354,6 +1354,17 @@ func SetsockoptIPv6Mreq(fd Handle, level, opt int, mreq *IPv6Mreq) (err error) {
return syscall.EWINDOWS
}
+func EnumProcesses(processIds []uint32, bytesReturned *uint32) error {
+ // EnumProcesses syscall expects the size parameter to be in bytes, but the code generated with mksyscall uses
+ // the length of the processIds slice instead. Hence, this wrapper function is added to fix the discrepancy.
+ var p *uint32
+ if len(processIds) > 0 {
+ p = &processIds[0]
+ }
+ size := uint32(len(processIds) * 4)
+ return enumProcesses(p, size, bytesReturned)
+}
+
func Getpid() (pid int) { return int(GetCurrentProcessId()) }
func FindFirstFile(name *uint16, data *Win32finddata) (handle Handle, err error) {
diff --git a/vendor/golang.org/x/sys/windows/zsyscall_windows.go b/vendor/golang.org/x/sys/windows/zsyscall_windows.go
index a81ea2c7..566dd3e3 100644
--- a/vendor/golang.org/x/sys/windows/zsyscall_windows.go
+++ b/vendor/golang.org/x/sys/windows/zsyscall_windows.go
@@ -3516,12 +3516,8 @@ func EnumProcessModulesEx(process Handle, module *Handle, cb uint32, cbNeeded *u
return
}
-func EnumProcesses(processIds []uint32, bytesReturned *uint32) (err error) {
- var _p0 *uint32
- if len(processIds) > 0 {
- _p0 = &processIds[0]
- }
- r1, _, e1 := syscall.Syscall(procEnumProcesses.Addr(), 3, uintptr(unsafe.Pointer(_p0)), uintptr(len(processIds)), uintptr(unsafe.Pointer(bytesReturned)))
+func enumProcesses(processIds *uint32, nSize uint32, bytesReturned *uint32) (err error) {
+ r1, _, e1 := syscall.Syscall(procEnumProcesses.Addr(), 3, uintptr(unsafe.Pointer(processIds)), uintptr(nSize), uintptr(unsafe.Pointer(bytesReturned)))
if r1 == 0 {
err = errnoErr(e1)
}
diff --git a/vendor/golang.org/x/tools/go/gcexportdata/gcexportdata.go b/vendor/golang.org/x/tools/go/gcexportdata/gcexportdata.go
index 165ede0f..03543bd4 100644
--- a/vendor/golang.org/x/tools/go/gcexportdata/gcexportdata.go
+++ b/vendor/golang.org/x/tools/go/gcexportdata/gcexportdata.go
@@ -128,15 +128,14 @@ func Read(in io.Reader, fset *token.FileSet, imports map[string]*types.Package,
// (from "version"). Select appropriate importer.
if len(data) > 0 {
switch data[0] {
- case 'i':
+ case 'v', 'c', 'd': // binary, till go1.10
+ return nil, fmt.Errorf("binary (%c) import format is no longer supported", data[0])
+
+ case 'i': // indexed, till go1.19
_, pkg, err := gcimporter.IImportData(fset, imports, data[1:], path)
return pkg, err
- case 'v', 'c', 'd':
- _, pkg, err := gcimporter.BImportData(fset, imports, data, path)
- return pkg, err
-
- case 'u':
+ case 'u': // unified, from go1.20
_, pkg, err := gcimporter.UImportData(fset, imports, data[1:], path)
return pkg, err
diff --git a/vendor/golang.org/x/tools/go/packages/golist.go b/vendor/golang.org/x/tools/go/packages/golist.go
index 6bb7168d..e84f19df 100644
--- a/vendor/golang.org/x/tools/go/packages/golist.go
+++ b/vendor/golang.org/x/tools/go/packages/golist.go
@@ -625,7 +625,12 @@ func (state *golistState) createDriverResponse(words ...string) (*driverResponse
}
if pkg.PkgPath == "unsafe" {
- pkg.GoFiles = nil // ignore fake unsafe.go file
+ pkg.CompiledGoFiles = nil // ignore fake unsafe.go file (#59929)
+ } else if len(pkg.CompiledGoFiles) == 0 {
+ // Work around for pre-go.1.11 versions of go list.
+ // TODO(matloob): they should be handled by the fallback.
+ // Can we delete this?
+ pkg.CompiledGoFiles = pkg.GoFiles
}
// Assume go list emits only absolute paths for Dir.
@@ -663,13 +668,6 @@ func (state *golistState) createDriverResponse(words ...string) (*driverResponse
response.Roots = append(response.Roots, pkg.ID)
}
- // Work around for pre-go.1.11 versions of go list.
- // TODO(matloob): they should be handled by the fallback.
- // Can we delete this?
- if len(pkg.CompiledGoFiles) == 0 {
- pkg.CompiledGoFiles = pkg.GoFiles
- }
-
// Temporary work-around for golang/go#39986. Parse filenames out of
// error messages. This happens if there are unrecoverable syntax
// errors in the source, so we can't match on a specific error message.
@@ -891,6 +889,15 @@ func golistargs(cfg *Config, words []string, goVersion int) []string {
// probably because you'd just get the TestMain.
fmt.Sprintf("-find=%t", !cfg.Tests && cfg.Mode&findFlags == 0 && !usesExportData(cfg)),
}
+
+ // golang/go#60456: with go1.21 and later, go list serves pgo variants, which
+ // can be costly to compute and may result in redundant processing for the
+ // caller. Disable these variants. If someone wants to add e.g. a NeedPGO
+ // mode flag, that should be a separate proposal.
+ if goVersion >= 21 {
+ fullargs = append(fullargs, "-pgo=off")
+ }
+
fullargs = append(fullargs, cfg.BuildFlags...)
fullargs = append(fullargs, "--")
fullargs = append(fullargs, words...)
diff --git a/vendor/golang.org/x/tools/go/packages/packages.go b/vendor/golang.org/x/tools/go/packages/packages.go
index 0f1505b8..632be722 100644
--- a/vendor/golang.org/x/tools/go/packages/packages.go
+++ b/vendor/golang.org/x/tools/go/packages/packages.go
@@ -308,6 +308,9 @@ type Package struct {
TypeErrors []types.Error
// GoFiles lists the absolute file paths of the package's Go source files.
+ // It may include files that should not be compiled, for example because
+ // they contain non-matching build tags, are documentary pseudo-files such as
+ // unsafe/unsafe.go or builtin/builtin.go, or are subject to cgo preprocessing.
GoFiles []string
// CompiledGoFiles lists the absolute file paths of the package's source
diff --git a/vendor/golang.org/x/tools/go/types/objectpath/objectpath.go b/vendor/golang.org/x/tools/go/types/objectpath/objectpath.go
deleted file mode 100644
index aa7dfacc..00000000
--- a/vendor/golang.org/x/tools/go/types/objectpath/objectpath.go
+++ /dev/null
@@ -1,764 +0,0 @@
-// Copyright 2018 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-// Package objectpath defines a naming scheme for types.Objects
-// (that is, named entities in Go programs) relative to their enclosing
-// package.
-//
-// Type-checker objects are canonical, so they are usually identified by
-// their address in memory (a pointer), but a pointer has meaning only
-// within one address space. By contrast, objectpath names allow the
-// identity of an object to be sent from one program to another,
-// establishing a correspondence between types.Object variables that are
-// distinct but logically equivalent.
-//
-// A single object may have multiple paths. In this example,
-//
-// type A struct{ X int }
-// type B A
-//
-// the field X has two paths due to its membership of both A and B.
-// The For(obj) function always returns one of these paths, arbitrarily
-// but consistently.
-package objectpath
-
-import (
- "fmt"
- "go/types"
- "sort"
- "strconv"
- "strings"
-
- "golang.org/x/tools/internal/typeparams"
-
- _ "unsafe" // for go:linkname
-)
-
-// A Path is an opaque name that identifies a types.Object
-// relative to its package. Conceptually, the name consists of a
-// sequence of destructuring operations applied to the package scope
-// to obtain the original object.
-// The name does not include the package itself.
-type Path string
-
-// Encoding
-//
-// An object path is a textual and (with training) human-readable encoding
-// of a sequence of destructuring operators, starting from a types.Package.
-// The sequences represent a path through the package/object/type graph.
-// We classify these operators by their type:
-//
-// PO package->object Package.Scope.Lookup
-// OT object->type Object.Type
-// TT type->type Type.{Elem,Key,Params,Results,Underlying} [EKPRU]
-// TO type->object Type.{At,Field,Method,Obj} [AFMO]
-//
-// All valid paths start with a package and end at an object
-// and thus may be defined by the regular language:
-//
-// objectpath = PO (OT TT* TO)*
-//
-// The concrete encoding follows directly:
-// - The only PO operator is Package.Scope.Lookup, which requires an identifier.
-// - The only OT operator is Object.Type,
-// which we encode as '.' because dot cannot appear in an identifier.
-// - The TT operators are encoded as [EKPRUTC];
-// one of these (TypeParam) requires an integer operand,
-// which is encoded as a string of decimal digits.
-// - The TO operators are encoded as [AFMO];
-// three of these (At,Field,Method) require an integer operand,
-// which is encoded as a string of decimal digits.
-// These indices are stable across different representations
-// of the same package, even source and export data.
-// The indices used are implementation specific and may not correspond to
-// the argument to the go/types function.
-//
-// In the example below,
-//
-// package p
-//
-// type T interface {
-// f() (a string, b struct{ X int })
-// }
-//
-// field X has the path "T.UM0.RA1.F0",
-// representing the following sequence of operations:
-//
-// p.Lookup("T") T
-// .Type().Underlying().Method(0). f
-// .Type().Results().At(1) b
-// .Type().Field(0) X
-//
-// The encoding is not maximally compact---every R or P is
-// followed by an A, for example---but this simplifies the
-// encoder and decoder.
-const (
- // object->type operators
- opType = '.' // .Type() (Object)
-
- // type->type operators
- opElem = 'E' // .Elem() (Pointer, Slice, Array, Chan, Map)
- opKey = 'K' // .Key() (Map)
- opParams = 'P' // .Params() (Signature)
- opResults = 'R' // .Results() (Signature)
- opUnderlying = 'U' // .Underlying() (Named)
- opTypeParam = 'T' // .TypeParams.At(i) (Named, Signature)
- opConstraint = 'C' // .Constraint() (TypeParam)
-
- // type->object operators
- opAt = 'A' // .At(i) (Tuple)
- opField = 'F' // .Field(i) (Struct)
- opMethod = 'M' // .Method(i) (Named or Interface; not Struct: "promoted" names are ignored)
- opObj = 'O' // .Obj() (Named, TypeParam)
-)
-
-// For is equivalent to new(Encoder).For(obj).
-//
-// It may be more efficient to reuse a single Encoder across several calls.
-func For(obj types.Object) (Path, error) {
- return new(Encoder).For(obj)
-}
-
-// An Encoder amortizes the cost of encoding the paths of multiple objects.
-// The zero value of an Encoder is ready to use.
-type Encoder struct {
- scopeNamesMemo map[*types.Scope][]string // memoization of Scope.Names()
- namedMethodsMemo map[*types.Named][]*types.Func // memoization of namedMethods()
-}
-
-// For returns the path to an object relative to its package,
-// or an error if the object is not accessible from the package's Scope.
-//
-// The For function guarantees to return a path only for the following objects:
-// - package-level types
-// - exported package-level non-types
-// - methods
-// - parameter and result variables
-// - struct fields
-// These objects are sufficient to define the API of their package.
-// The objects described by a package's export data are drawn from this set.
-//
-// For does not return a path for predeclared names, imported package
-// names, local names, and unexported package-level names (except
-// types).
-//
-// Example: given this definition,
-//
-// package p
-//
-// type T interface {
-// f() (a string, b struct{ X int })
-// }
-//
-// For(X) would return a path that denotes the following sequence of operations:
-//
-// p.Scope().Lookup("T") (TypeName T)
-// .Type().Underlying().Method(0). (method Func f)
-// .Type().Results().At(1) (field Var b)
-// .Type().Field(0) (field Var X)
-//
-// where p is the package (*types.Package) to which X belongs.
-func (enc *Encoder) For(obj types.Object) (Path, error) {
- pkg := obj.Pkg()
-
- // This table lists the cases of interest.
- //
- // Object Action
- // ------ ------
- // nil reject
- // builtin reject
- // pkgname reject
- // label reject
- // var
- // package-level accept
- // func param/result accept
- // local reject
- // struct field accept
- // const
- // package-level accept
- // local reject
- // func
- // package-level accept
- // init functions reject
- // concrete method accept
- // interface method accept
- // type
- // package-level accept
- // local reject
- //
- // The only accessible package-level objects are members of pkg itself.
- //
- // The cases are handled in four steps:
- //
- // 1. reject nil and builtin
- // 2. accept package-level objects
- // 3. reject obviously invalid objects
- // 4. search the API for the path to the param/result/field/method.
-
- // 1. reference to nil or builtin?
- if pkg == nil {
- return "", fmt.Errorf("predeclared %s has no path", obj)
- }
- scope := pkg.Scope()
-
- // 2. package-level object?
- if scope.Lookup(obj.Name()) == obj {
- // Only exported objects (and non-exported types) have a path.
- // Non-exported types may be referenced by other objects.
- if _, ok := obj.(*types.TypeName); !ok && !obj.Exported() {
- return "", fmt.Errorf("no path for non-exported %v", obj)
- }
- return Path(obj.Name()), nil
- }
-
- // 3. Not a package-level object.
- // Reject obviously non-viable cases.
- switch obj := obj.(type) {
- case *types.TypeName:
- if _, ok := obj.Type().(*typeparams.TypeParam); !ok {
- // With the exception of type parameters, only package-level type names
- // have a path.
- return "", fmt.Errorf("no path for %v", obj)
- }
- case *types.Const, // Only package-level constants have a path.
- *types.Label, // Labels are function-local.
- *types.PkgName: // PkgNames are file-local.
- return "", fmt.Errorf("no path for %v", obj)
-
- case *types.Var:
- // Could be:
- // - a field (obj.IsField())
- // - a func parameter or result
- // - a local var.
- // Sadly there is no way to distinguish
- // a param/result from a local
- // so we must proceed to the find.
-
- case *types.Func:
- // A func, if not package-level, must be a method.
- if recv := obj.Type().(*types.Signature).Recv(); recv == nil {
- return "", fmt.Errorf("func is not a method: %v", obj)
- }
-
- if path, ok := enc.concreteMethod(obj); ok {
- // Fast path for concrete methods that avoids looping over scope.
- return path, nil
- }
-
- default:
- panic(obj)
- }
-
- // 4. Search the API for the path to the var (field/param/result) or method.
-
- // First inspect package-level named types.
- // In the presence of path aliases, these give
- // the best paths because non-types may
- // refer to types, but not the reverse.
- empty := make([]byte, 0, 48) // initial space
- names := enc.scopeNames(scope)
- for _, name := range names {
- o := scope.Lookup(name)
- tname, ok := o.(*types.TypeName)
- if !ok {
- continue // handle non-types in second pass
- }
-
- path := append(empty, name...)
- path = append(path, opType)
-
- T := o.Type()
-
- if tname.IsAlias() {
- // type alias
- if r := find(obj, T, path, nil); r != nil {
- return Path(r), nil
- }
- } else {
- if named, _ := T.(*types.Named); named != nil {
- if r := findTypeParam(obj, typeparams.ForNamed(named), path, nil); r != nil {
- // generic named type
- return Path(r), nil
- }
- }
- // defined (named) type
- if r := find(obj, T.Underlying(), append(path, opUnderlying), nil); r != nil {
- return Path(r), nil
- }
- }
- }
-
- // Then inspect everything else:
- // non-types, and declared methods of defined types.
- for _, name := range names {
- o := scope.Lookup(name)
- path := append(empty, name...)
- if _, ok := o.(*types.TypeName); !ok {
- if o.Exported() {
- // exported non-type (const, var, func)
- if r := find(obj, o.Type(), append(path, opType), nil); r != nil {
- return Path(r), nil
- }
- }
- continue
- }
-
- // Inspect declared methods of defined types.
- if T, ok := o.Type().(*types.Named); ok {
- path = append(path, opType)
- // Note that method index here is always with respect
- // to canonical ordering of methods, regardless of how
- // they appear in the underlying type.
- for i, m := range enc.namedMethods(T) {
- path2 := appendOpArg(path, opMethod, i)
- if m == obj {
- return Path(path2), nil // found declared method
- }
- if r := find(obj, m.Type(), append(path2, opType), nil); r != nil {
- return Path(r), nil
- }
- }
- }
- }
-
- return "", fmt.Errorf("can't find path for %v in %s", obj, pkg.Path())
-}
-
-func appendOpArg(path []byte, op byte, arg int) []byte {
- path = append(path, op)
- path = strconv.AppendInt(path, int64(arg), 10)
- return path
-}
-
-// concreteMethod returns the path for meth, which must have a non-nil receiver.
-// The second return value indicates success and may be false if the method is
-// an interface method or if it is an instantiated method.
-//
-// This function is just an optimization that avoids the general scope walking
-// approach. You are expected to fall back to the general approach if this
-// function fails.
-func (enc *Encoder) concreteMethod(meth *types.Func) (Path, bool) {
- // Concrete methods can only be declared on package-scoped named types. For
- // that reason we can skip the expensive walk over the package scope: the
- // path will always be package -> named type -> method. We can trivially get
- // the type name from the receiver, and only have to look over the type's
- // methods to find the method index.
- //
- // Methods on generic types require special consideration, however. Consider
- // the following package:
- //
- // L1: type S[T any] struct{}
- // L2: func (recv S[A]) Foo() { recv.Bar() }
- // L3: func (recv S[B]) Bar() { }
- // L4: type Alias = S[int]
- // L5: func _[T any]() { var s S[int]; s.Foo() }
- //
- // The receivers of methods on generic types are instantiations. L2 and L3
- // instantiate S with the type-parameters A and B, which are scoped to the
- // respective methods. L4 and L5 each instantiate S with int. Each of these
- // instantiations has its own method set, full of methods (and thus objects)
- // with receivers whose types are the respective instantiations. In other
- // words, we have
- //
- // S[A].Foo, S[A].Bar
- // S[B].Foo, S[B].Bar
- // S[int].Foo, S[int].Bar
- //
- // We may thus be trying to produce object paths for any of these objects.
- //
- // S[A].Foo and S[B].Bar are the origin methods, and their paths are S.Foo
- // and S.Bar, which are the paths that this function naturally produces.
- //
- // S[A].Bar, S[B].Foo, and both methods on S[int] are instantiations that
- // don't correspond to the origin methods. For S[int], this is significant.
- // The most precise object path for S[int].Foo, for example, is Alias.Foo,
- // not S.Foo. Our function, however, would produce S.Foo, which would
- // resolve to a different object.
- //
- // For S[A].Bar and S[B].Foo it could be argued that S.Bar and S.Foo are
- // still the correct paths, since only the origin methods have meaningful
- // paths. But this is likely only true for trivial cases and has edge cases.
- // Since this function is only an optimization, we err on the side of giving
- // up, deferring to the slower but definitely correct algorithm. Most users
- // of objectpath will only be giving us origin methods, anyway, as referring
- // to instantiated methods is usually not useful.
-
- if typeparams.OriginMethod(meth) != meth {
- return "", false
- }
-
- recvT := meth.Type().(*types.Signature).Recv().Type()
- if ptr, ok := recvT.(*types.Pointer); ok {
- recvT = ptr.Elem()
- }
-
- named, ok := recvT.(*types.Named)
- if !ok {
- return "", false
- }
-
- if types.IsInterface(named) {
- // Named interfaces don't have to be package-scoped
- //
- // TODO(dominikh): opt: if scope.Lookup(name) == named, then we can apply this optimization to interface
- // methods, too, I think.
- return "", false
- }
-
- // Preallocate space for the name, opType, opMethod, and some digits.
- name := named.Obj().Name()
- path := make([]byte, 0, len(name)+8)
- path = append(path, name...)
- path = append(path, opType)
- for i, m := range enc.namedMethods(named) {
- if m == meth {
- path = appendOpArg(path, opMethod, i)
- return Path(path), true
- }
- }
-
- // Due to golang/go#59944, go/types fails to associate the receiver with
- // certain methods on cgo types.
- //
- // TODO(rfindley): replace this panic once golang/go#59944 is fixed in all Go
- // versions gopls supports.
- return "", false
- // panic(fmt.Sprintf("couldn't find method %s on type %s; methods: %#v", meth, named, enc.namedMethods(named)))
-}
-
-// find finds obj within type T, returning the path to it, or nil if not found.
-//
-// The seen map is used to short circuit cycles through type parameters. If
-// nil, it will be allocated as necessary.
-func find(obj types.Object, T types.Type, path []byte, seen map[*types.TypeName]bool) []byte {
- switch T := T.(type) {
- case *types.Basic, *types.Named:
- // Named types belonging to pkg were handled already,
- // so T must belong to another package. No path.
- return nil
- case *types.Pointer:
- return find(obj, T.Elem(), append(path, opElem), seen)
- case *types.Slice:
- return find(obj, T.Elem(), append(path, opElem), seen)
- case *types.Array:
- return find(obj, T.Elem(), append(path, opElem), seen)
- case *types.Chan:
- return find(obj, T.Elem(), append(path, opElem), seen)
- case *types.Map:
- if r := find(obj, T.Key(), append(path, opKey), seen); r != nil {
- return r
- }
- return find(obj, T.Elem(), append(path, opElem), seen)
- case *types.Signature:
- if r := findTypeParam(obj, typeparams.ForSignature(T), path, seen); r != nil {
- return r
- }
- if r := find(obj, T.Params(), append(path, opParams), seen); r != nil {
- return r
- }
- return find(obj, T.Results(), append(path, opResults), seen)
- case *types.Struct:
- for i := 0; i < T.NumFields(); i++ {
- fld := T.Field(i)
- path2 := appendOpArg(path, opField, i)
- if fld == obj {
- return path2 // found field var
- }
- if r := find(obj, fld.Type(), append(path2, opType), seen); r != nil {
- return r
- }
- }
- return nil
- case *types.Tuple:
- for i := 0; i < T.Len(); i++ {
- v := T.At(i)
- path2 := appendOpArg(path, opAt, i)
- if v == obj {
- return path2 // found param/result var
- }
- if r := find(obj, v.Type(), append(path2, opType), seen); r != nil {
- return r
- }
- }
- return nil
- case *types.Interface:
- for i := 0; i < T.NumMethods(); i++ {
- m := T.Method(i)
- path2 := appendOpArg(path, opMethod, i)
- if m == obj {
- return path2 // found interface method
- }
- if r := find(obj, m.Type(), append(path2, opType), seen); r != nil {
- return r
- }
- }
- return nil
- case *typeparams.TypeParam:
- name := T.Obj()
- if name == obj {
- return append(path, opObj)
- }
- if seen[name] {
- return nil
- }
- if seen == nil {
- seen = make(map[*types.TypeName]bool)
- }
- seen[name] = true
- if r := find(obj, T.Constraint(), append(path, opConstraint), seen); r != nil {
- return r
- }
- return nil
- }
- panic(T)
-}
-
-func findTypeParam(obj types.Object, list *typeparams.TypeParamList, path []byte, seen map[*types.TypeName]bool) []byte {
- for i := 0; i < list.Len(); i++ {
- tparam := list.At(i)
- path2 := appendOpArg(path, opTypeParam, i)
- if r := find(obj, tparam, path2, seen); r != nil {
- return r
- }
- }
- return nil
-}
-
-// Object returns the object denoted by path p within the package pkg.
-func Object(pkg *types.Package, p Path) (types.Object, error) {
- if p == "" {
- return nil, fmt.Errorf("empty path")
- }
-
- pathstr := string(p)
- var pkgobj, suffix string
- if dot := strings.IndexByte(pathstr, opType); dot < 0 {
- pkgobj = pathstr
- } else {
- pkgobj = pathstr[:dot]
- suffix = pathstr[dot:] // suffix starts with "."
- }
-
- obj := pkg.Scope().Lookup(pkgobj)
- if obj == nil {
- return nil, fmt.Errorf("package %s does not contain %q", pkg.Path(), pkgobj)
- }
-
- // abstraction of *types.{Pointer,Slice,Array,Chan,Map}
- type hasElem interface {
- Elem() types.Type
- }
- // abstraction of *types.{Named,Signature}
- type hasTypeParams interface {
- TypeParams() *typeparams.TypeParamList
- }
- // abstraction of *types.{Named,TypeParam}
- type hasObj interface {
- Obj() *types.TypeName
- }
-
- // The loop state is the pair (t, obj),
- // exactly one of which is non-nil, initially obj.
- // All suffixes start with '.' (the only object->type operation),
- // followed by optional type->type operations,
- // then a type->object operation.
- // The cycle then repeats.
- var t types.Type
- for suffix != "" {
- code := suffix[0]
- suffix = suffix[1:]
-
- // Codes [AFM] have an integer operand.
- var index int
- switch code {
- case opAt, opField, opMethod, opTypeParam:
- rest := strings.TrimLeft(suffix, "0123456789")
- numerals := suffix[:len(suffix)-len(rest)]
- suffix = rest
- i, err := strconv.Atoi(numerals)
- if err != nil {
- return nil, fmt.Errorf("invalid path: bad numeric operand %q for code %q", numerals, code)
- }
- index = int(i)
- case opObj:
- // no operand
- default:
- // The suffix must end with a type->object operation.
- if suffix == "" {
- return nil, fmt.Errorf("invalid path: ends with %q, want [AFMO]", code)
- }
- }
-
- if code == opType {
- if t != nil {
- return nil, fmt.Errorf("invalid path: unexpected %q in type context", opType)
- }
- t = obj.Type()
- obj = nil
- continue
- }
-
- if t == nil {
- return nil, fmt.Errorf("invalid path: code %q in object context", code)
- }
-
- // Inv: t != nil, obj == nil
-
- switch code {
- case opElem:
- hasElem, ok := t.(hasElem) // Pointer, Slice, Array, Chan, Map
- if !ok {
- return nil, fmt.Errorf("cannot apply %q to %s (got %T, want pointer, slice, array, chan or map)", code, t, t)
- }
- t = hasElem.Elem()
-
- case opKey:
- mapType, ok := t.(*types.Map)
- if !ok {
- return nil, fmt.Errorf("cannot apply %q to %s (got %T, want map)", code, t, t)
- }
- t = mapType.Key()
-
- case opParams:
- sig, ok := t.(*types.Signature)
- if !ok {
- return nil, fmt.Errorf("cannot apply %q to %s (got %T, want signature)", code, t, t)
- }
- t = sig.Params()
-
- case opResults:
- sig, ok := t.(*types.Signature)
- if !ok {
- return nil, fmt.Errorf("cannot apply %q to %s (got %T, want signature)", code, t, t)
- }
- t = sig.Results()
-
- case opUnderlying:
- named, ok := t.(*types.Named)
- if !ok {
- return nil, fmt.Errorf("cannot apply %q to %s (got %T, want named)", code, t, t)
- }
- t = named.Underlying()
-
- case opTypeParam:
- hasTypeParams, ok := t.(hasTypeParams) // Named, Signature
- if !ok {
- return nil, fmt.Errorf("cannot apply %q to %s (got %T, want named or signature)", code, t, t)
- }
- tparams := hasTypeParams.TypeParams()
- if n := tparams.Len(); index >= n {
- return nil, fmt.Errorf("tuple index %d out of range [0-%d)", index, n)
- }
- t = tparams.At(index)
-
- case opConstraint:
- tparam, ok := t.(*typeparams.TypeParam)
- if !ok {
- return nil, fmt.Errorf("cannot apply %q to %s (got %T, want type parameter)", code, t, t)
- }
- t = tparam.Constraint()
-
- case opAt:
- tuple, ok := t.(*types.Tuple)
- if !ok {
- return nil, fmt.Errorf("cannot apply %q to %s (got %T, want tuple)", code, t, t)
- }
- if n := tuple.Len(); index >= n {
- return nil, fmt.Errorf("tuple index %d out of range [0-%d)", index, n)
- }
- obj = tuple.At(index)
- t = nil
-
- case opField:
- structType, ok := t.(*types.Struct)
- if !ok {
- return nil, fmt.Errorf("cannot apply %q to %s (got %T, want struct)", code, t, t)
- }
- if n := structType.NumFields(); index >= n {
- return nil, fmt.Errorf("field index %d out of range [0-%d)", index, n)
- }
- obj = structType.Field(index)
- t = nil
-
- case opMethod:
- switch t := t.(type) {
- case *types.Interface:
- if index >= t.NumMethods() {
- return nil, fmt.Errorf("method index %d out of range [0-%d)", index, t.NumMethods())
- }
- obj = t.Method(index) // Id-ordered
-
- case *types.Named:
- methods := namedMethods(t) // (unmemoized)
- if index >= len(methods) {
- return nil, fmt.Errorf("method index %d out of range [0-%d)", index, len(methods))
- }
- obj = methods[index] // Id-ordered
-
- default:
- return nil, fmt.Errorf("cannot apply %q to %s (got %T, want interface or named)", code, t, t)
- }
- t = nil
-
- case opObj:
- hasObj, ok := t.(hasObj)
- if !ok {
- return nil, fmt.Errorf("cannot apply %q to %s (got %T, want named or type param)", code, t, t)
- }
- obj = hasObj.Obj()
- t = nil
-
- default:
- return nil, fmt.Errorf("invalid path: unknown code %q", code)
- }
- }
-
- if obj.Pkg() != pkg {
- return nil, fmt.Errorf("path denotes %s, which belongs to a different package", obj)
- }
-
- return obj, nil // success
-}
-
-// namedMethods returns the methods of a Named type in ascending Id order.
-func namedMethods(named *types.Named) []*types.Func {
- methods := make([]*types.Func, named.NumMethods())
- for i := range methods {
- methods[i] = named.Method(i)
- }
- sort.Slice(methods, func(i, j int) bool {
- return methods[i].Id() < methods[j].Id()
- })
- return methods
-}
-
-// namedMethods is a memoization of the namedMethods function. Callers must not modify the result.
-func (enc *Encoder) namedMethods(named *types.Named) []*types.Func {
- m := enc.namedMethodsMemo
- if m == nil {
- m = make(map[*types.Named][]*types.Func)
- enc.namedMethodsMemo = m
- }
- methods, ok := m[named]
- if !ok {
- methods = namedMethods(named) // allocates and sorts
- m[named] = methods
- }
- return methods
-}
-
-// scopeNames is a memoization of scope.Names. Callers must not modify the result.
-func (enc *Encoder) scopeNames(scope *types.Scope) []string {
- m := enc.scopeNamesMemo
- if m == nil {
- m = make(map[*types.Scope][]string)
- enc.scopeNamesMemo = m
- }
- names, ok := m[scope]
- if !ok {
- names = scope.Names() // allocates and sorts
- m[scope] = names
- }
- return names
-}
diff --git a/vendor/golang.org/x/tools/internal/event/tag/tag.go b/vendor/golang.org/x/tools/internal/event/tag/tag.go
new file mode 100644
index 00000000..ff2f2ecd
--- /dev/null
+++ b/vendor/golang.org/x/tools/internal/event/tag/tag.go
@@ -0,0 +1,59 @@
+// Copyright 2019 The Go Authors. All rights reserved.
+// Use of this source code is governed by a BSD-style
+// license that can be found in the LICENSE file.
+
+// Package tag provides the labels used for telemetry throughout gopls.
+package tag
+
+import (
+ "golang.org/x/tools/internal/event/keys"
+)
+
+var (
+ // create the label keys we use
+ Method = keys.NewString("method", "")
+ StatusCode = keys.NewString("status.code", "")
+ StatusMessage = keys.NewString("status.message", "")
+ RPCID = keys.NewString("id", "")
+ RPCDirection = keys.NewString("direction", "")
+ File = keys.NewString("file", "")
+ Directory = keys.New("directory", "")
+ URI = keys.New("URI", "")
+ Package = keys.NewString("package", "") // Package ID
+ PackagePath = keys.NewString("package_path", "")
+ Query = keys.New("query", "")
+ Snapshot = keys.NewUInt64("snapshot", "")
+ Operation = keys.NewString("operation", "")
+
+ Position = keys.New("position", "")
+ Category = keys.NewString("category", "")
+ PackageCount = keys.NewInt("packages", "")
+ Files = keys.New("files", "")
+ Port = keys.NewInt("port", "")
+ Type = keys.New("type", "")
+ HoverKind = keys.NewString("hoverkind", "")
+
+ NewServer = keys.NewString("new_server", "A new server was added")
+ EndServer = keys.NewString("end_server", "A server was shut down")
+
+ ServerID = keys.NewString("server", "The server ID an event is related to")
+ Logfile = keys.NewString("logfile", "")
+ DebugAddress = keys.NewString("debug_address", "")
+ GoplsPath = keys.NewString("gopls_path", "")
+ ClientID = keys.NewString("client_id", "")
+
+ Level = keys.NewInt("level", "The logging level")
+)
+
+var (
+ // create the stats we measure
+ Started = keys.NewInt64("started", "Count of started RPCs.")
+ ReceivedBytes = keys.NewInt64("received_bytes", "Bytes received.") //, unit.Bytes)
+ SentBytes = keys.NewInt64("sent_bytes", "Bytes sent.") //, unit.Bytes)
+ Latency = keys.NewFloat64("latency_ms", "Elapsed time in milliseconds") //, unit.Milliseconds)
+)
+
+const (
+ Inbound = "in"
+ Outbound = "out"
+)
diff --git a/vendor/golang.org/x/tools/internal/gcimporter/bexport.go b/vendor/golang.org/x/tools/internal/gcimporter/bexport.go
deleted file mode 100644
index 30582ed6..00000000
--- a/vendor/golang.org/x/tools/internal/gcimporter/bexport.go
+++ /dev/null
@@ -1,852 +0,0 @@
-// Copyright 2016 The Go Authors. All rights reserved.
-// Use of this source code is governed by a BSD-style
-// license that can be found in the LICENSE file.
-
-// Binary package export.
-// This file was derived from $GOROOT/src/cmd/compile/internal/gc/bexport.go;
-// see that file for specification of the format.
-
-package gcimporter
-
-import (
- "bytes"
- "encoding/binary"
- "fmt"
- "go/constant"
- "go/token"
- "go/types"
- "math"
- "math/big"
- "sort"
- "strings"
-)
-
-// If debugFormat is set, each integer and string value is preceded by a marker
-// and position information in the encoding. This mechanism permits an importer
-// to recognize immediately when it is out of sync. The importer recognizes this
-// mode automatically (i.e., it can import export data produced with debugging
-// support even if debugFormat is not set at the time of import). This mode will
-// lead to massively larger export data (by a factor of 2 to 3) and should only
-// be enabled during development and debugging.
-//
-// NOTE: This flag is the first flag to enable if importing dies because of
-// (suspected) format errors, and whenever a change is made to the format.
-const debugFormat = false // default: false
-
-// Current export format version. Increase with each format change.
-//
-// Note: The latest binary (non-indexed) export format is at version 6.
-// This exporter is still at level 4, but it doesn't matter since
-// the binary importer can handle older versions just fine.
-//
-// 6: package height (CL 105038) -- NOT IMPLEMENTED HERE
-// 5: improved position encoding efficiency (issue 20080, CL 41619) -- NOT IMPLEMENTED HERE
-// 4: type name objects support type aliases, uses aliasTag
-// 3: Go1.8 encoding (same as version 2, aliasTag defined but never used)
-// 2: removed unused bool in ODCL export (compiler only)
-// 1: header format change (more regular), export package for _ struct fields
-// 0: Go1.7 encoding
-const exportVersion = 4
-
-// trackAllTypes enables cycle tracking for all types, not just named
-// types. The existing compiler invariants assume that unnamed types
-// that are not completely set up are not used, or else there are spurious
-// errors.
-// If disabled, only named types are tracked, possibly leading to slightly
-// less efficient encoding in rare cases. It also prevents the export of
-// some corner-case type declarations (but those are not handled correctly
-// with with the textual export format either).
-// TODO(gri) enable and remove once issues caused by it are fixed
-const trackAllTypes = false
-
-type exporter struct {
- fset *token.FileSet
- out bytes.Buffer
-
- // object -> index maps, indexed in order of serialization
- strIndex map[string]int
- pkgIndex map[*types.Package]int
- typIndex map[types.Type]int
-
- // position encoding
- posInfoFormat bool
- prevFile string
- prevLine int
-
- // debugging support
- written int // bytes written
- indent int // for trace
-}
-
-// internalError represents an error generated inside this package.
-type internalError string
-
-func (e internalError) Error() string { return "gcimporter: " + string(e) }
-
-func internalErrorf(format string, args ...interface{}) error {
- return internalError(fmt.Sprintf(format, args...))
-}
-
-// BExportData returns binary export data for pkg.
-// If no file set is provided, position info will be missing.
-func BExportData(fset *token.FileSet, pkg *types.Package) (b []byte, err error) {
- if !debug {
- defer func() {
- if e := recover(); e != nil {
- if ierr, ok := e.(internalError); ok {
- err = ierr
- return
- }
- // Not an internal error; panic again.
- panic(e)
- }
- }()
- }
-
- p := exporter{
- fset: fset,
- strIndex: map[string]int{"": 0}, // empty string is mapped to 0
- pkgIndex: make(map[*types.Package]int),
- typIndex: make(map[types.Type]int),
- posInfoFormat: true, // TODO(gri) might become a flag, eventually
- }
-
- // write version info
- // The version string must start with "version %d" where %d is the version
- // number. Additional debugging information may follow after a blank; that
- // text is ignored by the importer.
- p.rawStringln(fmt.Sprintf("version %d", exportVersion))
- var debug string
- if debugFormat {
- debug = "debug"
- }
- p.rawStringln(debug) // cannot use p.bool since it's affected by debugFormat; also want to see this clearly
- p.bool(trackAllTypes)
- p.bool(p.posInfoFormat)
-
- // --- generic export data ---
-
- // populate type map with predeclared "known" types
- for index, typ := range predeclared() {
- p.typIndex[typ] = index
- }
- if len(p.typIndex) != len(predeclared()) {
- return nil, internalError("duplicate entries in type map?")
- }
-
- // write package data
- p.pkg(pkg, true)
- if trace {
- p.tracef("\n")
- }
-
- // write objects
- objcount := 0
- scope := pkg.Scope()
- for _, name := range scope.Names() {
- if !token.IsExported(name) {
- continue
- }
- if trace {
- p.tracef("\n")
- }
- p.obj(scope.Lookup(name))
- objcount++
- }
-
- // indicate end of list
- if trace {
- p.tracef("\n")
- }
- p.tag(endTag)
-
- // for self-verification only (redundant)
- p.int(objcount)
-
- if trace {
- p.tracef("\n")
- }
-
- // --- end of export data ---
-
- return p.out.Bytes(), nil
-}
-
-func (p *exporter) pkg(pkg *types.Package, emptypath bool) {
- if pkg == nil {
- panic(internalError("unexpected nil pkg"))
- }
-
- // if we saw the package before, write its index (>= 0)
- if i, ok := p.pkgIndex[pkg]; ok {
- p.index('P', i)
- return
- }
-
- // otherwise, remember the package, write the package tag (< 0) and package data
- if trace {
- p.tracef("P%d = { ", len(p.pkgIndex))
- defer p.tracef("} ")
- }
- p.pkgIndex[pkg] = len(p.pkgIndex)
-
- p.tag(packageTag)
- p.string(pkg.Name())
- if emptypath {
- p.string("")
- } else {
- p.string(pkg.Path())
- }
-}
-
-func (p *exporter) obj(obj types.Object) {
- switch obj := obj.(type) {
- case *types.Const:
- p.tag(constTag)
- p.pos(obj)
- p.qualifiedName(obj)
- p.typ(obj.Type())
- p.value(obj.Val())
-
- case *types.TypeName:
- if obj.IsAlias() {
- p.tag(aliasTag)
- p.pos(obj)
- p.qualifiedName(obj)
- } else {
- p.tag(typeTag)
- }
- p.typ(obj.Type())
-
- case *types.Var:
- p.tag(varTag)
- p.pos(obj)
- p.qualifiedName(obj)
- p.typ(obj.Type())
-
- case *types.Func:
- p.tag(funcTag)
- p.pos(obj)
- p.qualifiedName(obj)
- sig := obj.Type().(*types.Signature)
- p.paramList(sig.Params(), sig.Variadic())
- p.paramList(sig.Results(), false)
-
- default:
- panic(internalErrorf("unexpected object %v (%T)", obj, obj))
- }
-}
-
-func (p *exporter) pos(obj types.Object) {
- if !p.posInfoFormat {
- return
- }
-
- file, line := p.fileLine(obj)
- if file == p.prevFile {
- // common case: write line delta
- // delta == 0 means different file or no line change
- delta := line - p.prevLine
- p.int(delta)
- if delta == 0 {
- p.int(-1) // -1 means no file change
- }
- } else {
- // different file
- p.int(0)
- // Encode filename as length of common prefix with previous
- // filename, followed by (possibly empty) suffix. Filenames
- // frequently share path prefixes, so this can save a lot
- // of space and make export data size less dependent on file
- // path length. The suffix is unlikely to be empty because
- // file names tend to end in ".go".
- n := commonPrefixLen(p.prevFile, file)
- p.int(n) // n >= 0
- p.string(file[n:]) // write suffix only
- p.prevFile = file
- p.int(line)
- }
- p.prevLine = line
-}
-
-func (p *exporter) fileLine(obj types.Object) (file string, line int) {
- if p.fset != nil {
- pos := p.fset.Position(obj.Pos())
- file = pos.Filename
- line = pos.Line
- }
- return
-}
-
-func commonPrefixLen(a, b string) int {
- if len(a) > len(b) {
- a, b = b, a
- }
- // len(a) <= len(b)
- i := 0
- for i < len(a) && a[i] == b[i] {
- i++
- }
- return i
-}
-
-func (p *exporter) qualifiedName(obj types.Object) {
- p.string(obj.Name())
- p.pkg(obj.Pkg(), false)
-}
-
-func (p *exporter) typ(t types.Type) {
- if t == nil {
- panic(internalError("nil type"))
- }
-
- // Possible optimization: Anonymous pointer types *T where
- // T is a named type are common. We could canonicalize all
- // such types *T to a single type PT = *T. This would lead
- // to at most one *T entry in typIndex, and all future *T's
- // would be encoded as the respective index directly. Would
- // save 1 byte (pointerTag) per *T and reduce the typIndex
- // size (at the cost of a canonicalization map). We can do
- // this later, without encoding format change.
-
- // if we saw the type before, write its index (>= 0)
- if i, ok := p.typIndex[t]; ok {
- p.index('T', i)
- return
- }
-
- // otherwise, remember the type, write the type tag (< 0) and type data
- if trackAllTypes {
- if trace {
- p.tracef("T%d = {>\n", len(p.typIndex))
- defer p.tracef("<\n} ")
- }
- p.typIndex[t] = len(p.typIndex)
- }
-
- switch t := t.(type) {
- case *types.Named:
- if !trackAllTypes {
- // if we don't track all types, track named types now
- p.typIndex[t] = len(p.typIndex)
- }
-
- p.tag(namedTag)
- p.pos(t.Obj())
- p.qualifiedName(t.Obj())
- p.typ(t.Underlying())
- if !types.IsInterface(t) {
- p.assocMethods(t)
- }
-
- case *types.Array:
- p.tag(arrayTag)
- p.int64(t.Len())
- p.typ(t.Elem())
-
- case *types.Slice:
- p.tag(sliceTag)
- p.typ(t.Elem())
-
- case *dddSlice:
- p.tag(dddTag)
- p.typ(t.elem)
-
- case *types.Struct:
- p.tag(structTag)
- p.fieldList(t)
-
- case *types.Pointer:
- p.tag(pointerTag)
- p.typ(t.Elem())
-
- case *types.Signature:
- p.tag(signatureTag)
- p.paramList(t.Params(), t.Variadic())
- p.paramList(t.Results(), false)
-
- case *types.Interface:
- p.tag(interfaceTag)
- p.iface(t)
-
- case *types.Map:
- p.tag(mapTag)
- p.typ(t.Key())
- p.typ(t.Elem())
-
- case *types.Chan:
- p.tag(chanTag)
- p.int(int(3 - t.Dir())) // hack
- p.typ(t.Elem())
-
- default:
- panic(internalErrorf("unexpected type %T: %s", t, t))
- }
-}
-
-func (p *exporter) assocMethods(named *types.Named) {
- // Sort methods (for determinism).
- var methods []*types.Func
- for i := 0; i < named.NumMethods(); i++ {
- methods = append(methods, named.Method(i))
- }
- sort.Sort(methodsByName(methods))
-
- p.int(len(methods))
-
- if trace && methods != nil {
- p.tracef("associated methods {>\n")
- }
-
- for i, m := range methods {
- if trace && i > 0 {
- p.tracef("\n")
- }
-
- p.pos(m)
- name := m.Name()
- p.string(name)
- if !exported(name) {
- p.pkg(m.Pkg(), false)
- }
-
- sig := m.Type().(*types.Signature)
- p.paramList(types.NewTuple(sig.Recv()), false)
- p.paramList(sig.Params(), sig.Variadic())
- p.paramList(sig.Results(), false)
- p.int(0) // dummy value for go:nointerface pragma - ignored by importer
- }
-
- if trace && methods != nil {
- p.tracef("<\n} ")
- }
-}
-
-type methodsByName []*types.Func
-
-func (x methodsByName) Len() int { return len(x) }
-func (x methodsByName) Swap(i, j int) { x[i], x[j] = x[j], x[i] }
-func (x methodsByName) Less(i, j int) bool { return x[i].Name() < x[j].Name() }
-
-func (p *exporter) fieldList(t *types.Struct) {
- if trace && t.NumFields() > 0 {
- p.tracef("fields {>\n")
- defer p.tracef("<\n} ")
- }
-
- p.int(t.NumFields())
- for i := 0; i < t.NumFields(); i++ {
- if trace && i > 0 {
- p.tracef("\n")
- }
- p.field(t.Field(i))
- p.string(t.Tag(i))
- }
-}
-
-func (p *exporter) field(f *types.Var) {
- if !f.IsField() {
- panic(internalError("field expected"))
- }
-
- p.pos(f)
- p.fieldName(f)
- p.typ(f.Type())
-}
-
-func (p *exporter) iface(t *types.Interface) {
- // TODO(gri): enable importer to load embedded interfaces,
- // then emit Embeddeds and ExplicitMethods separately here.
- p.int(0)
-
- n := t.NumMethods()
- if trace && n > 0 {
- p.tracef("methods {>\n")
- defer p.tracef("<\n} ")
- }
- p.int(n)
- for i := 0; i < n; i++ {
- if trace && i > 0 {
- p.tracef("\n")
- }
- p.method(t.Method(i))
- }
-}
-
-func (p *exporter) method(m *types.Func) {
- sig := m.Type().(*types.Signature)
- if sig.Recv() == nil {
- panic(internalError("method expected"))
- }
-
- p.pos(m)
- p.string(m.Name())
- if m.Name() != "_" && !token.IsExported(m.Name()) {
- p.pkg(m.Pkg(), false)
- }
-
- // interface method; no need to encode receiver.
- p.paramList(sig.Params(), sig.Variadic())
- p.paramList(sig.Results(), false)
-}
-
-func (p *exporter) fieldName(f *types.Var) {
- name := f.Name()
-
- if f.Anonymous() {
- // anonymous field - we distinguish between 3 cases:
- // 1) field name matches base type name and is exported
- // 2) field name matches base type name and is not exported
- // 3) field name doesn't match base type name (alias name)
- bname := basetypeName(f.Type())
- if name == bname {
- if token.IsExported(name) {
- name = "" // 1) we don't need to know the field name or package
- } else {
- name = "?" // 2) use unexported name "?" to force package export
- }
- } else {
- // 3) indicate alias and export name as is
- // (this requires an extra "@" but this is a rare case)
- p.string("@")
- }
- }
-
- p.string(name)
- if name != "" && !token.IsExported(name) {
- p.pkg(f.Pkg(), false)
- }
-}
-
-func basetypeName(typ types.Type) string {
- switch typ := deref(typ).(type) {
- case *types.Basic:
- return typ.Name()
- case *types.Named:
- return typ.Obj().Name()
- default:
- return "" // unnamed type
- }
-}
-
-func (p *exporter) paramList(params *types.Tuple, variadic bool) {
- // use negative length to indicate unnamed parameters
- // (look at the first parameter only since either all
- // names are present or all are absent)
- n := params.Len()
- if n > 0 && params.At(0).Name() == "" {
- n = -n
- }
- p.int(n)
- for i := 0; i < params.Len(); i++ {
- q := params.At(i)
- t := q.Type()
- if variadic && i == params.Len()-1 {
- t = &dddSlice{t.(*types.Slice).Elem()}
- }
- p.typ(t)
- if n > 0 {
- name := q.Name()
- p.string(name)
- if name != "_" {
- p.pkg(q.Pkg(), false)
- }
- }
- p.string("") // no compiler-specific info
- }
-}
-
-func (p *exporter) value(x constant.Value) {
- if trace {
- p.tracef("= ")
- }
-
- switch x.Kind() {
- case constant.Bool:
- tag := falseTag
- if constant.BoolVal(x) {
- tag = trueTag
- }
- p.tag(tag)
-
- case constant.Int:
- if v, exact := constant.Int64Val(x); exact {
- // common case: x fits into an int64 - use compact encoding
- p.tag(int64Tag)
- p.int64(v)
- return
- }
- // uncommon case: large x - use float encoding
- // (powers of 2 will be encoded efficiently with exponent)
- p.tag(floatTag)
- p.float(constant.ToFloat(x))
-
- case constant.Float:
- p.tag(floatTag)
- p.float(x)
-
- case constant.Complex:
- p.tag(complexTag)
- p.float(constant.Real(x))
- p.float(constant.Imag(x))
-
- case constant.String:
- p.tag(stringTag)
- p.string(constant.StringVal(x))
-
- case constant.Unknown:
- // package contains type errors
- p.tag(unknownTag)
-
- default:
- panic(internalErrorf("unexpected value %v (%T)", x, x))
- }
-}
-
-func (p *exporter) float(x constant.Value) {
- if x.Kind() != constant.Float {
- panic(internalErrorf("unexpected constant %v, want float", x))
- }
- // extract sign (there is no -0)
- sign := constant.Sign(x)
- if sign == 0 {
- // x == 0
- p.int(0)
- return
- }
- // x != 0
-
- var f big.Float
- if v, exact := constant.Float64Val(x); exact {
- // float64
- f.SetFloat64(v)
- } else if num, denom := constant.Num(x), constant.Denom(x); num.Kind() == constant.Int {
- // TODO(gri): add big.Rat accessor to constant.Value.
- r := valueToRat(num)
- f.SetRat(r.Quo(r, valueToRat(denom)))
- } else {
- // Value too large to represent as a fraction => inaccessible.
- // TODO(gri): add big.Float accessor to constant.Value.
- f.SetFloat64(math.MaxFloat64) // FIXME
- }
-
- // extract exponent such that 0.5 <= m < 1.0
- var m big.Float
- exp := f.MantExp(&m)
-
- // extract mantissa as *big.Int
- // - set exponent large enough so mant satisfies mant.IsInt()
- // - get *big.Int from mant
- m.SetMantExp(&m, int(m.MinPrec()))
- mant, acc := m.Int(nil)
- if acc != big.Exact {
- panic(internalError("internal error"))
- }
-
- p.int(sign)
- p.int(exp)
- p.string(string(mant.Bytes()))
-}
-
-func valueToRat(x constant.Value) *big.Rat {
- // Convert little-endian to big-endian.
- // I can't believe this is necessary.
- bytes := constant.Bytes(x)
- for i := 0; i < len(bytes)/2; i++ {
- bytes[i], bytes[len(bytes)-1-i] = bytes[len(bytes)-1-i], bytes[i]
- }
- return new(big.Rat).SetInt(new(big.Int).SetBytes(bytes))
-}
-
-func (p *exporter) bool(b bool) bool {
- if trace {
- p.tracef("[")
- defer p.tracef("= %v] ", b)
- }
-
- x := 0
- if b {
- x = 1
- }
- p.int(x)
- return b
-}
-
-// ----------------------------------------------------------------------------
-// Low-level encoders
-
-func (p *exporter) index(marker byte, index int) {
- if index < 0 {
- panic(internalError("invalid index < 0"))
- }
- if debugFormat {
- p.marker('t')
- }
- if trace {
- p.tracef("%c%d ", marker, index)
- }
- p.rawInt64(int64(index))
-}
-
-func (p *exporter) tag(tag int) {
- if tag >= 0 {
- panic(internalError("invalid tag >= 0"))
- }
- if debugFormat {
- p.marker('t')
- }
- if trace {
- p.tracef("%s ", tagString[-tag])
- }
- p.rawInt64(int64(tag))
-}
-
-func (p *exporter) int(x int) {
- p.int64(int64(x))
-}
-
-func (p *exporter) int64(x int64) {
- if debugFormat {
- p.marker('i')
- }
- if trace {
- p.tracef("%d ", x)
- }
- p.rawInt64(x)
-}
-
-func (p *exporter) string(s string) {
- if debugFormat {
- p.marker('s')
- }
- if trace {
- p.tracef("%q ", s)
- }
- // if we saw the string before, write its index (>= 0)
- // (the empty string is mapped to 0)
- if i, ok := p.strIndex[s]; ok {
- p.rawInt64(int64(i))
- return
- }
- // otherwise, remember string and write its negative length and bytes
- p.strIndex[s] = len(p.strIndex)
- p.rawInt64(-int64(len(s)))
- for i := 0; i < len(s); i++ {
- p.rawByte(s[i])
- }
-}
-
-// marker emits a marker byte and position information which makes
-// it easy for a reader to detect if it is "out of sync". Used for
-// debugFormat format only.
-func (p *exporter) marker(m byte) {
- p.rawByte(m)
- // Enable this for help tracking down the location
- // of an incorrect marker when running in debugFormat.
- if false && trace {
- p.tracef("#%d ", p.written)
- }
- p.rawInt64(int64(p.written))
-}
-
-// rawInt64 should only be used by low-level encoders.
-func (p *exporter) rawInt64(x int64) {
- var tmp [binary.MaxVarintLen64]byte
- n := binary.PutVarint(tmp[:], x)
- for i := 0; i < n; i++ {
- p.rawByte(tmp[i])
- }
-}
-
-// rawStringln should only be used to emit the initial version string.
-func (p *exporter) rawStringln(s string) {
- for i := 0; i < len(s); i++ {
- p.rawByte(s[i])
- }
- p.rawByte('\n')
-}
-
-// rawByte is the bottleneck interface to write to p.out.
-// rawByte escapes b as follows (any encoding does that
-// hides '$'):
-//
-// '$' => '|' 'S'
-// '|' => '|' '|'
-//
-// Necessary so other tools can find the end of the
-// export data by searching for "$$".
-// rawByte should only be used by low-level encoders.
-func (p *exporter) rawByte(b byte) {
- switch b {
- case '$':
- // write '$' as '|' 'S'
- b = 'S'
- fallthrough
- case '|':
- // write '|' as '|' '|'
- p.out.WriteByte('|')
- p.written++
- }
- p.out.WriteByte(b)
- p.written++
-}
-
-// tracef is like fmt.Printf but it rewrites the format string
-// to take care of indentation.
-func (p *exporter) tracef(format string, args ...interface{}) {
- if strings.ContainsAny(format, "<>\n") {
- var buf bytes.Buffer
- for i := 0; i < len(format); i++ {
- // no need to deal with runes
- ch := format[i]
- switch ch {
- case '>':
- p.indent++
- continue
- case '<':
- p.indent--
- continue
- }
- buf.WriteByte(ch)
- if ch == '\n' {
- for j := p.indent; j > 0; j-- {
- buf.WriteString(". ")
- }
- }
- }
- format = buf.String()
- }
- fmt.Printf(format, args...)
-}
-
-// Debugging support.
-// (tagString is only used when tracing is enabled)
-var tagString = [...]string{
- // Packages
- -packageTag: "package",
-
- // Types
- -namedTag: "named type",
- -arrayTag: "array",
- -sliceTag: "slice",
- -dddTag: "ddd",
- -structTag: "struct",
- -pointerTag: "pointer",
- -signatureTag: "signature",
- -interfaceTag: "interface",
- -mapTag: "map",
- -chanTag: "chan",
-
- // Values
- -falseTag: "false",
- -trueTag: "true",
- -int64Tag: "int64",
- -floatTag: "float",
- -fractionTag: "fraction",
- -complexTag: "complex",
- -stringTag: "string",
- -unknownTag: "unknown",
-
- // Type aliases
- -aliasTag: "alias",
-}
diff --git a/vendor/golang.org/x/tools/internal/gcimporter/bimport.go b/vendor/golang.org/x/tools/internal/gcimporter/bimport.go
index b85de014..d98b0db2 100644
--- a/vendor/golang.org/x/tools/internal/gcimporter/bimport.go
+++ b/vendor/golang.org/x/tools/internal/gcimporter/bimport.go
@@ -2,340 +2,24 @@
// Use of this source code is governed by a BSD-style
// license that can be found in the LICENSE file.
-// This file is a copy of $GOROOT/src/go/internal/gcimporter/bimport.go.
+// This file contains the remaining vestiges of
+// $GOROOT/src/go/internal/gcimporter/bimport.go.
package gcimporter
import (
- "encoding/binary"
"fmt"
- "go/constant"
"go/token"
"go/types"
- "sort"
- "strconv"
- "strings"
"sync"
- "unicode"
- "unicode/utf8"
)
-type importer struct {
- imports map[string]*types.Package
- data []byte
- importpath string
- buf []byte // for reading strings
- version int // export format version
-
- // object lists
- strList []string // in order of appearance
- pathList []string // in order of appearance
- pkgList []*types.Package // in order of appearance
- typList []types.Type // in order of appearance
- interfaceList []*types.Interface // for delayed completion only
- trackAllTypes bool
-
- // position encoding
- posInfoFormat bool
- prevFile string
- prevLine int
- fake fakeFileSet
-
- // debugging support
- debugFormat bool
- read int // bytes read
-}
-
-// BImportData imports a package from the serialized package data
-// and returns the number of bytes consumed and a reference to the package.
-// If the export data version is not recognized or the format is otherwise
-// compromised, an error is returned.
-func BImportData(fset *token.FileSet, imports map[string]*types.Package, data []byte, path string) (_ int, pkg *types.Package, err error) {
- // catch panics and return them as errors
- const currentVersion = 6
- version := -1 // unknown version
- defer func() {
- if e := recover(); e != nil {
- // Return a (possibly nil or incomplete) package unchanged (see #16088).
- if version > currentVersion {
- err = fmt.Errorf("cannot import %q (%v), export data is newer version - update tool", path, e)
- } else {
- err = fmt.Errorf("cannot import %q (%v), possibly version skew - reinstall package", path, e)
- }
- }
- }()
-
- p := importer{
- imports: imports,
- data: data,
- importpath: path,
- version: version,
- strList: []string{""}, // empty string is mapped to 0
- pathList: []string{""}, // empty string is mapped to 0
- fake: fakeFileSet{
- fset: fset,
- files: make(map[string]*fileInfo),
- },
- }
- defer p.fake.setLines() // set lines for files in fset
-
- // read version info
- var versionstr string
- if b := p.rawByte(); b == 'c' || b == 'd' {
- // Go1.7 encoding; first byte encodes low-level
- // encoding format (compact vs debug).
- // For backward-compatibility only (avoid problems with
- // old installed packages). Newly compiled packages use
- // the extensible format string.
- // TODO(gri) Remove this support eventually; after Go1.8.
- if b == 'd' {
- p.debugFormat = true
- }
- p.trackAllTypes = p.rawByte() == 'a'
- p.posInfoFormat = p.int() != 0
- versionstr = p.string()
- if versionstr == "v1" {
- version = 0
- }
- } else {
- // Go1.8 extensible encoding
- // read version string and extract version number (ignore anything after the version number)
- versionstr = p.rawStringln(b)
- if s := strings.SplitN(versionstr, " ", 3); len(s) >= 2 && s[0] == "version" {
- if v, err := strconv.Atoi(s[1]); err == nil && v > 0 {
- version = v
- }
- }
- }
- p.version = version
-
- // read version specific flags - extend as necessary
- switch p.version {
- // case currentVersion:
- // ...
- // fallthrough
- case currentVersion, 5, 4, 3, 2, 1:
- p.debugFormat = p.rawStringln(p.rawByte()) == "debug"
- p.trackAllTypes = p.int() != 0
- p.posInfoFormat = p.int() != 0
- case 0:
- // Go1.7 encoding format - nothing to do here
- default:
- errorf("unknown bexport format version %d (%q)", p.version, versionstr)
- }
-
- // --- generic export data ---
-
- // populate typList with predeclared "known" types
- p.typList = append(p.typList, predeclared()...)
-
- // read package data
- pkg = p.pkg()
-
- // read objects of phase 1 only (see cmd/compile/internal/gc/bexport.go)
- objcount := 0
- for {
- tag := p.tagOrIndex()
- if tag == endTag {
- break
- }
- p.obj(tag)
- objcount++
- }
-
- // self-verification
- if count := p.int(); count != objcount {
- errorf("got %d objects; want %d", objcount, count)
- }
-
- // ignore compiler-specific import data
-
- // complete interfaces
- // TODO(gri) re-investigate if we still need to do this in a delayed fashion
- for _, typ := range p.interfaceList {
- typ.Complete()
- }
-
- // record all referenced packages as imports
- list := append(([]*types.Package)(nil), p.pkgList[1:]...)
- sort.Sort(byPath(list))
- pkg.SetImports(list)
-
- // package was imported completely and without errors
- pkg.MarkComplete()
-
- return p.read, pkg, nil
-}
-
func errorf(format string, args ...interface{}) {
panic(fmt.Sprintf(format, args...))
}
-func (p *importer) pkg() *types.Package {
- // if the package was seen before, i is its index (>= 0)
- i := p.tagOrIndex()
- if i >= 0 {
- return p.pkgList[i]
- }
-
- // otherwise, i is the package tag (< 0)
- if i != packageTag {
- errorf("unexpected package tag %d version %d", i, p.version)
- }
-
- // read package data
- name := p.string()
- var path string
- if p.version >= 5 {
- path = p.path()
- } else {
- path = p.string()
- }
- if p.version >= 6 {
- p.int() // package height; unused by go/types
- }
-
- // we should never see an empty package name
- if name == "" {
- errorf("empty package name in import")
- }
-
- // an empty path denotes the package we are currently importing;
- // it must be the first package we see
- if (path == "") != (len(p.pkgList) == 0) {
- errorf("package path %q for pkg index %d", path, len(p.pkgList))
- }
-
- // if the package was imported before, use that one; otherwise create a new one
- if path == "" {
- path = p.importpath
- }
- pkg := p.imports[path]
- if pkg == nil {
- pkg = types.NewPackage(path, name)
- p.imports[path] = pkg
- } else if pkg.Name() != name {
- errorf("conflicting names %s and %s for package %q", pkg.Name(), name, path)
- }
- p.pkgList = append(p.pkgList, pkg)
-
- return pkg
-}
-
-// objTag returns the tag value for each object kind.
-func objTag(obj types.Object) int {
- switch obj.(type) {
- case *types.Const:
- return constTag
- case *types.TypeName:
- return typeTag
- case *types.Var:
- return varTag
- case *types.Func:
- return funcTag
- default:
- errorf("unexpected object: %v (%T)", obj, obj) // panics
- panic("unreachable")
- }
-}
-
-func sameObj(a, b types.Object) bool {
- // Because unnamed types are not canonicalized, we cannot simply compare types for
- // (pointer) identity.
- // Ideally we'd check equality of constant values as well, but this is good enough.
- return objTag(a) == objTag(b) && types.Identical(a.Type(), b.Type())
-}
-
-func (p *importer) declare(obj types.Object) {
- pkg := obj.Pkg()
- if alt := pkg.Scope().Insert(obj); alt != nil {
- // This can only trigger if we import a (non-type) object a second time.
- // Excluding type aliases, this cannot happen because 1) we only import a package
- // once; and b) we ignore compiler-specific export data which may contain
- // functions whose inlined function bodies refer to other functions that
- // were already imported.
- // However, type aliases require reexporting the original type, so we need
- // to allow it (see also the comment in cmd/compile/internal/gc/bimport.go,
- // method importer.obj, switch case importing functions).
- // TODO(gri) review/update this comment once the gc compiler handles type aliases.
- if !sameObj(obj, alt) {
- errorf("inconsistent import:\n\t%v\npreviously imported as:\n\t%v\n", obj, alt)
- }
- }
-}
-
-func (p *importer) obj(tag int) {
- switch tag {
- case constTag:
- pos := p.pos()
- pkg, name := p.qualifiedName()
- typ := p.typ(nil, nil)
- val := p.value()
- p.declare(types.NewConst(pos, pkg, name, typ, val))
-
- case aliasTag:
- // TODO(gri) verify type alias hookup is correct
- pos := p.pos()
- pkg, name := p.qualifiedName()
- typ := p.typ(nil, nil)
- p.declare(types.NewTypeName(pos, pkg, name, typ))
-
- case typeTag:
- p.typ(nil, nil)
-
- case varTag:
- pos := p.pos()
- pkg, name := p.qualifiedName()
- typ := p.typ(nil, nil)
- p.declare(types.NewVar(pos, pkg, name, typ))
-
- case funcTag:
- pos := p.pos()
- pkg, name := p.qualifiedName()
- params, isddd := p.paramList()
- result, _ := p.paramList()
- sig := types.NewSignature(nil, params, result, isddd)
- p.declare(types.NewFunc(pos, pkg, name, sig))
-
- default:
- errorf("unexpected object tag %d", tag)
- }
-}
-
const deltaNewFile = -64 // see cmd/compile/internal/gc/bexport.go
-func (p *importer) pos() token.Pos {
- if !p.posInfoFormat {
- return token.NoPos
- }
-
- file := p.prevFile
- line := p.prevLine
- delta := p.int()
- line += delta
- if p.version >= 5 {
- if delta == deltaNewFile {
- if n := p.int(); n >= 0 {
- // file changed
- file = p.path()
- line = n
- }
- }
- } else {
- if delta == 0 {
- if n := p.int(); n >= 0 {
- // file changed
- file = p.prevFile[:n] + p.string()
- line = p.int()
- }
- }
- }
- p.prevFile = file
- p.prevLine = line
-
- return p.fake.pos(file, line, 0)
-}
-
// Synthesize a token.Pos
type fakeFileSet struct {
fset *token.FileSet
@@ -389,205 +73,6 @@ var (
fakeLinesOnce sync.Once
)
-func (p *importer) qualifiedName() (pkg *types.Package, name string) {
- name = p.string()
- pkg = p.pkg()
- return
-}
-
-func (p *importer) record(t types.Type) {
- p.typList = append(p.typList, t)
-}
-
-// A dddSlice is a types.Type representing ...T parameters.
-// It only appears for parameter types and does not escape
-// the importer.
-type dddSlice struct {
- elem types.Type
-}
-
-func (t *dddSlice) Underlying() types.Type { return t }
-func (t *dddSlice) String() string { return "..." + t.elem.String() }
-
-// parent is the package which declared the type; parent == nil means
-// the package currently imported. The parent package is needed for
-// exported struct fields and interface methods which don't contain
-// explicit package information in the export data.
-//
-// A non-nil tname is used as the "owner" of the result type; i.e.,
-// the result type is the underlying type of tname. tname is used
-// to give interface methods a named receiver type where possible.
-func (p *importer) typ(parent *types.Package, tname *types.Named) types.Type {
- // if the type was seen before, i is its index (>= 0)
- i := p.tagOrIndex()
- if i >= 0 {
- return p.typList[i]
- }
-
- // otherwise, i is the type tag (< 0)
- switch i {
- case namedTag:
- // read type object
- pos := p.pos()
- parent, name := p.qualifiedName()
- scope := parent.Scope()
- obj := scope.Lookup(name)
-
- // if the object doesn't exist yet, create and insert it
- if obj == nil {
- obj = types.NewTypeName(pos, parent, name, nil)
- scope.Insert(obj)
- }
-
- if _, ok := obj.(*types.TypeName); !ok {
- errorf("pkg = %s, name = %s => %s", parent, name, obj)
- }
-
- // associate new named type with obj if it doesn't exist yet
- t0 := types.NewNamed(obj.(*types.TypeName), nil, nil)
-
- // but record the existing type, if any
- tname := obj.Type().(*types.Named) // tname is either t0 or the existing type
- p.record(tname)
-
- // read underlying type
- t0.SetUnderlying(p.typ(parent, t0))
-
- // interfaces don't have associated methods
- if types.IsInterface(t0) {
- return tname
- }
-
- // read associated methods
- for i := p.int(); i > 0; i-- {
- // TODO(gri) replace this with something closer to fieldName
- pos := p.pos()
- name := p.string()
- if !exported(name) {
- p.pkg()
- }
-
- recv, _ := p.paramList() // TODO(gri) do we need a full param list for the receiver?
- params, isddd := p.paramList()
- result, _ := p.paramList()
- p.int() // go:nointerface pragma - discarded
-
- sig := types.NewSignature(recv.At(0), params, result, isddd)
- t0.AddMethod(types.NewFunc(pos, parent, name, sig))
- }
-
- return tname
-
- case arrayTag:
- t := new(types.Array)
- if p.trackAllTypes {
- p.record(t)
- }
-
- n := p.int64()
- *t = *types.NewArray(p.typ(parent, nil), n)
- return t
-
- case sliceTag:
- t := new(types.Slice)
- if p.trackAllTypes {
- p.record(t)
- }
-
- *t = *types.NewSlice(p.typ(parent, nil))
- return t
-
- case dddTag:
- t := new(dddSlice)
- if p.trackAllTypes {
- p.record(t)
- }
-
- t.elem = p.typ(parent, nil)
- return t
-
- case structTag:
- t := new(types.Struct)
- if p.trackAllTypes {
- p.record(t)
- }
-
- *t = *types.NewStruct(p.fieldList(parent))
- return t
-
- case pointerTag:
- t := new(types.Pointer)
- if p.trackAllTypes {
- p.record(t)
- }
-
- *t = *types.NewPointer(p.typ(parent, nil))
- return t
-
- case signatureTag:
- t := new(types.Signature)
- if p.trackAllTypes {
- p.record(t)
- }
-
- params, isddd := p.paramList()
- result, _ := p.paramList()
- *t = *types.NewSignature(nil, params, result, isddd)
- return t
-
- case interfaceTag:
- // Create a dummy entry in the type list. This is safe because we
- // cannot expect the interface type to appear in a cycle, as any
- // such cycle must contain a named type which would have been
- // first defined earlier.
- // TODO(gri) Is this still true now that we have type aliases?
- // See issue #23225.
- n := len(p.typList)
- if p.trackAllTypes {
- p.record(nil)
- }
-
- var embeddeds []types.Type
- for n := p.int(); n > 0; n-- {
- p.pos()
- embeddeds = append(embeddeds, p.typ(parent, nil))
- }
-
- t := newInterface(p.methodList(parent, tname), embeddeds)
- p.interfaceList = append(p.interfaceList, t)
- if p.trackAllTypes {
- p.typList[n] = t
- }
- return t
-
- case mapTag:
- t := new(types.Map)
- if p.trackAllTypes {
- p.record(t)
- }
-
- key := p.typ(parent, nil)
- val := p.typ(parent, nil)
- *t = *types.NewMap(key, val)
- return t
-
- case chanTag:
- t := new(types.Chan)
- if p.trackAllTypes {
- p.record(t)
- }
-
- dir := chanDir(p.int())
- val := p.typ(parent, nil)
- *t = *types.NewChan(dir, val)
- return t
-
- default:
- errorf("unexpected type tag %d", i) // panics
- panic("unreachable")
- }
-}
-
func chanDir(d int) types.ChanDir {
// tag values must match the constants in cmd/compile/internal/gc/go.go
switch d {
@@ -603,394 +88,6 @@ func chanDir(d int) types.ChanDir {
}
}
-func (p *importer) fieldList(parent *types.Package) (fields []*types.Var, tags []string) {
- if n := p.int(); n > 0 {
- fields = make([]*types.Var, n)
- tags = make([]string, n)
- for i := range fields {
- fields[i], tags[i] = p.field(parent)
- }
- }
- return
-}
-
-func (p *importer) field(parent *types.Package) (*types.Var, string) {
- pos := p.pos()
- pkg, name, alias := p.fieldName(parent)
- typ := p.typ(parent, nil)
- tag := p.string()
-
- anonymous := false
- if name == "" {
- // anonymous field - typ must be T or *T and T must be a type name
- switch typ := deref(typ).(type) {
- case *types.Basic: // basic types are named types
- pkg = nil // // objects defined in Universe scope have no package
- name = typ.Name()
- case *types.Named:
- name = typ.Obj().Name()
- default:
- errorf("named base type expected")
- }
- anonymous = true
- } else if alias {
- // anonymous field: we have an explicit name because it's an alias
- anonymous = true
- }
-
- return types.NewField(pos, pkg, name, typ, anonymous), tag
-}
-
-func (p *importer) methodList(parent *types.Package, baseType *types.Named) (methods []*types.Func) {
- if n := p.int(); n > 0 {
- methods = make([]*types.Func, n)
- for i := range methods {
- methods[i] = p.method(parent, baseType)
- }
- }
- return
-}
-
-func (p *importer) method(parent *types.Package, baseType *types.Named) *types.Func {
- pos := p.pos()
- pkg, name, _ := p.fieldName(parent)
- // If we don't have a baseType, use a nil receiver.
- // A receiver using the actual interface type (which
- // we don't know yet) will be filled in when we call
- // types.Interface.Complete.
- var recv *types.Var
- if baseType != nil {
- recv = types.NewVar(token.NoPos, parent, "", baseType)
- }
- params, isddd := p.paramList()
- result, _ := p.paramList()
- sig := types.NewSignature(recv, params, result, isddd)
- return types.NewFunc(pos, pkg, name, sig)
-}
-
-func (p *importer) fieldName(parent *types.Package) (pkg *types.Package, name string, alias bool) {
- name = p.string()
- pkg = parent
- if pkg == nil {
- // use the imported package instead
- pkg = p.pkgList[0]
- }
- if p.version == 0 && name == "_" {
- // version 0 didn't export a package for _ fields
- return
- }
- switch name {
- case "":
- // 1) field name matches base type name and is exported: nothing to do
- case "?":
- // 2) field name matches base type name and is not exported: need package
- name = ""
- pkg = p.pkg()
- case "@":
- // 3) field name doesn't match type name (alias)
- name = p.string()
- alias = true
- fallthrough
- default:
- if !exported(name) {
- pkg = p.pkg()
- }
- }
- return
-}
-
-func (p *importer) paramList() (*types.Tuple, bool) {
- n := p.int()
- if n == 0 {
- return nil, false
- }
- // negative length indicates unnamed parameters
- named := true
- if n < 0 {
- n = -n
- named = false
- }
- // n > 0
- params := make([]*types.Var, n)
- isddd := false
- for i := range params {
- params[i], isddd = p.param(named)
- }
- return types.NewTuple(params...), isddd
-}
-
-func (p *importer) param(named bool) (*types.Var, bool) {
- t := p.typ(nil, nil)
- td, isddd := t.(*dddSlice)
- if isddd {
- t = types.NewSlice(td.elem)
- }
-
- var pkg *types.Package
- var name string
- if named {
- name = p.string()
- if name == "" {
- errorf("expected named parameter")
- }
- if name != "_" {
- pkg = p.pkg()
- }
- if i := strings.Index(name, "·"); i > 0 {
- name = name[:i] // cut off gc-specific parameter numbering
- }
- }
-
- // read and discard compiler-specific info
- p.string()
-
- return types.NewVar(token.NoPos, pkg, name, t), isddd
-}
-
-func exported(name string) bool {
- ch, _ := utf8.DecodeRuneInString(name)
- return unicode.IsUpper(ch)
-}
-
-func (p *importer) value() constant.Value {
- switch tag := p.tagOrIndex(); tag {
- case falseTag:
- return constant.MakeBool(false)
- case trueTag:
- return constant.MakeBool(true)
- case int64Tag:
- return constant.MakeInt64(p.int64())
- case floatTag:
- return p.float()
- case complexTag:
- re := p.float()
- im := p.float()
- return constant.BinaryOp(re, token.ADD, constant.MakeImag(im))
- case stringTag:
- return constant.MakeString(p.string())
- case unknownTag:
- return constant.MakeUnknown()
- default:
- errorf("unexpected value tag %d", tag) // panics
- panic("unreachable")
- }
-}
-
-func (p *importer) float() constant.Value {
- sign := p.int()
- if sign == 0 {
- return constant.MakeInt64(0)
- }
-
- exp := p.int()
- mant := []byte(p.string()) // big endian
-
- // remove leading 0's if any
- for len(mant) > 0 && mant[0] == 0 {
- mant = mant[1:]
- }
-
- // convert to little endian
- // TODO(gri) go/constant should have a more direct conversion function
- // (e.g., once it supports a big.Float based implementation)
- for i, j := 0, len(mant)-1; i < j; i, j = i+1, j-1 {
- mant[i], mant[j] = mant[j], mant[i]
- }
-
- // adjust exponent (constant.MakeFromBytes creates an integer value,
- // but mant represents the mantissa bits such that 0.5 <= mant < 1.0)
- exp -= len(mant) << 3
- if len(mant) > 0 {
- for msd := mant[len(mant)-1]; msd&0x80 == 0; msd <<= 1 {
- exp++
- }
- }
-
- x := constant.MakeFromBytes(mant)
- switch {
- case exp < 0:
- d := constant.Shift(constant.MakeInt64(1), token.SHL, uint(-exp))
- x = constant.BinaryOp(x, token.QUO, d)
- case exp > 0:
- x = constant.Shift(x, token.SHL, uint(exp))
- }
-
- if sign < 0 {
- x = constant.UnaryOp(token.SUB, x, 0)
- }
- return x
-}
-
-// ----------------------------------------------------------------------------
-// Low-level decoders
-
-func (p *importer) tagOrIndex() int {
- if p.debugFormat {
- p.marker('t')
- }
-
- return int(p.rawInt64())
-}
-
-func (p *importer) int() int {
- x := p.int64()
- if int64(int(x)) != x {
- errorf("exported integer too large")
- }
- return int(x)
-}
-
-func (p *importer) int64() int64 {
- if p.debugFormat {
- p.marker('i')
- }
-
- return p.rawInt64()
-}
-
-func (p *importer) path() string {
- if p.debugFormat {
- p.marker('p')
- }
- // if the path was seen before, i is its index (>= 0)
- // (the empty string is at index 0)
- i := p.rawInt64()
- if i >= 0 {
- return p.pathList[i]
- }
- // otherwise, i is the negative path length (< 0)
- a := make([]string, -i)
- for n := range a {
- a[n] = p.string()
- }
- s := strings.Join(a, "/")
- p.pathList = append(p.pathList, s)
- return s
-}
-
-func (p *importer) string() string {
- if p.debugFormat {
- p.marker('s')
- }
- // if the string was seen before, i is its index (>= 0)
- // (the empty string is at index 0)
- i := p.rawInt64()
- if i >= 0 {
- return p.strList[i]
- }
- // otherwise, i is the negative string length (< 0)
- if n := int(-i); n <= cap(p.buf) {
- p.buf = p.buf[:n]
- } else {
- p.buf = make([]byte, n)
- }
- for i := range p.buf {
- p.buf[i] = p.rawByte()
- }
- s := string(p.buf)
- p.strList = append(p.strList, s)
- return s
-}
-
-func (p *importer) marker(want byte) {
- if got := p.rawByte(); got != want {
- errorf("incorrect marker: got %c; want %c (pos = %d)", got, want, p.read)
- }
-
- pos := p.read
- if n := int(p.rawInt64()); n != pos {
- errorf("incorrect position: got %d; want %d", n, pos)
- }
-}
-
-// rawInt64 should only be used by low-level decoders.
-func (p *importer) rawInt64() int64 {
- i, err := binary.ReadVarint(p)
- if err != nil {
- errorf("read error: %v", err)
- }
- return i
-}
-
-// rawStringln should only be used to read the initial version string.
-func (p *importer) rawStringln(b byte) string {
- p.buf = p.buf[:0]
- for b != '\n' {
- p.buf = append(p.buf, b)
- b = p.rawByte()
- }
- return string(p.buf)
-}
-
-// needed for binary.ReadVarint in rawInt64
-func (p *importer) ReadByte() (byte, error) {
- return p.rawByte(), nil
-}
-
-// byte is the bottleneck interface for reading p.data.
-// It unescapes '|' 'S' to '$' and '|' '|' to '|'.
-// rawByte should only be used by low-level decoders.
-func (p *importer) rawByte() byte {
- b := p.data[0]
- r := 1
- if b == '|' {
- b = p.data[1]
- r = 2
- switch b {
- case 'S':
- b = '$'
- case '|':
- // nothing to do
- default:
- errorf("unexpected escape sequence in export data")
- }
- }
- p.data = p.data[r:]
- p.read += r
- return b
-
-}
-
-// ----------------------------------------------------------------------------
-// Export format
-
-// Tags. Must be < 0.
-const (
- // Objects
- packageTag = -(iota + 1)
- constTag
- typeTag
- varTag
- funcTag
- endTag
-
- // Types
- namedTag
- arrayTag
- sliceTag
- dddTag
- structTag
- pointerTag
- signatureTag
- interfaceTag
- mapTag
- chanTag
-
- // Values
- falseTag
- trueTag
- int64Tag
- floatTag
- fractionTag // not used by gc
- complexTag
- stringTag
- nilTag // only used by gc (appears in exported inlined function bodies)
- unknownTag // not used by gc (only appears in packages with errors)
-
- // Type aliases
- aliasTag
-)
-
var predeclOnce sync.Once
var predecl []types.Type // initialized lazily
diff --git a/vendor/golang.org/x/tools/internal/gcimporter/gcimporter.go b/vendor/golang.org/x/tools/internal/gcimporter/gcimporter.go
index a973dece..b1223713 100644
--- a/vendor/golang.org/x/tools/internal/gcimporter/gcimporter.go
+++ b/vendor/golang.org/x/tools/internal/gcimporter/gcimporter.go
@@ -230,20 +230,17 @@ func Import(packages map[string]*types.Package, path, srcDir string, lookup func
// Or, define a new standard go/types/gcexportdata package.
fset := token.NewFileSet()
- // The indexed export format starts with an 'i'; the older
- // binary export format starts with a 'c', 'd', or 'v'
- // (from "version"). Select appropriate importer.
+ // Select appropriate importer.
if len(data) > 0 {
switch data[0] {
- case 'i':
+ case 'v', 'c', 'd': // binary, till go1.10
+ return nil, fmt.Errorf("binary (%c) import format is no longer supported", data[0])
+
+ case 'i': // indexed, till go1.19
_, pkg, err := IImportData(fset, packages, data[1:], id)
return pkg, err
- case 'v', 'c', 'd':
- _, pkg, err := BImportData(fset, packages, data, id)
- return pkg, err
-
- case 'u':
+ case 'u': // unified, from go1.20
_, pkg, err := UImportData(fset, packages, data[1:size], id)
return pkg, err
diff --git a/vendor/golang.org/x/tools/internal/gcimporter/iexport.go b/vendor/golang.org/x/tools/internal/gcimporter/iexport.go
index a0dc0b5e..3fc7989c 100644
--- a/vendor/golang.org/x/tools/internal/gcimporter/iexport.go
+++ b/vendor/golang.org/x/tools/internal/gcimporter/iexport.go
@@ -913,6 +913,17 @@ func (w *exportWriter) value(typ types.Type, v constant.Value) {
w.int64(int64(v.Kind()))
}
+ if v.Kind() == constant.Unknown {
+ // golang/go#60605: treat unknown constant values as if they have invalid type
+ //
+ // This loses some fidelity over the package type-checked from source, but that
+ // is acceptable.
+ //
+ // TODO(rfindley): we should switch on the recorded constant kind rather
+ // than the constant type
+ return
+ }
+
switch b := typ.Underlying().(*types.Basic); b.Info() & types.IsConstType {
case types.IsBoolean:
w.bool(constant.BoolVal(v))
@@ -969,6 +980,16 @@ func constantToFloat(x constant.Value) *big.Float {
return &f
}
+func valueToRat(x constant.Value) *big.Rat {
+ // Convert little-endian to big-endian.
+ // I can't believe this is necessary.
+ bytes := constant.Bytes(x)
+ for i := 0; i < len(bytes)/2; i++ {
+ bytes[i], bytes[len(bytes)-1-i] = bytes[len(bytes)-1-i], bytes[i]
+ }
+ return new(big.Rat).SetInt(new(big.Int).SetBytes(bytes))
+}
+
// mpint exports a multi-precision integer.
//
// For unsigned types, small values are written out as a single
@@ -1178,3 +1199,12 @@ func (q *objQueue) popHead() types.Object {
q.head++
return obj
}
+
+// internalError represents an error generated inside this package.
+type internalError string
+
+func (e internalError) Error() string { return "gcimporter: " + string(e) }
+
+func internalErrorf(format string, args ...interface{}) error {
+ return internalError(fmt.Sprintf(format, args...))
+}
diff --git a/vendor/golang.org/x/tools/internal/gcimporter/iimport.go b/vendor/golang.org/x/tools/internal/gcimporter/iimport.go
index be6dace1..94a5eba3 100644
--- a/vendor/golang.org/x/tools/internal/gcimporter/iimport.go
+++ b/vendor/golang.org/x/tools/internal/gcimporter/iimport.go
@@ -131,7 +131,7 @@ func iimportCommon(fset *token.FileSet, getPackage GetPackageFunc, data []byte,
} else if version > currentVersion {
err = fmt.Errorf("cannot import %q (%v), export data is newer version - update tool", path, e)
} else {
- err = fmt.Errorf("cannot import %q (%v), possibly version skew - reinstall package", path, e)
+ err = fmt.Errorf("internal error while importing %q (%v); please report an issue", path, e)
}
}
}()
@@ -140,11 +140,8 @@ func iimportCommon(fset *token.FileSet, getPackage GetPackageFunc, data []byte,
r := &intReader{bytes.NewReader(data), path}
if bundle {
- bundleVersion := r.uint64()
- switch bundleVersion {
- case bundleVersion:
- default:
- errorf("unknown bundle format version %d", bundleVersion)
+ if v := r.uint64(); v != bundleVersion {
+ errorf("unknown bundle format version %d", v)
}
}
diff --git a/vendor/golang.org/x/tools/internal/gcimporter/ureader_yes.go b/vendor/golang.org/x/tools/internal/gcimporter/ureader_yes.go
index 34fc783f..b977435f 100644
--- a/vendor/golang.org/x/tools/internal/gcimporter/ureader_yes.go
+++ b/vendor/golang.org/x/tools/internal/gcimporter/ureader_yes.go
@@ -10,6 +10,7 @@
package gcimporter
import (
+ "fmt"
"go/token"
"go/types"
"sort"
@@ -63,6 +64,14 @@ type typeInfo struct {
}
func UImportData(fset *token.FileSet, imports map[string]*types.Package, data []byte, path string) (_ int, pkg *types.Package, err error) {
+ if !debug {
+ defer func() {
+ if x := recover(); x != nil {
+ err = fmt.Errorf("internal error in importing %q (%v); please report an issue", path, x)
+ }
+ }()
+ }
+
s := string(data)
s = s[:strings.LastIndex(s, "\n$$\n")]
input := pkgbits.NewPkgDecoder(path, s)
diff --git a/vendor/golang.org/x/tools/internal/gocommand/invoke.go b/vendor/golang.org/x/tools/internal/gocommand/invoke.go
index 3c0afe72..8d9fc98d 100644
--- a/vendor/golang.org/x/tools/internal/gocommand/invoke.go
+++ b/vendor/golang.org/x/tools/internal/gocommand/invoke.go
@@ -24,6 +24,9 @@ import (
exec "golang.org/x/sys/execabs"
"golang.org/x/tools/internal/event"
+ "golang.org/x/tools/internal/event/keys"
+ "golang.org/x/tools/internal/event/label"
+ "golang.org/x/tools/internal/event/tag"
)
// An Runner will run go command invocations and serialize
@@ -53,9 +56,19 @@ func (runner *Runner) initialize() {
// 1.14: go: updating go.mod: existing contents have changed since last read
var modConcurrencyError = regexp.MustCompile(`go:.*go.mod.*contents have changed`)
+// verb is an event label for the go command verb.
+var verb = keys.NewString("verb", "go command verb")
+
+func invLabels(inv Invocation) []label.Label {
+ return []label.Label{verb.Of(inv.Verb), tag.Directory.Of(inv.WorkingDir)}
+}
+
// Run is a convenience wrapper around RunRaw.
// It returns only stdout and a "friendly" error.
func (runner *Runner) Run(ctx context.Context, inv Invocation) (*bytes.Buffer, error) {
+ ctx, done := event.Start(ctx, "gocommand.Runner.Run", invLabels(inv)...)
+ defer done()
+
stdout, _, friendly, _ := runner.RunRaw(ctx, inv)
return stdout, friendly
}
@@ -63,6 +76,9 @@ func (runner *Runner) Run(ctx context.Context, inv Invocation) (*bytes.Buffer, e
// RunPiped runs the invocation serially, always waiting for any concurrent
// invocations to complete first.
func (runner *Runner) RunPiped(ctx context.Context, inv Invocation, stdout, stderr io.Writer) error {
+ ctx, done := event.Start(ctx, "gocommand.Runner.RunPiped", invLabels(inv)...)
+ defer done()
+
_, err := runner.runPiped(ctx, inv, stdout, stderr)
return err
}
@@ -70,6 +86,8 @@ func (runner *Runner) RunPiped(ctx context.Context, inv Invocation, stdout, stde
// RunRaw runs the invocation, serializing requests only if they fight over
// go.mod changes.
func (runner *Runner) RunRaw(ctx context.Context, inv Invocation) (*bytes.Buffer, *bytes.Buffer, error, error) {
+ ctx, done := event.Start(ctx, "gocommand.Runner.RunRaw", invLabels(inv)...)
+ defer done()
// Make sure the runner is always initialized.
runner.initialize()
diff --git a/vendor/golang.org/x/tools/internal/imports/fix.go b/vendor/golang.org/x/tools/internal/imports/fix.go
index 6b493525..d4f1b4e8 100644
--- a/vendor/golang.org/x/tools/internal/imports/fix.go
+++ b/vendor/golang.org/x/tools/internal/imports/fix.go
@@ -26,6 +26,7 @@ import (
"unicode/utf8"
"golang.org/x/tools/go/ast/astutil"
+ "golang.org/x/tools/internal/event"
"golang.org/x/tools/internal/gocommand"
"golang.org/x/tools/internal/gopathwalk"
)
@@ -543,7 +544,7 @@ func (p *pass) addCandidate(imp *ImportInfo, pkg *packageInfo) {
var fixImports = fixImportsDefault
func fixImportsDefault(fset *token.FileSet, f *ast.File, filename string, env *ProcessEnv) error {
- fixes, err := getFixes(fset, f, filename, env)
+ fixes, err := getFixes(context.Background(), fset, f, filename, env)
if err != nil {
return err
}
@@ -553,7 +554,7 @@ func fixImportsDefault(fset *token.FileSet, f *ast.File, filename string, env *P
// getFixes gets the import fixes that need to be made to f in order to fix the imports.
// It does not modify the ast.
-func getFixes(fset *token.FileSet, f *ast.File, filename string, env *ProcessEnv) ([]*ImportFix, error) {
+func getFixes(ctx context.Context, fset *token.FileSet, f *ast.File, filename string, env *ProcessEnv) ([]*ImportFix, error) {
abs, err := filepath.Abs(filename)
if err != nil {
return nil, err
@@ -607,7 +608,7 @@ func getFixes(fset *token.FileSet, f *ast.File, filename string, env *ProcessEnv
// Go look for candidates in $GOPATH, etc. We don't necessarily load
// the real exports of sibling imports, so keep assuming their contents.
- if err := addExternalCandidates(p, p.missingRefs, filename); err != nil {
+ if err := addExternalCandidates(ctx, p, p.missingRefs, filename); err != nil {
return nil, err
}
@@ -1055,7 +1056,10 @@ type scanCallback struct {
exportsLoaded func(pkg *pkg, exports []string)
}
-func addExternalCandidates(pass *pass, refs references, filename string) error {
+func addExternalCandidates(ctx context.Context, pass *pass, refs references, filename string) error {
+ ctx, done := event.Start(ctx, "imports.addExternalCandidates")
+ defer done()
+
var mu sync.Mutex
found := make(map[string][]pkgDistance)
callback := &scanCallback{
diff --git a/vendor/golang.org/x/tools/internal/imports/imports.go b/vendor/golang.org/x/tools/internal/imports/imports.go
index 95a88383..58e637b9 100644
--- a/vendor/golang.org/x/tools/internal/imports/imports.go
+++ b/vendor/golang.org/x/tools/internal/imports/imports.go
@@ -11,6 +11,7 @@ package imports
import (
"bufio"
"bytes"
+ "context"
"fmt"
"go/ast"
"go/format"
@@ -23,6 +24,7 @@ import (
"strings"
"golang.org/x/tools/go/ast/astutil"
+ "golang.org/x/tools/internal/event"
)
// Options is golang.org/x/tools/imports.Options with extra internal-only options.
@@ -66,14 +68,17 @@ func Process(filename string, src []byte, opt *Options) (formatted []byte, err e
//
// Note that filename's directory influences which imports can be chosen,
// so it is important that filename be accurate.
-func FixImports(filename string, src []byte, opt *Options) (fixes []*ImportFix, err error) {
+func FixImports(ctx context.Context, filename string, src []byte, opt *Options) (fixes []*ImportFix, err error) {
+ ctx, done := event.Start(ctx, "imports.FixImports")
+ defer done()
+
fileSet := token.NewFileSet()
file, _, err := parse(fileSet, filename, src, opt)
if err != nil {
return nil, err
}
- return getFixes(fileSet, file, filename, opt.Env)
+ return getFixes(ctx, fileSet, file, filename, opt.Env)
}
// ApplyFixes applies all of the fixes to the file and formats it. extraMode
diff --git a/vendor/golang.org/x/tools/internal/imports/mod.go b/vendor/golang.org/x/tools/internal/imports/mod.go
index 7d99d04c..977d2389 100644
--- a/vendor/golang.org/x/tools/internal/imports/mod.go
+++ b/vendor/golang.org/x/tools/internal/imports/mod.go
@@ -19,6 +19,7 @@ import (
"strings"
"golang.org/x/mod/module"
+ "golang.org/x/tools/internal/event"
"golang.org/x/tools/internal/gocommand"
"golang.org/x/tools/internal/gopathwalk"
)
@@ -37,7 +38,7 @@ type ModuleResolver struct {
mains []*gocommand.ModuleJSON
mainByDir map[string]*gocommand.ModuleJSON
modsByModPath []*gocommand.ModuleJSON // All modules, ordered by # of path components in module Path...
- modsByDir []*gocommand.ModuleJSON // ...or Dir.
+ modsByDir []*gocommand.ModuleJSON // ...or number of path components in their Dir.
// moduleCacheCache stores information about the module cache.
moduleCacheCache *dirInfoCache
@@ -123,7 +124,7 @@ func (r *ModuleResolver) init() error {
})
sort.Slice(r.modsByDir, func(i, j int) bool {
count := func(x int) int {
- return strings.Count(r.modsByDir[x].Dir, "/")
+ return strings.Count(r.modsByDir[x].Dir, string(filepath.Separator))
}
return count(j) < count(i) // descending order
})
@@ -327,6 +328,10 @@ func (r *ModuleResolver) findModuleByDir(dir string) *gocommand.ModuleJSON {
// - in /vendor/ in -mod=vendor mode.
// - nested module? Dunno.
// Rumor has it that replace targets cannot contain other replace targets.
+ //
+ // Note that it is critical here that modsByDir is sorted to have deeper dirs
+ // first. This ensures that findModuleByDir finds the innermost module.
+ // See also golang/go#56291.
for _, m := range r.modsByDir {
if !strings.HasPrefix(dir, m.Dir) {
continue
@@ -424,6 +429,9 @@ func (r *ModuleResolver) loadPackageNames(importPaths []string, srcDir string) (
}
func (r *ModuleResolver) scan(ctx context.Context, callback *scanCallback) error {
+ ctx, done := event.Start(ctx, "imports.ModuleResolver.scan")
+ defer done()
+
if err := r.init(); err != nil {
return err
}
diff --git a/vendor/golang.org/x/tools/internal/typeparams/common.go b/vendor/golang.org/x/tools/internal/typeparams/common.go
index cfba8189..b9e87c69 100644
--- a/vendor/golang.org/x/tools/internal/typeparams/common.go
+++ b/vendor/golang.org/x/tools/internal/typeparams/common.go
@@ -105,6 +105,26 @@ func OriginMethod(fn *types.Func) *types.Func {
}
orig := NamedTypeOrigin(named)
gfn, _, _ := types.LookupFieldOrMethod(orig, true, fn.Pkg(), fn.Name())
+
+ // This is a fix for a gopls crash (#60628) due to a go/types bug (#60634). In:
+ // package p
+ // type T *int
+ // func (*T) f() {}
+ // LookupFieldOrMethod(T, true, p, f)=nil, but NewMethodSet(*T)={(*T).f}.
+ // Here we make them consistent by force.
+ // (The go/types bug is general, but this workaround is reached only
+ // for generic T thanks to the early return above.)
+ if gfn == nil {
+ mset := types.NewMethodSet(types.NewPointer(orig))
+ for i := 0; i < mset.Len(); i++ {
+ m := mset.At(i)
+ if m.Obj().Id() == fn.Id() {
+ gfn = m.Obj()
+ break
+ }
+ }
+ }
+
return gfn.(*types.Func)
}
diff --git a/vendor/golang.org/x/tools/internal/typesinternal/types.go b/vendor/golang.org/x/tools/internal/typesinternal/types.go
index 3c53fbc6..ce7d4351 100644
--- a/vendor/golang.org/x/tools/internal/typesinternal/types.go
+++ b/vendor/golang.org/x/tools/internal/typesinternal/types.go
@@ -11,8 +11,6 @@ import (
"go/types"
"reflect"
"unsafe"
-
- "golang.org/x/tools/go/types/objectpath"
)
func SetUsesCgo(conf *types.Config) bool {
@@ -52,10 +50,3 @@ func ReadGo116ErrorData(err types.Error) (code ErrorCode, start, end token.Pos,
}
var SetGoVersion = func(conf *types.Config, version string) bool { return false }
-
-// NewObjectpathEncoder returns a function closure equivalent to
-// objectpath.For but amortized for multiple (sequential) calls.
-// It is a temporary workaround, pending the approval of proposal 58668.
-//
-//go:linkname NewObjectpathFunc golang.org/x/tools/go/types/objectpath.newEncoderFor
-func NewObjectpathFunc() func(types.Object) (objectpath.Path, error)
diff --git a/vendor/modules.txt b/vendor/modules.txt
index a6a82123..39e94c85 100644
--- a/vendor/modules.txt
+++ b/vendor/modules.txt
@@ -1,4 +1,4 @@
-# github.com/99designs/gqlgen v0.17.31
+# github.com/99designs/gqlgen v0.17.33
## explicit; go 1.18
github.com/99designs/gqlgen
github.com/99designs/gqlgen/api
@@ -33,7 +33,7 @@ github.com/KyleBanks/depth
# github.com/Masterminds/semver/v3 v3.2.1
## explicit; go 1.18
github.com/Masterminds/semver/v3
-# github.com/adhocore/gronx v1.1.2
+# github.com/adhocore/gronx v1.6.3
## explicit; go 1.13
github.com/adhocore/gronx
# github.com/agnivade/levenshtein v1.1.1
@@ -54,10 +54,10 @@ github.com/beorn7/perks/quantile
# github.com/boltdb/bolt v1.3.1
## explicit
github.com/boltdb/bolt
-# github.com/caddyserver/certmagic v0.17.2
-## explicit; go 1.18
+# github.com/caddyserver/certmagic v0.18.0
+## explicit; go 1.19
github.com/caddyserver/certmagic
-# github.com/casbin/casbin/v2 v2.69.1
+# github.com/casbin/casbin/v2 v2.71.0
## explicit; go 1.13
github.com/casbin/casbin/v2
github.com/casbin/casbin/v2/config
@@ -82,7 +82,7 @@ github.com/cpuguy83/go-md2man/v2/md2man
## explicit; go 1.18
github.com/datarhei/core-client-go/v16
github.com/datarhei/core-client-go/v16/api
-# github.com/datarhei/gosrt v0.4.1
+# github.com/datarhei/gosrt v0.5.0
## explicit; go 1.18
github.com/datarhei/gosrt
github.com/datarhei/gosrt/internal/circular
@@ -145,7 +145,7 @@ github.com/go-openapi/jsonreference/internal
# github.com/go-openapi/spec v0.20.9
## explicit; go 1.13
github.com/go-openapi/spec
-# github.com/go-openapi/swag v0.22.3
+# github.com/go-openapi/swag v0.22.4
## explicit; go 1.18
github.com/go-openapi/swag
# github.com/go-playground/locales v0.14.1
@@ -155,7 +155,7 @@ github.com/go-playground/locales/currency
# github.com/go-playground/universal-translator v0.18.1
## explicit; go 1.18
github.com/go-playground/universal-translator
-# github.com/go-playground/validator/v10 v10.14.0
+# github.com/go-playground/validator/v10 v10.14.1
## explicit; go 1.18
github.com/go-playground/validator/v10
# github.com/gobwas/glob v0.2.3
@@ -195,7 +195,7 @@ github.com/hashicorp/go-msgpack/codec
# github.com/hashicorp/golang-lru v0.5.4
## explicit; go 1.12
github.com/hashicorp/golang-lru/simplelru
-# github.com/hashicorp/golang-lru/v2 v2.0.2
+# github.com/hashicorp/golang-lru/v2 v2.0.3
## explicit; go 1.18
github.com/hashicorp/golang-lru/v2
github.com/hashicorp/golang-lru/v2/simplelru
@@ -221,10 +221,10 @@ github.com/josharian/intern
# github.com/json-iterator/go v1.1.12
## explicit; go 1.12
github.com/json-iterator/go
-# github.com/klauspost/compress v1.16.5
+# github.com/klauspost/compress v1.16.6
## explicit; go 1.18
github.com/klauspost/compress/s2
-# github.com/klauspost/cpuid/v2 v2.2.4
+# github.com/klauspost/cpuid/v2 v2.2.5
## explicit; go 1.15
github.com/klauspost/cpuid/v2
# github.com/labstack/echo/v4 v4.10.2
@@ -277,7 +277,7 @@ github.com/miekg/dns
# github.com/minio/md5-simd v1.1.2
## explicit; go 1.14
github.com/minio/md5-simd
-# github.com/minio/minio-go/v7 v7.0.55
+# github.com/minio/minio-go/v7 v7.0.57
## explicit; go 1.17
github.com/minio/minio-go/v7
github.com/minio/minio-go/v7/pkg/credentials
@@ -314,7 +314,7 @@ github.com/power-devops/perfstat
# github.com/prep/average v0.0.0-20200506183628-d26c465f48c3
## explicit
github.com/prep/average
-# github.com/prometheus/client_golang v1.15.1
+# github.com/prometheus/client_golang v1.16.0
## explicit; go 1.17
github.com/prometheus/client_golang/prometheus
github.com/prometheus/client_golang/prometheus/internal
@@ -338,7 +338,7 @@ github.com/rs/xid
# github.com/russross/blackfriday/v2 v2.1.0
## explicit
github.com/russross/blackfriday/v2
-# github.com/shirou/gopsutil/v3 v3.23.4
+# github.com/shirou/gopsutil/v3 v3.23.5
## explicit; go 1.15
github.com/shirou/gopsutil/v3/cpu
github.com/shirou/gopsutil/v3/disk
@@ -349,7 +349,7 @@ github.com/shirou/gopsutil/v3/process
# github.com/shoenig/go-m1cpu v0.1.6
## explicit; go 1.20
github.com/shoenig/go-m1cpu
-# github.com/sirupsen/logrus v1.9.2
+# github.com/sirupsen/logrus v1.9.3
## explicit; go 1.13
github.com/sirupsen/logrus
# github.com/stretchr/testify v1.8.4
@@ -368,10 +368,10 @@ github.com/swaggo/swag
# github.com/tklauser/go-sysconf v0.3.11
## explicit; go 1.13
github.com/tklauser/go-sysconf
-# github.com/tklauser/numcpus v0.6.0
+# github.com/tklauser/numcpus v0.6.1
## explicit; go 1.13
github.com/tklauser/numcpus
-# github.com/urfave/cli/v2 v2.24.4
+# github.com/urfave/cli/v2 v2.25.5
## explicit; go 1.18
github.com/urfave/cli/v2
# github.com/valyala/bytebufferpool v1.0.0
@@ -380,7 +380,7 @@ github.com/valyala/bytebufferpool
# github.com/valyala/fasttemplate v1.2.2
## explicit; go 1.12
github.com/valyala/fasttemplate
-# github.com/vektah/gqlparser/v2 v2.5.1
+# github.com/vektah/gqlparser/v2 v2.5.3
## explicit; go 1.16
github.com/vektah/gqlparser/v2
github.com/vektah/gqlparser/v2/ast
@@ -429,7 +429,7 @@ go.uber.org/zap/internal/bufferpool
go.uber.org/zap/internal/color
go.uber.org/zap/internal/exit
go.uber.org/zap/zapcore
-# golang.org/x/crypto v0.9.0
+# golang.org/x/crypto v0.10.0
## explicit; go 1.17
golang.org/x/crypto/acme
golang.org/x/crypto/acme/autocert
@@ -440,12 +440,12 @@ golang.org/x/crypto/cryptobyte/asn1
golang.org/x/crypto/ocsp
golang.org/x/crypto/pbkdf2
golang.org/x/crypto/sha3
-# golang.org/x/mod v0.10.0
+# golang.org/x/mod v0.11.0
## explicit; go 1.17
golang.org/x/mod/internal/lazyregexp
golang.org/x/mod/module
golang.org/x/mod/semver
-# golang.org/x/net v0.10.0
+# golang.org/x/net v0.11.0
## explicit; go 1.17
golang.org/x/net/bpf
golang.org/x/net/html
@@ -460,7 +460,7 @@ golang.org/x/net/internal/socket
golang.org/x/net/ipv4
golang.org/x/net/ipv6
golang.org/x/net/publicsuffix
-# golang.org/x/sys v0.8.0
+# golang.org/x/sys v0.9.0
## explicit; go 1.17
golang.org/x/sys/cpu
golang.org/x/sys/execabs
@@ -468,7 +468,7 @@ golang.org/x/sys/internal/unsafeheader
golang.org/x/sys/unix
golang.org/x/sys/windows
golang.org/x/sys/windows/registry
-# golang.org/x/text v0.9.0
+# golang.org/x/text v0.10.0
## explicit; go 1.17
golang.org/x/text/cases
golang.org/x/text/internal
@@ -483,7 +483,7 @@ golang.org/x/text/unicode/norm
# golang.org/x/time v0.3.0
## explicit
golang.org/x/time/rate
-# golang.org/x/tools v0.9.1
+# golang.org/x/tools v0.10.0
## explicit; go 1.18
golang.org/x/tools/go/ast/astutil
golang.org/x/tools/go/buildutil
@@ -492,12 +492,12 @@ golang.org/x/tools/go/internal/cgo
golang.org/x/tools/go/internal/packagesdriver
golang.org/x/tools/go/loader
golang.org/x/tools/go/packages
-golang.org/x/tools/go/types/objectpath
golang.org/x/tools/imports
golang.org/x/tools/internal/event
golang.org/x/tools/internal/event/core
golang.org/x/tools/internal/event/keys
golang.org/x/tools/internal/event/label
+golang.org/x/tools/internal/event/tag
golang.org/x/tools/internal/fastwalk
golang.org/x/tools/internal/gcimporter
golang.org/x/tools/internal/gocommand