From 0a5661f7ab4b9d6e090731e354455f093d6067af Mon Sep 17 00:00:00 2001 From: Ingo Oppermann Date: Fri, 16 Jun 2023 13:30:56 +0200 Subject: [PATCH] Update dependencies --- go.mod | 46 +- go.sum | 117 +- http/graph/graph/graph.go | 1433 +++++++++-------- http/graph/models/models_gen.go | 24 +- http/graph/resolver/about.resolvers.go | 1 + http/graph/resolver/log.resolvers.go | 1 + http/graph/resolver/metrics.resolvers.go | 1 + http/graph/resolver/playout.resolvers.go | 1 + http/graph/resolver/process.resolvers.go | 1 + http/graph/resolver/schema.resolvers.go | 1 + iam/identity/identity.go | 2 +- rtmp/rtmp.go | 32 +- srt/srt.go | 74 +- .../github.com/99designs/gqlgen/.golangci.yml | 4 - .../github.com/99designs/gqlgen/CHANGELOG.md | 178 +- .../99designs/gqlgen/codegen/args.go | 10 +- .../99designs/gqlgen/codegen/config/binder.go | 76 +- .../99designs/gqlgen/codegen/config/config.go | 30 + .../99designs/gqlgen/codegen/field.gotpl | 2 +- .../99designs/gqlgen/codegen/generated!.gotpl | 70 +- .../99designs/gqlgen/codegen/object.gotpl | 181 ++- .../99designs/gqlgen/codegen/root_.gotpl | 69 +- .../gqlgen/codegen/templates/templates.go | 20 +- .../99designs/gqlgen/codegen/type.go | 2 +- .../99designs/gqlgen/codegen/type.gotpl | 4 +- .../99designs/gqlgen/graphql/cache.go | 8 +- .../gqlgen/graphql/context_response.go | 8 + .../99designs/gqlgen/graphql/deferred.go | 26 + .../gqlgen/graphql/executable_schema.go | 48 +- .../99designs/gqlgen/graphql/fieldset.go | 25 +- .../graphql/handler/extension/complexity.go | 8 +- .../99designs/gqlgen/graphql/response.go | 4 + .../99designs/gqlgen/graphql/uint.go | 2 +- .../99designs/gqlgen/graphql/version.go | 2 +- .../99designs/gqlgen/internal/code/compare.go | 16 +- .../99designs/gqlgen/internal/code/imports.go | 4 +- .../gqlgen/internal/code/packages.go | 6 +- .../99designs/gqlgen/internal/code/util.go | 2 +- .../gqlgen/internal/rewrite/rewriter.go | 6 +- vendor/github.com/99designs/gqlgen/lint.txt | 1167 -------------- .../gqlgen/plugin/federation/federation.go | 90 +- .../gqlgen/plugin/modelgen/models.go | 35 +- .../99designs/gqlgen/plugin/modelgen/types.go | 47 + vendor/github.com/adhocore/gronx/.gitignore | 4 + .../github.com/adhocore/gronx/.goreleaser.yml | 67 + vendor/github.com/adhocore/gronx/README.md | 128 +- vendor/github.com/adhocore/gronx/batch.go | 51 + vendor/github.com/adhocore/gronx/checker.go | 73 +- vendor/github.com/adhocore/gronx/gronx.go | 45 +- vendor/github.com/adhocore/gronx/next.go | 77 +- vendor/github.com/adhocore/gronx/prev.go | 32 + vendor/github.com/adhocore/gronx/validator.go | 20 +- .../caddyserver/certmagic/README.md | 17 +- .../caddyserver/certmagic/acmeissuer.go | 20 +- .../github.com/caddyserver/certmagic/cache.go | 32 +- .../caddyserver/certmagic/certificates.go | 3 + .../caddyserver/certmagic/certmagic.go | 25 +- .../caddyserver/certmagic/config.go | 46 +- .../caddyserver/certmagic/dnsutil.go | 2 +- .../caddyserver/certmagic/handshake.go | 234 ++- .../caddyserver/certmagic/httphandler.go | 2 + .../caddyserver/certmagic/ratelimiter.go | 9 +- .../casbin/casbin/v2/CONTRIBUTING.md | 2 +- .../rbac/default-role-manager/role_manager.go | 42 +- vendor/github.com/datarhei/gosrt/README.md | 2 +- vendor/github.com/datarhei/gosrt/config.go | 8 +- .../github.com/datarhei/gosrt/connection.go | 104 +- .../gosrt/internal/congestion/live.go | 68 +- vendor/github.com/go-openapi/swag/util.go | 16 +- .../go-playground/validator/v10/README.md | 2 +- .../go-playground/validator/v10/baked_in.go | 32 +- .../validator/v10/validator_instance.go | 2 + .../github.com/hashicorp/golang-lru/v2/2q.go | 10 + .../hashicorp/golang-lru/v2/README.md | 21 +- .../github.com/hashicorp/golang-lru/v2/arc.go | 259 --- .../github.com/hashicorp/golang-lru/v2/doc.go | 20 +- .../github.com/hashicorp/golang-lru/v2/lru.go | 8 + .../hashicorp/golang-lru/v2/simplelru/lru.go | 11 + .../golang-lru/v2/simplelru/lru_interface.go | 3 + .../hashicorp/golang-lru/v2/testing.go | 19 - .../klauspost/compress/s2/encode_all.go | 1 - .../klauspost/compress/s2/encode_better.go | 44 +- .../klauspost/compress/s2/encodeblock_amd64.s | 655 ++++---- .../klauspost/compress/s2/writer.go | 2 +- .../github.com/klauspost/cpuid/v2/README.md | 1 + vendor/github.com/klauspost/cpuid/v2/cpuid.go | 20 +- .../klauspost/cpuid/v2/featureid_string.go | 99 +- .../minio-go/v7/api-put-object-fan-out.go | 2 +- .../minio-go/v7/api-put-object-multipart.go | 5 +- vendor/github.com/minio/minio-go/v7/api.go | 4 +- .../minio/minio-go/v7/functional_tests.go | 32 +- .../client_golang/prometheus/desc.go | 4 +- .../client_golang/prometheus/histogram.go | 10 +- .../client_golang/prometheus/promhttp/http.go | 19 +- .../client_golang/prometheus/vec.go | 35 +- .../gopsutil/v3/internal/common/sleep.go | 3 + .../shirou/gopsutil/v3/mem/mem_linux.go | 4 +- .../shirou/gopsutil/v3/net/net_darwin.go | 2 +- .../shirou/gopsutil/v3/net/net_freebsd.go | 2 +- .../shirou/gopsutil/v3/net/net_linux.go | 2 +- .../shirou/gopsutil/v3/net/net_openbsd.go | 2 +- .../shirou/gopsutil/v3/net/net_windows.go | 2 +- .../shirou/gopsutil/v3/process/process.go | 6 +- vendor/github.com/sirupsen/logrus/writer.go | 36 +- .../github.com/tklauser/numcpus/.cirrus.yml | 2 +- vendor/github.com/urfave/cli/v2/app.go | 15 +- vendor/github.com/urfave/cli/v2/command.go | 1 + vendor/github.com/urfave/cli/v2/context.go | 24 +- vendor/github.com/urfave/cli/v2/docs.go | 11 +- vendor/github.com/urfave/cli/v2/flag_bool.go | 7 +- .../github.com/urfave/cli/v2/flag_generic.go | 9 +- vendor/github.com/urfave/cli/v2/flag_path.go | 9 +- .../github.com/urfave/cli/v2/flag_string.go | 6 +- .../urfave/cli/v2/godoc-current.txt | 7 +- vendor/github.com/urfave/cli/v2/help.go | 11 +- vendor/github.com/urfave/cli/v2/sliceflag.go | 3 - .../urfave/cli/v2/sliceflag_pre18.go | 10 - vendor/github.com/urfave/cli/v2/template.go | 2 +- .../vektah/gqlparser/v2/.go-version | 1 + .../vektah/gqlparser/v2/.golangci.yaml | 45 + .../vektah/gqlparser/v2/ast/path.go | 4 +- .../vektah/gqlparser/v2/ast/selection.go | 4 +- .../vektah/gqlparser/v2/ast/type.go | 4 +- .../vektah/gqlparser/v2/gqlerror/error.go | 9 +- .../vektah/gqlparser/v2/gqlparser.go | 21 +- .../vektah/gqlparser/v2/lexer/lexer.go | 12 +- .../vektah/gqlparser/v2/lexer/lexer_test.yml | 1 - .../vektah/gqlparser/v2/parser/query.go | 1 + .../vektah/gqlparser/v2/parser/schema.go | 1 + .../vektah/gqlparser/v2/validator/prelude.go | 1 + .../gqlparser/v2/validator/prelude.graphql | 3 + .../validator/rules/fields_on_correct_type.go | 9 +- .../rules/fragments_on_composite_types.go | 2 + .../validator/rules/known_argument_names.go | 2 + .../v2/validator/rules/known_directives.go | 4 +- .../validator/rules/known_fragment_names.go | 2 + .../v2/validator/rules/known_root_type.go | 2 + .../v2/validator/rules/known_type_names.go | 2 + .../rules/lone_anonymous_operation.go | 2 + .../v2/validator/rules/no_fragment_cycles.go | 2 + .../validator/rules/no_undefined_variables.go | 2 + .../v2/validator/rules/no_unused_fragments.go | 2 + .../v2/validator/rules/no_unused_variables.go | 2 + .../rules/overlapping_fields_can_be_merged.go | 2 + .../rules/possible_fragment_spreads.go | 2 + .../rules/provided_required_arguments.go | 2 + .../v2/validator/rules/scalar_leafs.go | 2 + .../rules/single_field_subscriptions.go | 2 + .../validator/rules/unique_argument_names.go | 2 + .../rules/unique_directives_per_location.go | 2 + .../validator/rules/unique_fragment_names.go | 2 + .../rules/unique_input_field_names.go | 2 + .../validator/rules/unique_operation_names.go | 2 + .../validator/rules/unique_variable_names.go | 2 + .../validator/rules/values_of_correct_type.go | 2 + .../rules/variables_are_input_types.go | 2 + .../rules/variables_in_allowed_position.go | 2 + .../vektah/gqlparser/v2/validator/schema.go | 25 +- .../gqlparser/v2/validator/schema_test.yml | 46 +- .../gqlparser/v2/validator/validator.go | 11 +- .../vektah/gqlparser/v2/validator/vars.go | 6 +- vendor/golang.org/x/net/http2/h2c/h2c.go | 2 +- vendor/golang.org/x/net/http2/server.go | 9 +- vendor/golang.org/x/net/http2/transport.go | 21 +- vendor/golang.org/x/net/http2/writesched.go | 3 +- .../x/net/http2/writesched_roundrobin.go | 119 ++ vendor/golang.org/x/sys/cpu/endian_little.go | 4 +- vendor/golang.org/x/sys/unix/mkall.sh | 2 +- vendor/golang.org/x/sys/unix/mkerrors.sh | 6 +- vendor/golang.org/x/sys/unix/syscall_linux.go | 30 +- .../golang.org/x/sys/unix/syscall_openbsd.go | 17 +- .../x/sys/unix/zerrors_linux_sparc64.go | 48 + .../golang.org/x/sys/unix/zsyscall_linux.go | 14 + .../x/sys/unix/zsyscall_openbsd_386.go | 22 + .../x/sys/unix/zsyscall_openbsd_386.s | 10 + .../x/sys/unix/zsyscall_openbsd_amd64.go | 36 +- .../x/sys/unix/zsyscall_openbsd_amd64.s | 10 + .../x/sys/unix/zsyscall_openbsd_arm.go | 22 + .../x/sys/unix/zsyscall_openbsd_arm.s | 10 + .../x/sys/unix/zsyscall_openbsd_arm64.go | 22 + .../x/sys/unix/zsyscall_openbsd_arm64.s | 10 + .../x/sys/unix/zsyscall_openbsd_mips64.go | 22 + .../x/sys/unix/zsyscall_openbsd_mips64.s | 10 + .../x/sys/unix/zsyscall_openbsd_ppc64.go | 22 + .../x/sys/unix/zsyscall_openbsd_ppc64.s | 12 + .../x/sys/unix/zsyscall_openbsd_riscv64.go | 22 + .../x/sys/unix/zsyscall_openbsd_riscv64.s | 10 + vendor/golang.org/x/sys/unix/ztypes_linux.go | 46 + .../x/sys/windows/syscall_windows.go | 13 +- .../x/sys/windows/zsyscall_windows.go | 8 +- .../x/tools/go/gcexportdata/gcexportdata.go | 11 +- .../golang.org/x/tools/go/packages/golist.go | 23 +- .../x/tools/go/packages/packages.go | 3 + .../x/tools/go/types/objectpath/objectpath.go | 764 --------- .../x/tools/internal/event/tag/tag.go | 59 + .../x/tools/internal/gcimporter/bexport.go | 852 ---------- .../x/tools/internal/gcimporter/bimport.go | 907 +---------- .../x/tools/internal/gcimporter/gcimporter.go | 15 +- .../x/tools/internal/gcimporter/iexport.go | 30 + .../x/tools/internal/gcimporter/iimport.go | 9 +- .../tools/internal/gcimporter/ureader_yes.go | 9 + .../x/tools/internal/gocommand/invoke.go | 18 + .../x/tools/internal/imports/fix.go | 12 +- .../x/tools/internal/imports/imports.go | 9 +- .../x/tools/internal/imports/mod.go | 12 +- .../x/tools/internal/typeparams/common.go | 20 + .../x/tools/internal/typesinternal/types.go | 9 - vendor/modules.txt | 50 +- 208 files changed, 4135 insertions(+), 6024 deletions(-) create mode 100644 vendor/github.com/99designs/gqlgen/graphql/deferred.go delete mode 100644 vendor/github.com/99designs/gqlgen/lint.txt create mode 100644 vendor/github.com/99designs/gqlgen/plugin/modelgen/types.go create mode 100644 vendor/github.com/adhocore/gronx/.goreleaser.yml create mode 100644 vendor/github.com/adhocore/gronx/batch.go create mode 100644 vendor/github.com/adhocore/gronx/prev.go delete mode 100644 vendor/github.com/hashicorp/golang-lru/v2/arc.go delete mode 100644 vendor/github.com/hashicorp/golang-lru/v2/testing.go delete mode 100644 vendor/github.com/urfave/cli/v2/sliceflag_pre18.go create mode 100644 vendor/github.com/vektah/gqlparser/v2/.go-version create mode 100644 vendor/github.com/vektah/gqlparser/v2/.golangci.yaml create mode 100644 vendor/golang.org/x/net/http2/writesched_roundrobin.go delete mode 100644 vendor/golang.org/x/tools/go/types/objectpath/objectpath.go create mode 100644 vendor/golang.org/x/tools/internal/event/tag/tag.go delete mode 100644 vendor/golang.org/x/tools/internal/gcimporter/bexport.go diff --git a/go.mod b/go.mod index 79753126..3159f727 100644 --- a/go.mod +++ b/go.mod @@ -3,17 +3,17 @@ module github.com/datarhei/core/v16 go 1.18 require ( - github.com/99designs/gqlgen v0.17.31 + github.com/99designs/gqlgen v0.17.33 github.com/Masterminds/semver/v3 v3.2.1 - github.com/adhocore/gronx v1.1.2 + github.com/adhocore/gronx v1.6.3 github.com/atrox/haikunatorgo/v2 v2.0.1 - github.com/caddyserver/certmagic v0.17.2 - github.com/casbin/casbin/v2 v2.69.1 + github.com/caddyserver/certmagic v0.18.0 + github.com/casbin/casbin/v2 v2.71.0 github.com/datarhei/core-client-go/v16 v16.11.1-0.20230614141756-a25a5fc3c60e - github.com/datarhei/gosrt v0.4.1 + github.com/datarhei/gosrt v0.5.0 github.com/datarhei/joy4 v0.0.0-20230505074825-fde05957445a github.com/fujiwara/shapeio v1.0.0 - github.com/go-playground/validator/v10 v10.14.0 + github.com/go-playground/validator/v10 v10.14.1 github.com/gobwas/glob v0.2.3 github.com/golang-jwt/jwt/v4 v4.5.0 github.com/google/uuid v1.3.0 @@ -26,19 +26,19 @@ require ( github.com/lestrrat-go/strftime v1.0.6 github.com/lithammer/shortuuid/v4 v4.0.0 github.com/mattn/go-isatty v0.0.19 - github.com/minio/minio-go/v7 v7.0.55 + github.com/minio/minio-go/v7 v7.0.57 github.com/prep/average v0.0.0-20200506183628-d26c465f48c3 - github.com/prometheus/client_golang v1.15.1 - github.com/shirou/gopsutil/v3 v3.23.4 + github.com/prometheus/client_golang v1.16.0 + github.com/shirou/gopsutil/v3 v3.23.5 github.com/stretchr/testify v1.8.4 github.com/swaggo/echo-swagger v1.4.0 github.com/swaggo/swag v1.16.1 - github.com/vektah/gqlparser/v2 v2.5.1 + github.com/vektah/gqlparser/v2 v2.5.3 github.com/xeipuuv/gojsonschema v1.2.0 go.etcd.io/bbolt v1.3.7 go.uber.org/automaxprocs v1.5.2 go.uber.org/zap v1.24.0 - golang.org/x/mod v0.10.0 + golang.org/x/mod v0.11.0 ) //replace github.com/datarhei/core-client-go/v16 => ../core-client-go @@ -61,7 +61,7 @@ require ( github.com/go-openapi/jsonpointer v0.19.6 // indirect github.com/go-openapi/jsonreference v0.20.2 // indirect github.com/go-openapi/spec v0.20.9 // indirect - github.com/go-openapi/swag v0.22.3 // indirect + github.com/go-openapi/swag v0.22.4 // indirect github.com/go-playground/locales v0.14.1 // indirect github.com/go-playground/universal-translator v0.18.1 // indirect github.com/golang-jwt/jwt v3.2.2+incompatible // indirect @@ -70,12 +70,12 @@ require ( github.com/hashicorp/go-immutable-radix v1.3.1 // indirect github.com/hashicorp/go-msgpack v0.5.5 // indirect github.com/hashicorp/golang-lru v0.5.4 // indirect - github.com/hashicorp/golang-lru/v2 v2.0.2 // indirect + github.com/hashicorp/golang-lru/v2 v2.0.3 // indirect github.com/iancoleman/orderedmap v0.2.0 // indirect github.com/josharian/intern v1.0.0 // indirect github.com/json-iterator/go v1.1.12 // indirect - github.com/klauspost/compress v1.16.5 // indirect - github.com/klauspost/cpuid/v2 v2.2.4 // indirect + github.com/klauspost/compress v1.16.6 // indirect + github.com/klauspost/cpuid/v2 v2.2.5 // indirect github.com/labstack/gommon v0.4.0 // indirect github.com/leodido/go-urn v1.2.4 // indirect github.com/libdns/libdns v0.2.1 // indirect @@ -99,11 +99,11 @@ require ( github.com/rs/xid v1.5.0 // indirect github.com/russross/blackfriday/v2 v2.1.0 // indirect github.com/shoenig/go-m1cpu v0.1.6 // indirect - github.com/sirupsen/logrus v1.9.2 // indirect + github.com/sirupsen/logrus v1.9.3 // indirect github.com/swaggo/files/v2 v2.0.0 // indirect github.com/tklauser/go-sysconf v0.3.11 // indirect - github.com/tklauser/numcpus v0.6.0 // indirect - github.com/urfave/cli/v2 v2.24.4 // indirect + github.com/tklauser/numcpus v0.6.1 // indirect + github.com/urfave/cli/v2 v2.25.5 // indirect github.com/valyala/bytebufferpool v1.0.0 // indirect github.com/valyala/fasttemplate v1.2.2 // indirect github.com/xeipuuv/gojsonpointer v0.0.0-20190905194746-02993c407bfb // indirect @@ -113,12 +113,12 @@ require ( go.uber.org/atomic v1.11.0 // indirect go.uber.org/goleak v1.1.12 // indirect go.uber.org/multierr v1.11.0 // indirect - golang.org/x/crypto v0.9.0 // indirect - golang.org/x/net v0.10.0 // indirect - golang.org/x/sys v0.8.0 // indirect - golang.org/x/text v0.9.0 // indirect + golang.org/x/crypto v0.10.0 // indirect + golang.org/x/net v0.11.0 // indirect + golang.org/x/sys v0.9.0 // indirect + golang.org/x/text v0.10.0 // indirect golang.org/x/time v0.3.0 // indirect - golang.org/x/tools v0.9.1 // indirect + golang.org/x/tools v0.10.0 // indirect google.golang.org/protobuf v1.30.0 // indirect gopkg.in/ini.v1 v1.67.0 // indirect gopkg.in/yaml.v3 v3.0.1 // indirect diff --git a/go.sum b/go.sum index eb3b80be..0a6903f2 100644 --- a/go.sum +++ b/go.sum @@ -1,5 +1,5 @@ -github.com/99designs/gqlgen v0.17.31 h1:VncSQ82VxieHkea8tz11p7h/zSbvHSxSDZfywqWt158= -github.com/99designs/gqlgen v0.17.31/go.mod h1:i4rEatMrzzu6RXaHydq1nmEPZkb3bKQsnxNRHS4DQB4= +github.com/99designs/gqlgen v0.17.33 h1:VTUpAtElDszatPSe26N0SD0deJCSxb7TZLlUb6JnVRY= +github.com/99designs/gqlgen v0.17.33/go.mod h1:ygDK+m8zGpoQuSh8xoq80UfisR5JTZr7mN57qXlSIZs= github.com/DataDog/datadog-go v2.2.0+incompatible/go.mod h1:LButxg5PwREeZtORoXG3tL4fMGNddJ+vMq1mwgfaqoQ= github.com/DataDog/datadog-go v3.2.0+incompatible/go.mod h1:LButxg5PwREeZtORoXG3tL4fMGNddJ+vMq1mwgfaqoQ= github.com/Knetic/govaluate v3.0.1-0.20171022003610-9aa49832a739+incompatible h1:1G1pk05UrOh0NlF1oeaaix1x8XzrfjIDK47TY0Zehcw= @@ -8,11 +8,8 @@ github.com/KyleBanks/depth v1.2.1 h1:5h8fQADFrWtarTdtDudMmGsC7GPbOAu6RVB3ffsVFHc github.com/KyleBanks/depth v1.2.1/go.mod h1:jzSb9d0L43HxTQfT+oSA1EEp2q+ne2uh6XgeJcm8brE= github.com/Masterminds/semver/v3 v3.2.1 h1:RN9w6+7QoMeJVGyfmbcgs28Br8cvmnucEXnY0rYXWg0= github.com/Masterminds/semver/v3 v3.2.1/go.mod h1:qvl/7zhW3nngYb5+80sSMF+FG2BjYrf8m9wsX0PNOMQ= -github.com/PuerkitoBio/purell v1.1.1/go.mod h1:c11w/QuzBsJSee3cPx9rAFu61PvFxuPbtSwDGJws/X0= -github.com/PuerkitoBio/urlesc v0.0.0-20170810143723-de5bf2ad4578/go.mod h1:uGdkoq3SwY9Y+13GIhn11/XLaGBb4BfwItxLd5jeuXE= -github.com/adhocore/gronx v1.1.2 h1:Hgm+d8SyGtn+rCoDkxZq3nLNFLLkzRGR7L2ziRRD1w8= -github.com/adhocore/gronx v1.1.2/go.mod h1:7oUY1WAU8rEJWmAxXR2DN0JaO4gi9khSgKjiRypqteg= -github.com/agnivade/levenshtein v1.0.1/go.mod h1:CURSv5d9Uaml+FovSIICkLbAUZ9S4RqaHDIsdSBg7lM= +github.com/adhocore/gronx v1.6.3 h1:bnm5vieTrY3QQPpsfB0hrAaeaHDpuZTUC2LLCVMLe9c= +github.com/adhocore/gronx v1.6.3/go.mod h1:7oUY1WAU8rEJWmAxXR2DN0JaO4gi9khSgKjiRypqteg= github.com/agnivade/levenshtein v1.1.1 h1:QY8M92nrzkmr798gCo3kmMyqXFzdQVpxLlGPRBij0P8= github.com/agnivade/levenshtein v1.1.1/go.mod h1:veldBMzWxcCG2ZvUTKD2kJNRdCk5hVbJomOvKkmgYbo= github.com/alecthomas/template v0.0.0-20160405071501-a0175ee3bccc/go.mod h1:LOuyumcjzFXgccqObfd/Ljyb9UuFJ6TxHnclSeseNhc= @@ -29,7 +26,6 @@ github.com/armon/go-metrics v0.4.1/go.mod h1:E6amYzXo6aW1tqzoZGT755KkbgrJsSdpwZ+ github.com/atrox/haikunatorgo/v2 v2.0.1 h1:FCVx2KL2YvZtI1rI9WeEHxeLRrKGr0Dd4wfCJiUXupc= github.com/atrox/haikunatorgo/v2 v2.0.1/go.mod h1:BBQmx2o+1Z5poziaHRgddAZKOpijwfKdAmMnSYlFK70= github.com/benbjohnson/clock v1.1.0 h1:Q92kusRqC1XV2MjkWETPvjJVqKetz1OzxZB7mHJLju8= -github.com/benbjohnson/clock v1.1.0/go.mod h1:J11/hYXuz8f4ySSvYwY0FKfm+ezbsZBKZxNJlLklBHA= github.com/benburkert/openpgp v0.0.0-20160410205803-c2471f86866c h1:8XZeJrs4+ZYhJeJ2aZxADI2tGADS15AzIF8MQ8XAhT4= github.com/benburkert/openpgp v0.0.0-20160410205803-c2471f86866c/go.mod h1:x1vxHcL/9AVzuk5HOloOEPrtJY0MaalYr78afXZ+pWI= github.com/beorn7/perks v0.0.0-20180321164747-3a771d992973/go.mod h1:Dwedo/Wpr24TaqPxmxbtue+5NUziq4I4S80YR8gNf3Q= @@ -38,10 +34,10 @@ github.com/beorn7/perks v1.0.1 h1:VlbKKnNfV8bJzeqoa4cOKqO6bYr3WgKZxO8Z16+hsOM= github.com/beorn7/perks v1.0.1/go.mod h1:G2ZrVWU2WbWT9wwq4/hrbKbnv/1ERSJQ0ibhJ6rlkpw= github.com/boltdb/bolt v1.3.1 h1:JQmyP4ZBrce+ZQu0dY660FMfatumYDLun9hBCUVIkF4= github.com/boltdb/bolt v1.3.1/go.mod h1:clJnj/oiGkjum5o1McbSZDSLxVThjynRyGBgiAx27Ps= -github.com/caddyserver/certmagic v0.17.2 h1:o30seC1T/dBqBCNNGNHWwj2i5/I/FMjBbTAhjADP3nE= -github.com/caddyserver/certmagic v0.17.2/go.mod h1:ouWUuC490GOLJzkyN35eXfV8bSbwMwSf4bdhkIxtdQE= -github.com/casbin/casbin/v2 v2.69.1 h1:R3e7uveIRN5Pdqvq0GXEhXmn7HyfoEVjp21/mgEXbdI= -github.com/casbin/casbin/v2 v2.69.1/go.mod h1:vByNa/Fchek0KZUgG5wEsl7iFsiviAYKRtgrQfcJqHg= +github.com/caddyserver/certmagic v0.18.0 h1:L22mJES1WllfLoHUcQUy4wVO7UfOsoL5wtg/Bj7kmIw= +github.com/caddyserver/certmagic v0.18.0/go.mod h1:e0YLTnXIopZ05bBWCLzpIf1Yvk27Q90FGUmGowFRDY8= +github.com/casbin/casbin/v2 v2.71.0 h1:pVzHKXkGgOXIjksEwnrOjNu5CE4xy6aAVzdR8td2gSc= +github.com/casbin/casbin/v2 v2.71.0/go.mod h1:vByNa/Fchek0KZUgG5wEsl7iFsiviAYKRtgrQfcJqHg= github.com/cespare/xxhash/v2 v2.1.1/go.mod h1:VGX0DQ3Q6kWi7AoAeZDth3/j3BFtOZR5XLFGgcrjCOs= github.com/cespare/xxhash/v2 v2.2.0 h1:DC2CZ1Ep5Y4k3ZQ899DldepgrayRUGE6BBZ/cd9Cj44= github.com/cespare/xxhash/v2 v2.2.0/go.mod h1:VGX0DQ3Q6kWi7AoAeZDth3/j3BFtOZR5XLFGgcrjCOs= @@ -50,14 +46,10 @@ github.com/circonus-labs/circonusllhist v0.1.3/go.mod h1:kMXHVDlOchFAehlya5ePtbp github.com/cpuguy83/go-md2man/v2 v2.0.2 h1:p1EgwI/C7NhT0JmVkwCD2ZBK8j4aeHQX2pMHHBfMQ6w= github.com/cpuguy83/go-md2man/v2 v2.0.2/go.mod h1:tgQtvFlXSQOSOSIRvRPT7W67SCa46tRHOmNcaadrF8o= github.com/creack/pty v1.1.9/go.mod h1:oKZEueFk5CKHvIhNR5MUki03XCEU+Q6VDXinZuGJ33E= -github.com/datarhei/core-client-go/v16 v16.11.1-0.20230605095314-42546fbbbece h1:Gv+W986jLcMa/TOKg5YF3RMDlNDDyj7uHuH+mHP7xq8= -github.com/datarhei/core-client-go/v16 v16.11.1-0.20230605095314-42546fbbbece/go.mod h1:6L0zr/NUwvaPsCTK/IL17m8JUEtgLp3BDtlsBREwacg= -github.com/datarhei/core-client-go/v16 v16.11.1-0.20230614130211-fb0f92af8ac9 h1:ntM1tymajXx92ydwi6RSiDG54aQV3cMOtlGRBT6p9Z8= -github.com/datarhei/core-client-go/v16 v16.11.1-0.20230614130211-fb0f92af8ac9/go.mod h1:6L0zr/NUwvaPsCTK/IL17m8JUEtgLp3BDtlsBREwacg= github.com/datarhei/core-client-go/v16 v16.11.1-0.20230614141756-a25a5fc3c60e h1:iQKqGTyIdCyO7kY/G5MCKhzt3xZ5YPRubbJskVp5EvQ= github.com/datarhei/core-client-go/v16 v16.11.1-0.20230614141756-a25a5fc3c60e/go.mod h1:6L0zr/NUwvaPsCTK/IL17m8JUEtgLp3BDtlsBREwacg= -github.com/datarhei/gosrt v0.4.1 h1:08km3wKy72jOdC+JzBDWN57H7xST4mz5lFeJQHuWmMs= -github.com/datarhei/gosrt v0.4.1/go.mod h1:FtsulRiUc67Oi3Ii9JH9aQkpO+ZfgeauRAtIE40mIVA= +github.com/datarhei/gosrt v0.5.0 h1:MhM8kb00nbWc+haNKU7ZdYgSm9pLdxdtas7tcERh8j8= +github.com/datarhei/gosrt v0.5.0/go.mod h1:bcLf0p0FeZl+QY87b+Q8nGkyjyX6IDvI9y9raol8vng= github.com/datarhei/joy4 v0.0.0-20230505074825-fde05957445a h1:Tf4DSHY1xruBglr+yYP5Wct7czM86GKMYgbXH8a7OFo= github.com/datarhei/joy4 v0.0.0-20230505074825-fde05957445a/go.mod h1:Jcw/6jZDQQmPx8A7INEkXmuEF7E9jjBbSTfVSLwmiQw= github.com/davecgh/go-spew v1.1.0/go.mod h1:J7Y8YcW2NihsgmVo/mv3lAwl/skON4iLHjSsI+c5H38= @@ -79,7 +71,6 @@ github.com/go-kit/kit v0.8.0/go.mod h1:xBxKIO96dXMWWy0MnWVtmwkA9/13aqxPnvrjFYMA2 github.com/go-kit/kit v0.9.0/go.mod h1:xBxKIO96dXMWWy0MnWVtmwkA9/13aqxPnvrjFYMA2as= github.com/go-logfmt/logfmt v0.3.0/go.mod h1:Qt1PoO58o5twSAckw1HlFXLmHsOX5/0LbT9GBnD5lWE= github.com/go-logfmt/logfmt v0.4.0/go.mod h1:3RMwSq7FuexP4Kalkev3ejPJsZTpXXBr9+V4qmtdjCk= -github.com/go-logfmt/logfmt v0.5.1/go.mod h1:WYhtIu8zTZfxdn5+rREduYbwxfcBr/Vr6KEVveWlfTs= github.com/go-ole/go-ole v1.2.6 h1:/Fpf6oFPoeFik9ty7siob0G6Ke8QvQEuVcuChpwXzpY= github.com/go-ole/go-ole v1.2.6/go.mod h1:pprOEPIfldk/42T2oK7lQ4v4JSDwmV0As9GaiUsvbm0= github.com/go-openapi/jsonpointer v0.19.3/go.mod h1:Pl9vOtqEWErmShwVjC8pYs9cog34VGT37dQOVbmoatg= @@ -93,15 +84,16 @@ github.com/go-openapi/spec v0.20.9 h1:xnlYNQAwKd2VQRRfwTEI0DcK+2cbuvI/0c7jx3gA8/ github.com/go-openapi/spec v0.20.9/go.mod h1:2OpW+JddWPrpXSCIX8eOx7lZ5iyuWj3RYR6VaaBKcWA= github.com/go-openapi/swag v0.19.5/go.mod h1:POnQmlKehdgb5mhVOsnJFsivZCEZ/vjK9gh66Z9tfKk= github.com/go-openapi/swag v0.19.15/go.mod h1:QYRuS/SOXUCsnplDa677K7+DxSOj6IPNl/eQntq43wQ= -github.com/go-openapi/swag v0.22.3 h1:yMBqmnQ0gyZvEb/+KzuWZOXgllrXT4SADYbvDaXHv/g= github.com/go-openapi/swag v0.22.3/go.mod h1:UzaqsxGiab7freDnrUUra0MwWfN/q7tE4j+VcZ0yl14= +github.com/go-openapi/swag v0.22.4 h1:QLMzNJnMGPRNDCbySlcj1x01tzU8/9LTTL9hZZZogBU= +github.com/go-openapi/swag v0.22.4/go.mod h1:UzaqsxGiab7freDnrUUra0MwWfN/q7tE4j+VcZ0yl14= github.com/go-playground/assert/v2 v2.2.0 h1:JvknZsQTYeFEAhQwI4qEt9cyV5ONwRHC+lYKSsYSR8s= github.com/go-playground/locales v0.14.1 h1:EWaQ/wswjilfKLTECiXz7Rh+3BjFhfDFKv/oXslEjJA= github.com/go-playground/locales v0.14.1/go.mod h1:hxrqLVvrK65+Rwrd5Fc6F2O76J/NuW9t0sjnWqG1slY= github.com/go-playground/universal-translator v0.18.1 h1:Bcnm0ZwsGyWbCzImXv+pAJnYK9S473LQFuzCbDbfSFY= github.com/go-playground/universal-translator v0.18.1/go.mod h1:xekY+UJKNuX9WP91TpwSH2VMlDf28Uj24BCp08ZFTUY= -github.com/go-playground/validator/v10 v10.14.0 h1:vgvQWe3XCz3gIeFDm/HnTIbj6UGmg/+t63MyGU2n5js= -github.com/go-playground/validator/v10 v10.14.0/go.mod h1:9iXMNT7sEkjXb0I+enO7QXmzG6QCsPWY4zveKFVRSyU= +github.com/go-playground/validator/v10 v10.14.1 h1:9c50NUPC30zyuKprjL3vNZ0m5oG+jU0zvx4AqHGnv4k= +github.com/go-playground/validator/v10 v10.14.1/go.mod h1:9iXMNT7sEkjXb0I+enO7QXmzG6QCsPWY4zveKFVRSyU= github.com/go-stack/stack v1.8.0/go.mod h1:v0f6uXyyMGvRgIKkXu+yp6POWl0qKG85gN/melR3HDY= github.com/gobwas/glob v0.2.3 h1:A4xDbljILXROh+kObIiy5kIaPYD8e96x1tgBhUI5J+Y= github.com/gobwas/glob v0.2.3/go.mod h1:d3Ez4x06l9bZtSvzIay5+Yzi0fmZzPgnTbPcKjJAkT8= @@ -144,8 +136,8 @@ github.com/hashicorp/go-uuid v1.0.0/go.mod h1:6SBZvOh/SIDV7/2o3Jml5SYk/TvGqwFJ/b github.com/hashicorp/golang-lru v0.5.0/go.mod h1:/m3WP610KZHVQ1SGc6re/UDhFvYD7pJ4Ao+sR/qLZy8= github.com/hashicorp/golang-lru v0.5.4 h1:YDjusn29QI/Das2iO9M0BHnIbxPeyuCHsjMW+lJfyTc= github.com/hashicorp/golang-lru v0.5.4/go.mod h1:iADmTwqILo4mZ8BN3D2Q6+9jd8WM5uGBxy+E8yxSoD4= -github.com/hashicorp/golang-lru/v2 v2.0.2 h1:Dwmkdr5Nc/oBiXgJS3CDHNhJtIHkuZ3DZF5twqnfBdU= -github.com/hashicorp/golang-lru/v2 v2.0.2/go.mod h1:QeFd9opnmA6QUJc5vARoKUSoFhyfM2/ZepoAG6RGpeM= +github.com/hashicorp/golang-lru/v2 v2.0.3 h1:kmRrRLlInXvng0SmLxmQpQkpbYAvcXm7NPDrgxJa9mE= +github.com/hashicorp/golang-lru/v2 v2.0.3/go.mod h1:QeFd9opnmA6QUJc5vARoKUSoFhyfM2/ZepoAG6RGpeM= github.com/hashicorp/raft v1.1.0/go.mod h1:4Ak7FSPnuvmb0GV6vgIAJ4vYT4bek9bb6Q+7HVbyzqM= github.com/hashicorp/raft v1.5.0 h1:uNs9EfJ4FwiArZRxxfd/dQ5d33nV31/CdCHArH89hT8= github.com/hashicorp/raft v1.5.0/go.mod h1:pKHB2mf/Y25u3AHNSXVRv+yT+WAnmeTX0BwVppVQV+M= @@ -162,18 +154,16 @@ github.com/joho/godotenv v1.5.1 h1:7eLL/+HRGLY0ldzfGMeQkb7vMd0as4CfYvUVzLqw0N0= github.com/joho/godotenv v1.5.1/go.mod h1:f4LDr5Voq0i2e/R5DDNOoa2zzDfwtkZa6DnEwAbqwq4= github.com/josharian/intern v1.0.0 h1:vlS4z54oSdjm0bgjRigI+G1HpF+tI+9rE5LLzOg8HmY= github.com/josharian/intern v1.0.0/go.mod h1:5DoeVV0s6jJacbCEi61lwdGj/aVlrQvzHFFd8Hwg//Y= -github.com/jpillora/backoff v1.0.0/go.mod h1:J/6gKK9jxlEcS3zixgDgUAsiuZ7yrSoa/FX5e0EB2j4= github.com/json-iterator/go v1.1.6/go.mod h1:+SdeFBvtyEkXs7REEP0seUULqWtbJapLOCVDaaPEHmU= github.com/json-iterator/go v1.1.9/go.mod h1:KdQUCv79m/52Kvf8AW2vK1V8akMuk1QjK/uOdHXbAo4= github.com/json-iterator/go v1.1.12 h1:PV8peI4a0ysnczrg+LtxykD8LfKY9ML6u2jnxaEnrnM= github.com/json-iterator/go v1.1.12/go.mod h1:e30LSqwooZae/UwlEbR2852Gd8hjQvJoHmT4TnhNGBo= github.com/julienschmidt/httprouter v1.2.0/go.mod h1:SYymIcj16QtmaHHD7aYtjjsJG7VTCxuUUipMqKk8s4w= -github.com/julienschmidt/httprouter v1.3.0/go.mod h1:JR6WtHb+2LUe8TCKY3cZOxFyyO8IZAc4RVcycCCAKdM= -github.com/klauspost/compress v1.16.5 h1:IFV2oUNUzZaz+XyusxpLzpzS8Pt5rh0Z16For/djlyI= -github.com/klauspost/compress v1.16.5/go.mod h1:ntbaceVETuRiXiv4DpjP66DpAtAGkEQskQzEyD//IeE= +github.com/klauspost/compress v1.16.6 h1:91SKEy4K37vkp255cJ8QesJhjyRO0hn9i9G0GoUwLsk= +github.com/klauspost/compress v1.16.6/go.mod h1:ntbaceVETuRiXiv4DpjP66DpAtAGkEQskQzEyD//IeE= github.com/klauspost/cpuid/v2 v2.0.1/go.mod h1:FInQzS24/EEf25PyTYn52gqo7WaD8xa0213Md/qVLRg= -github.com/klauspost/cpuid/v2 v2.2.4 h1:acbojRNwl3o09bUq+yDCtZFc1aiwaAAxtcn8YkZXnvk= -github.com/klauspost/cpuid/v2 v2.2.4/go.mod h1:RVVoqg1df56z8g3pUjL/3lE5UfnlrJX8tyFgg4nqhuY= +github.com/klauspost/cpuid/v2 v2.2.5 h1:0E5MSMDEoAulmXNFquVs//DdoomxaoTY1kUhbc/qbZg= +github.com/klauspost/cpuid/v2 v2.2.5/go.mod h1:Lcz8mBdAVJIBVzewtcLocK12l3Y+JytZYpaMropDUws= github.com/konsorten/go-windows-terminal-sequences v1.0.1/go.mod h1:T0+1ngSBFLxvqU3pZ+m/2kptfBszLMUkC4ZK/EgS/cQ= github.com/kr/logfmt v0.0.0-20140226030751-b84e30acd515/go.mod h1:+0opPa2QZZtGFBFZlji/RkVcI2GknAs/DXo4wKdlNEc= github.com/kr/pretty v0.1.0/go.mod h1:dAy3ld7l9f0ibDNOQOHHMYYIIbhfbHSm3C4ZsoJORNo= @@ -224,8 +214,8 @@ github.com/miekg/dns v1.1.54 h1:5jon9mWcb0sFJGpnI99tOMhCPyJ+RPVz5b63MQG0VWI= github.com/miekg/dns v1.1.54/go.mod h1:uInx36IzPl7FYnDcMeVWxj9byh7DutNykX4G9Sj60FY= github.com/minio/md5-simd v1.1.2 h1:Gdi1DZK69+ZVMoNHRXJyNcxrMA4dSxoYHZSQbirFg34= github.com/minio/md5-simd v1.1.2/go.mod h1:MzdKDxYpY2BT9XQFocsiZf/NKVtR7nkE4RoEpN+20RM= -github.com/minio/minio-go/v7 v7.0.55 h1:ZXqUO/8cgfHzI+08h/zGuTTFpISSA32BZmBE3FCLJas= -github.com/minio/minio-go/v7 v7.0.55/go.mod h1:NUDy4A4oXPq1l2yK6LTSvCEzAMeIcoz9lcj5dbzSrRE= +github.com/minio/minio-go/v7 v7.0.57 h1:xsFiOiWjpC1XAGbFEUOzj1/gMXGz7ljfxifwcb/5YXU= +github.com/minio/minio-go/v7 v7.0.57/go.mod h1:NUDy4A4oXPq1l2yK6LTSvCEzAMeIcoz9lcj5dbzSrRE= github.com/minio/sha256-simd v1.0.1 h1:6kaan5IFmwTNynnKKpDHe6FWHohJOHhCPchzK49dzMM= github.com/minio/sha256-simd v1.0.1/go.mod h1:Pz6AKMiUdngCLpeTL/RJY1M9rUuPMYujV5xJjtbRSN8= github.com/mitchellh/mapstructure v1.5.0 h1:jeMsZIYE/09sWLaz43PL7Gy6RuMjD2eJVyuac5Z2hdY= @@ -238,7 +228,6 @@ github.com/modern-go/reflect2 v1.0.1/go.mod h1:bx2lNnkwVCuqBIxFjflWJWanXIb3Rllmb github.com/modern-go/reflect2 v1.0.2 h1:xBagoLtFs94CBntxluKeaWgTMpvLxC4ur3nMaC9Gz0M= github.com/modern-go/reflect2 v1.0.2/go.mod h1:yWuevngMOJpCy52FWWMvUC8ws7m/LJsjYzDa0/r8luk= github.com/mwitkow/go-conntrack v0.0.0-20161129095857-cc309e4a2223/go.mod h1:qRWi+5nqEBWmkhHvq77mSJWrCKwh8bxhgT7d/eI7P4U= -github.com/mwitkow/go-conntrack v0.0.0-20190716064945-2f068394615f/go.mod h1:qRWi+5nqEBWmkhHvq77mSJWrCKwh8bxhgT7d/eI7P4U= github.com/niemeyer/pretty v0.0.0-20200227124842-a10e7caefd8e/go.mod h1:zD1mROLANZcx1PVRCS0qkT7pwLkGfwJo4zjcN/Tysno= github.com/pascaldekloe/goe v0.1.0 h1:cBOtyMzM9HTpWjXfbbunk26uA6nG3a8n06Wieeh0MwY= github.com/pascaldekloe/goe v0.1.0/go.mod h1:lzWF7FIEvWOWxwDKqyGYQf6ZUaNfKdP144TG7ZOy1lc= @@ -259,8 +248,8 @@ github.com/prometheus/client_golang v0.9.1/go.mod h1:7SWBe2y4D6OKWSNQJUaRYU/AaXP github.com/prometheus/client_golang v0.9.2/go.mod h1:OsXs2jCmiKlQ1lTBmv21f2mNfw4xf/QclQDMrYNZzcM= github.com/prometheus/client_golang v1.0.0/go.mod h1:db9x61etRT2tGnBNRi70OPL5FsnadC4Ky3P0J6CfImo= github.com/prometheus/client_golang v1.4.0/go.mod h1:e9GMxYsXl05ICDXkRhurwBS4Q3OK1iX/F2sw+iXX5zU= -github.com/prometheus/client_golang v1.15.1 h1:8tXpTmJbyH5lydzFPoxSIJ0J46jdh3tylbvM1xCv0LI= -github.com/prometheus/client_golang v1.15.1/go.mod h1:e9yaBhRPU2pPNsZwE+JdQl0KEt1N9XgF6zxWmaC0xOk= +github.com/prometheus/client_golang v1.16.0 h1:yk/hx9hDbrGHovbci4BY+pRMfSuuat626eFsHb7tmT8= +github.com/prometheus/client_golang v1.16.0/go.mod h1:Zsulrv/L9oM40tJ7T815tM89lFEugiJ9HzIqaAx4LKc= github.com/prometheus/client_model v0.0.0-20180712105110-5c3871d89910/go.mod h1:MbSGuTsp3dbXC40dX6PRTWyKYBIrTGTE9sqQNg2J8bo= github.com/prometheus/client_model v0.0.0-20190129233127-fd36f4220a90/go.mod h1:xMI15A0UPsDsEKsMN9yxemIoYk6Tm2C1GtYGdfGttqA= github.com/prometheus/client_model v0.2.0/go.mod h1:xMI15A0UPsDsEKsMN9yxemIoYk6Tm2C1GtYGdfGttqA= @@ -282,20 +271,18 @@ github.com/rs/xid v1.5.0 h1:mKX4bl4iPYJtEIxp6CYiUuLQ/8DYMoz0PUdtGgMFRVc= github.com/rs/xid v1.5.0/go.mod h1:trrq9SKmegXys3aeAKXMUTdJsYXVwGY3RLcfgqegfbg= github.com/russross/blackfriday/v2 v2.1.0 h1:JIOH55/0cWyOuilr9/qlrm0BSXldqnqwMsf35Ld67mk= github.com/russross/blackfriday/v2 v2.1.0/go.mod h1:+Rmxgy9KzJVeS9/2gXHxylqXiyQDYRxCVz55jmeOWTM= -github.com/sergi/go-diff v1.1.0 h1:we8PVUC3FE2uYfodKH/nBHMSetSfHDR6scGdBi+erh0= -github.com/sergi/go-diff v1.1.0/go.mod h1:STckp+ISIX8hZLjrqAeVduY0gWCT9IjLuqbuNXdaHfM= -github.com/shirou/gopsutil/v3 v3.23.4 h1:hZwmDxZs7Ewt75DV81r4pFMqbq+di2cbt9FsQBqLD2o= -github.com/shirou/gopsutil/v3 v3.23.4/go.mod h1:ZcGxyfzAMRevhUR2+cfhXDH6gQdFYE/t8j1nsU4mPI8= -github.com/shoenig/go-m1cpu v0.1.5/go.mod h1:Wwvst4LR89UxjeFtLRMrpgRiyY4xPsejnVZym39dbAQ= +github.com/sergi/go-diff v1.3.1 h1:xkr+Oxo4BOQKmkn/B9eMK0g5Kg/983T9DqqPHwYqD+8= +github.com/sergi/go-diff v1.3.1/go.mod h1:aMJSSKb2lpPvRNec0+w3fl7LP9IOFzdc9Pa4NFbPK1I= +github.com/shirou/gopsutil/v3 v3.23.5 h1:5SgDCeQ0KW0S4N0znjeM/eFHXXOKyv2dVNgRq/c9P6Y= +github.com/shirou/gopsutil/v3 v3.23.5/go.mod h1:Ng3Maa27Q2KARVJ0SPZF5NdrQSC3XHKP8IIWrHgMeLY= github.com/shoenig/go-m1cpu v0.1.6 h1:nxdKQNcEB6vzgA2E2bvzKIYRuNj7XNJ4S/aRSwKzFtM= github.com/shoenig/go-m1cpu v0.1.6/go.mod h1:1JJMcUBvfNwpq05QDQVAnx3gUHr9IYF7GNg9SUEw2VQ= -github.com/shoenig/test v0.6.3/go.mod h1:byHiCGXqrVaflBLAMq/srcZIHynQPQgeyvkvXnjqq0k= github.com/shoenig/test v0.6.4 h1:kVTaSd7WLz5WZ2IaoM0RSzRsUD+m8wRR+5qvntpn4LU= -github.com/shurcooL/sanitized_anchor_name v1.0.0/go.mod h1:1NzhyTcUVG4SuEtjjoZeVRXNmyL/1OwPU0+IJeTBvfc= +github.com/shoenig/test v0.6.4/go.mod h1:byHiCGXqrVaflBLAMq/srcZIHynQPQgeyvkvXnjqq0k= github.com/sirupsen/logrus v1.2.0/go.mod h1:LxeOpSwHxABJmUn/MG1IvRgCAasNZTLOkJPxbbu5VWo= github.com/sirupsen/logrus v1.4.2/go.mod h1:tLMulIdttU9McNUspp0xgXVQah82FyeX6MwdIuYE2rE= -github.com/sirupsen/logrus v1.9.2 h1:oxx1eChJGI6Uks2ZC4W1zpLlVgqB8ner4EuQwV4Ik1Y= -github.com/sirupsen/logrus v1.9.2/go.mod h1:naHLuLoDiP4jHNo9R0sCBMtWGeIprob74mVsIT4qYEQ= +github.com/sirupsen/logrus v1.9.3 h1:dueUQJ1C2q9oE3F7wvmSGAaVtTmUizReu6fjN8uqzbQ= +github.com/sirupsen/logrus v1.9.3/go.mod h1:naHLuLoDiP4jHNo9R0sCBMtWGeIprob74mVsIT4qYEQ= github.com/stretchr/objx v0.1.0/go.mod h1:HFkY916IF+rwdDfMAkV7OtwuqBVzrE8GR6GFx+wExME= github.com/stretchr/objx v0.1.1/go.mod h1:HFkY916IF+rwdDfMAkV7OtwuqBVzrE8GR6GFx+wExME= github.com/stretchr/objx v0.4.0/go.mod h1:YvHI0jy2hoMjB+UWwv71VJQ9isScKT/TqJzVSSt89Yw= @@ -311,6 +298,7 @@ github.com/stretchr/testify v1.7.2/go.mod h1:R6va5+xMeoiuVRoj+gSkQ7d3FALtqAAGI1F github.com/stretchr/testify v1.8.0/go.mod h1:yNjHg4UonilssWZ8iaSj1OCr/vHnekPRkoO+kdMU+MU= github.com/stretchr/testify v1.8.1/go.mod h1:w2LPCIKwWwSfY2zedu0+kehJoqGctiVI29o6fzry7u4= github.com/stretchr/testify v1.8.2/go.mod h1:w2LPCIKwWwSfY2zedu0+kehJoqGctiVI29o6fzry7u4= +github.com/stretchr/testify v1.8.3/go.mod h1:sz/lmYIOXD/1dqDmKjjqLyZ2RngseejIcXlSw2iwfAo= github.com/stretchr/testify v1.8.4 h1:CcVxjf3Q8PM0mHUKJCdn+eZZtm5yQwehR5yeSVQQcUk= github.com/stretchr/testify v1.8.4/go.mod h1:sz/lmYIOXD/1dqDmKjjqLyZ2RngseejIcXlSw2iwfAo= github.com/swaggo/echo-swagger v1.4.0 h1:RCxLKySw1SceHLqnmc41pKyiIeE+OiD7NSI7FUOBlLo= @@ -321,18 +309,19 @@ github.com/swaggo/swag v1.16.1 h1:fTNRhKstPKxcnoKsytm4sahr8FaYzUcT7i1/3nd/fBg= github.com/swaggo/swag v1.16.1/go.mod h1:9/LMvHycG3NFHfR6LwvikHv5iFvmPADQ359cKikGxto= github.com/tklauser/go-sysconf v0.3.11 h1:89WgdJhk5SNwJfu+GKyYveZ4IaJ7xAkecBo+KdJV0CM= github.com/tklauser/go-sysconf v0.3.11/go.mod h1:GqXfhXY3kiPa0nAXPDIQIWzJbMCB7AmcWpGR8lSZfqI= -github.com/tklauser/numcpus v0.6.0 h1:kebhY2Qt+3U6RNK7UqpYNA+tJ23IBEGKkB7JQBfDYms= github.com/tklauser/numcpus v0.6.0/go.mod h1:FEZLMke0lhOUG6w2JadTzp0a+Nl8PF/GFkQ5UVIcaL4= +github.com/tklauser/numcpus v0.6.1 h1:ng9scYS7az0Bk4OZLvrNXNSAO2Pxr1XXRAPyjhIx+Fk= +github.com/tklauser/numcpus v0.6.1/go.mod h1:1XfjsgE2zo8GVw7POkMbHENHzVg3GzmoZ9fESEdAacY= github.com/tv42/httpunix v0.0.0-20150427012821-b75d8614f926/go.mod h1:9ESjWnEqriFuLhtthL60Sar/7RFoluCcXsuvEwTV5KM= -github.com/urfave/cli/v2 v2.24.4 h1:0gyJJEBYtCV87zI/x2nZCPyDxD51K6xM8SkwjHFCNEU= -github.com/urfave/cli/v2 v2.24.4/go.mod h1:GHupkWPMM0M/sj1a2b4wUrWBPzazNrIjouW6fmdJLxc= +github.com/urfave/cli/v2 v2.25.5 h1:d0NIAyhh5shGscroL7ek/Ya9QYQE0KNabJgiUinIQkc= +github.com/urfave/cli/v2 v2.25.5/go.mod h1:GHupkWPMM0M/sj1a2b4wUrWBPzazNrIjouW6fmdJLxc= github.com/valyala/bytebufferpool v1.0.0 h1:GqA5TC/0021Y/b9FG4Oi9Mr3q7XYx6KllzawFIhcdPw= github.com/valyala/bytebufferpool v1.0.0/go.mod h1:6bBcMArwyJ5K/AmCkWv1jt77kVWyCJ6HpOuEn7z0Csc= github.com/valyala/fasttemplate v1.2.1/go.mod h1:KHLXt3tVN2HBp8eijSv/kGJopbvo7S+qRAEEKiv+SiQ= github.com/valyala/fasttemplate v1.2.2 h1:lxLXG0uE3Qnshl9QyaK6XJxMXlQZELvChBOCmQD0Loo= github.com/valyala/fasttemplate v1.2.2/go.mod h1:KHLXt3tVN2HBp8eijSv/kGJopbvo7S+qRAEEKiv+SiQ= -github.com/vektah/gqlparser/v2 v2.5.1 h1:ZGu+bquAY23jsxDRcYpWjttRZrUz07LbiY77gUOHcr4= -github.com/vektah/gqlparser/v2 v2.5.1/go.mod h1:mPgqFBu/woKTVYWyNk8cO3kh4S/f4aRFZrvOnp3hmCs= +github.com/vektah/gqlparser/v2 v2.5.3 h1:goUwv4+blhtwR3GwefadPVI4ubYc/WZSypljWMQa6IE= +github.com/vektah/gqlparser/v2 v2.5.3/go.mod h1:z8xXUff237NntSuH8mLFijZ+1tjV1swDbpDqjJmk6ME= github.com/xeipuuv/gojsonpointer v0.0.0-20180127040702-4e3ac2762d5f/go.mod h1:N2zxlSyiKSe5eX1tZViRH5QA0qijqEDrYZiPEAiq3wU= github.com/xeipuuv/gojsonpointer v0.0.0-20190905194746-02993c407bfb h1:zGWFAtiMcyryUHoUjUJX0/lt1H2+i2Ka2n+D3DImSNo= github.com/xeipuuv/gojsonpointer v0.0.0-20190905194746-02993c407bfb/go.mod h1:N2zxlSyiKSe5eX1tZViRH5QA0qijqEDrYZiPEAiq3wU= @@ -343,7 +332,6 @@ github.com/xeipuuv/gojsonschema v1.2.0/go.mod h1:anYRn/JVcOK2ZgGU+IjEV4nwlhoK5sQ github.com/xrash/smetrics v0.0.0-20201216005158-039620a65673 h1:bAn7/zixMGCfxrRTfdpNzjtPYqr8smhKouy9mxVdGPU= github.com/xrash/smetrics v0.0.0-20201216005158-039620a65673/go.mod h1:N3UwUGtsrSj3ccvlPHLoLsHnpR27oXr4ZE984MbSER8= github.com/yuin/goldmark v1.3.5/go.mod h1:mwnBkeHKe2W/ZEtQ+71ViKU8L12m81fl3OWwC1Zlc8k= -github.com/yusufpapurcu/wmi v1.2.2/go.mod h1:SBZ9tNy3G9/m5Oi98Zks0QjeHVDvuK0qfxQmPyzfmi0= github.com/yusufpapurcu/wmi v1.2.3 h1:E1ctvB7uKFMOJw3fdOW32DwGE9I7t++CRUEMKvFoFiw= github.com/yusufpapurcu/wmi v1.2.3/go.mod h1:SBZ9tNy3G9/m5Oi98Zks0QjeHVDvuK0qfxQmPyzfmi0= go.etcd.io/bbolt v1.3.5/go.mod h1:G5EMThwa9y8QZGBClrRx5EY+Yw9kAhnjy3bSjsnlVTQ= @@ -362,12 +350,12 @@ go.uber.org/zap v1.24.0/go.mod h1:2kMP+WWQ8aoFoedH3T2sq6iJ2yDWpHbP0f6MQbS9Gkg= golang.org/x/crypto v0.0.0-20180904163835-0709b304e793/go.mod h1:6SG95UA2DQfeDnfUPMdvaQW0Q7yPrPDi9nlGo2tz2b4= golang.org/x/crypto v0.0.0-20190308221718-c2843e01d9a2/go.mod h1:djNgcEr1/C05ACkg1iLfiJU5Ep61QUkGW8qpdssI0+w= golang.org/x/crypto v0.0.0-20191011191535-87dc89f01550/go.mod h1:yigFU9vqHzYiE8UmvKecakEJjdnWj3jj499lnFckfCI= -golang.org/x/crypto v0.9.0 h1:LF6fAI+IutBocDJ2OT0Q1g8plpYljMZ4+lty+dsqw3g= -golang.org/x/crypto v0.9.0/go.mod h1:yrmDGqONDYtNj3tH8X9dzUun2m2lzPa9ngI6/RUPGR0= +golang.org/x/crypto v0.10.0 h1:LKqV2xt9+kDzSTfOhx4FrkEBcMrAgHSYgzywV9zcGmM= +golang.org/x/crypto v0.10.0/go.mod h1:o4eNf7Ede1fv+hwOwZsTHl9EsPFO6q6ZvYR8vYfY45I= golang.org/x/lint v0.0.0-20190930215403-16217165b5de/go.mod h1:6SW0HCj/g11FgYtHlgUYUwCkIfeOF89ocIRzGO/8vkc= golang.org/x/mod v0.4.2/go.mod h1:s0Qsj1ACt9ePp/hMypM3fl4fZqREWJwdYDEqhRiZZUA= -golang.org/x/mod v0.10.0 h1:lFO9qtOdlre5W1jxS3r/4szv2/6iXxScdzjoBMXNhYk= -golang.org/x/mod v0.10.0/go.mod h1:iBbtSCu2XBx23ZKBPSOrRkjjQPZFPuis4dIYUhu/chs= +golang.org/x/mod v0.11.0 h1:bUO06HqtnRcc/7l71XBe4WcqTZ+3AH1J59zWDDwLKgU= +golang.org/x/mod v0.11.0/go.mod h1:iBbtSCu2XBx23ZKBPSOrRkjjQPZFPuis4dIYUhu/chs= golang.org/x/net v0.0.0-20181114220301-adae6a3d119a/go.mod h1:mL1N/T3taQHkDXs73rZJwtUhF3w3ftmwwsq0BUmARs4= golang.org/x/net v0.0.0-20181201002055-351d144fa1fc/go.mod h1:mL1N/T3taQHkDXs73rZJwtUhF3w3ftmwwsq0BUmARs4= golang.org/x/net v0.0.0-20190311183353-d8887717615a/go.mod h1:t9HGtf8HONx5eT2rtn7q6eTqICYqUVnKs3thJo3Qplg= @@ -375,14 +363,14 @@ golang.org/x/net v0.0.0-20190404232315-eb5bcb51f2a3/go.mod h1:t9HGtf8HONx5eT2rtn golang.org/x/net v0.0.0-20190613194153-d28f0bde5980/go.mod h1:z5CRVTTTmAJ677TzLLGU+0bjPO0LkuOLi4/5GtJWs/s= golang.org/x/net v0.0.0-20190620200207-3b0461eec859/go.mod h1:z5CRVTTTmAJ677TzLLGU+0bjPO0LkuOLi4/5GtJWs/s= golang.org/x/net v0.0.0-20210405180319-a5a99cb37ef4/go.mod h1:p54w0d4576C0XHj96bSt6lcn1PtDYWL6XObtHCRCNQM= -golang.org/x/net v0.10.0 h1:X2//UzNDwYmtCLn7To6G58Wr6f5ahEAQgKNzv9Y951M= -golang.org/x/net v0.10.0/go.mod h1:0qNGK6F8kojg2nk9dLZ2mShWaEBan6FAoqfSigmmuDg= +golang.org/x/net v0.11.0 h1:Gi2tvZIJyBtO9SDr1q9h5hEQCp/4L2RQ+ar0qjx2oNU= +golang.org/x/net v0.11.0/go.mod h1:2L/ixqYpgIVXmeoSA/4Lu7BzTG4KIyPIryS4IsOd1oQ= golang.org/x/sync v0.0.0-20181108010431-42b317875d0f/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM= golang.org/x/sync v0.0.0-20181221193216-37e7f081c4d4/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM= golang.org/x/sync v0.0.0-20190423024810-112230192c58/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM= golang.org/x/sync v0.0.0-20190911185100-cd5d95a43a6e/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM= golang.org/x/sync v0.0.0-20210220032951-036812b2e83c/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM= -golang.org/x/sync v0.2.0 h1:PUR+T4wwASmuSTYdKjYHI5TD22Wy5ogLU5qZCOLxBrI= +golang.org/x/sync v0.3.0 h1:ftCYgMx6zT/asHUrPw8BLLscYtGznsLAnjq5RH9P66E= golang.org/x/sys v0.0.0-20180905080454-ebe1bf3edb33/go.mod h1:STP8DvDyc/dI5b8T5hshtkjS+E42TnysNCUPdjciGhY= golang.org/x/sys v0.0.0-20181116152217-5ac8a444bdc5/go.mod h1:STP8DvDyc/dI5b8T5hshtkjS+E42TnysNCUPdjciGhY= golang.org/x/sys v0.0.0-20190215142949-d0b11bdaac8a/go.mod h1:STP8DvDyc/dI5b8T5hshtkjS+E42TnysNCUPdjciGhY= @@ -401,19 +389,19 @@ golang.org/x/sys v0.0.0-20210630005230-0f9fa26af87c/go.mod h1:oPkhp1MJrh7nUepCBc golang.org/x/sys v0.0.0-20210927094055-39ccf1dd6fa6/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= golang.org/x/sys v0.0.0-20211103235746-7861aae1554b/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= golang.org/x/sys v0.0.0-20220503163025-988cb79eb6c6/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= -golang.org/x/sys v0.0.0-20220704084225-05e143d24a9e/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= golang.org/x/sys v0.0.0-20220715151400-c0bba94af5f8/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= golang.org/x/sys v0.0.0-20220811171246-fbc7d0a398ab/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= golang.org/x/sys v0.2.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= +golang.org/x/sys v0.5.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= golang.org/x/sys v0.6.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= -golang.org/x/sys v0.7.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= -golang.org/x/sys v0.8.0 h1:EBmGv8NaZBZTWvrbjNoL6HVt+IVy3QDQpJs7VRIw3tU= golang.org/x/sys v0.8.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= +golang.org/x/sys v0.9.0 h1:KS/R3tvhPqvJvwcKfnBHJwwthS11LRhmM5D59eEXa0s= +golang.org/x/sys v0.9.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= golang.org/x/term v0.0.0-20201126162022-7de9c90e9dd1/go.mod h1:bj7SfCRtBDWHUb9snDiAeCFNEtKQo2Wmx5Cou7ajbmo= golang.org/x/text v0.3.0/go.mod h1:NqM8EUOU14njkJ3fqMW+pc6Ldnwhi/IjpwHt7yyuwOQ= golang.org/x/text v0.3.3/go.mod h1:5Zoc/QRtKVWzQhOtBMvqHzDpF6irO9z98xDceosuGiQ= -golang.org/x/text v0.9.0 h1:2sjJmO8cDvYveuX97RDLsxlyUxLl+GHoLxBiRdHllBE= -golang.org/x/text v0.9.0/go.mod h1:e1OnstbJyHTd6l/uOt8jFFHp6TRDWZR/bV3emEE/zU8= +golang.org/x/text v0.10.0 h1:UpjohKhiEgNc0CSauXmwYftY1+LlaC75SJwh0SgCX58= +golang.org/x/text v0.10.0/go.mod h1:TvPlkZtksWOMsz7fbANvkp4WM8x/WCo/om8BMLbz+aE= golang.org/x/time v0.0.0-20210220033141-f8bda1e9f3ba/go.mod h1:tRJNPiyCQ0inRvYxbN9jk5I+vvW/OXSQhTDSoE431IQ= golang.org/x/time v0.3.0 h1:rg5rLMjNzMS1RkNLzCG38eapWhnYLFYXDXj2gOlr8j4= golang.org/x/time v0.3.0/go.mod h1:tRJNPiyCQ0inRvYxbN9jk5I+vvW/OXSQhTDSoE431IQ= @@ -422,8 +410,8 @@ golang.org/x/tools v0.0.0-20190311212946-11955173bddd/go.mod h1:LCzVGOaR6xXOjkQ3 golang.org/x/tools v0.0.0-20190425150028-36563e24a262/go.mod h1:RgjU9mgBXZiqYHBnxXauZ1Gv1EHHAz9KjViQ78xBX0Q= golang.org/x/tools v0.0.0-20191119224855-298f0cb1881e/go.mod h1:b+2E5dAYhXwXZwtnZ6UAqBI28+e2cm9otk0dWdXHAEo= golang.org/x/tools v0.1.5/go.mod h1:o0xws9oXOQQZyjljx8fwUC0k7L1pTE6eaCbjGeHmOkk= -golang.org/x/tools v0.9.1 h1:8WMNJAz3zrtPmnYC7ISf5dEn3MT0gY7jBJfw27yrrLo= -golang.org/x/tools v0.9.1/go.mod h1:owI94Op576fPu3cIGQeHs3joujW/2Oc6MtlxbF5dfNc= +golang.org/x/tools v0.10.0 h1:tvDr/iQoUqNdohiYm0LmmKcBk+q86lb9EprIUFhHHGg= +golang.org/x/tools v0.10.0/go.mod h1:UJwyiVBsOA2uwvK/e5OY3GTpDUJriEd+/YlqAwLPmyM= golang.org/x/xerrors v0.0.0-20190717185122-a985d3407aa7/go.mod h1:I/5z698sn9Ka8TeJc9MKroUUfqBBauWjQqLJ2OPfmY0= golang.org/x/xerrors v0.0.0-20191011141410-1b5146add898/go.mod h1:I/5z698sn9Ka8TeJc9MKroUUfqBBauWjQqLJ2OPfmY0= golang.org/x/xerrors v0.0.0-20191204190536-9bdfabe68543/go.mod h1:I/5z698sn9Ka8TeJc9MKroUUfqBBauWjQqLJ2OPfmY0= @@ -445,7 +433,6 @@ gopkg.in/yaml.v2 v2.2.1/go.mod h1:hI93XBmqTisBFMUTm0b8Fm+jr3Dg1NNxqwp+5A1VGuI= gopkg.in/yaml.v2 v2.2.2/go.mod h1:hI93XBmqTisBFMUTm0b8Fm+jr3Dg1NNxqwp+5A1VGuI= gopkg.in/yaml.v2 v2.2.4/go.mod h1:hI93XBmqTisBFMUTm0b8Fm+jr3Dg1NNxqwp+5A1VGuI= gopkg.in/yaml.v2 v2.2.5/go.mod h1:hI93XBmqTisBFMUTm0b8Fm+jr3Dg1NNxqwp+5A1VGuI= -gopkg.in/yaml.v2 v2.2.8/go.mod h1:hI93XBmqTisBFMUTm0b8Fm+jr3Dg1NNxqwp+5A1VGuI= gopkg.in/yaml.v2 v2.4.0 h1:D8xgwECY7CYvx+Y2n4sBz93Jn9JRvxdiyyo8CTfuKaY= gopkg.in/yaml.v2 v2.4.0/go.mod h1:RDklbk79AGWmwhnvt/jBztapEOGDOx6ZbXqjP6csGnQ= gopkg.in/yaml.v3 v3.0.0-20200313102051-9f266ea9e77c/go.mod h1:K4uyk7z7BCEPqu6E+C64Yfv1cQ7kz7rIZviUmN+EgEM= diff --git a/http/graph/graph/graph.go b/http/graph/graph/graph.go index 57d0564e..6db1ccba 100644 --- a/http/graph/graph/graph.go +++ b/http/graph/graph/graph.go @@ -304,7 +304,7 @@ func (e *executableSchema) Schema() *ast.Schema { } func (e *executableSchema) Complexity(typeName, field string, childComplexity int, rawArgs map[string]interface{}) (int, bool) { - ec := executionContext{nil, e} + ec := executionContext{nil, e, 0, 0, nil} _ = ec switch typeName + "." + field { @@ -1480,7 +1480,7 @@ func (e *executableSchema) Complexity(typeName, field string, childComplexity in func (e *executableSchema) Exec(ctx context.Context) graphql.ResponseHandler { rc := graphql.GetOperationContext(ctx) - ec := executionContext{rc, e} + ec := executionContext{rc, e, 0, 0, make(chan graphql.DeferredResult)} inputUnmarshalMap := graphql.BuildUnmarshalerMap( ec.unmarshalInputMetricInput, ec.unmarshalInputMetricsInput, @@ -1490,18 +1490,33 @@ func (e *executableSchema) Exec(ctx context.Context) graphql.ResponseHandler { switch rc.Operation.Operation { case ast.Query: return func(ctx context.Context) *graphql.Response { - if !first { - return nil + var response graphql.Response + var data graphql.Marshaler + if first { + first = false + ctx = graphql.WithUnmarshalerMap(ctx, inputUnmarshalMap) + data = ec._Query(ctx, rc.Operation.SelectionSet) + } else { + if atomic.LoadInt32(&ec.pendingDeferred) > 0 { + result := <-ec.deferredResults + atomic.AddInt32(&ec.pendingDeferred, -1) + data = result.Result + response.Path = result.Path + response.Label = result.Label + response.Errors = result.Errors + } else { + return nil + } } - first = false - ctx = graphql.WithUnmarshalerMap(ctx, inputUnmarshalMap) - data := ec._Query(ctx, rc.Operation.SelectionSet) var buf bytes.Buffer data.MarshalGQL(&buf) - - return &graphql.Response{ - Data: buf.Bytes(), + response.Data = buf.Bytes() + if atomic.LoadInt32(&ec.deferred) > 0 { + hasNext := atomic.LoadInt32(&ec.pendingDeferred) > 0 + response.HasNext = &hasNext } + + return &response } case ast.Mutation: return func(ctx context.Context) *graphql.Response { @@ -1527,6 +1542,28 @@ func (e *executableSchema) Exec(ctx context.Context) graphql.ResponseHandler { type executionContext struct { *graphql.OperationContext *executableSchema + deferred int32 + pendingDeferred int32 + deferredResults chan graphql.DeferredResult +} + +func (ec *executionContext) processDeferredGroup(dg graphql.DeferredGroup) { + atomic.AddInt32(&ec.pendingDeferred, 1) + go func() { + ctx := graphql.WithFreshResponseContext(dg.Context) + dg.FieldSet.Dispatch(ctx) + ds := graphql.DeferredResult{ + Path: dg.Path, + Label: dg.Label, + Result: dg.FieldSet, + Errors: graphql.GetErrors(ctx), + } + // null fields should bubble up + if dg.FieldSet.Invalids > 0 { + ds.Result = graphql.Null + } + ec.deferredResults <- ds + }() } func (ec *executionContext) introspectSchema() (*introspection.Schema, error) { @@ -8337,7 +8374,7 @@ func (ec *executionContext) fieldContext_Query_metrics(ctx context.Context, fiel ctx = graphql.WithFieldContext(ctx, fc) if fc.Args, err = ec.field_Query_metrics_args(ctx, field.ArgumentMap(ec.Variables)); err != nil { ec.Error(ctx, err) - return + return fc, err } return fc, nil } @@ -8421,7 +8458,7 @@ func (ec *executionContext) fieldContext_Query_playoutStatus(ctx context.Context ctx = graphql.WithFieldContext(ctx, fc) if fc.Args, err = ec.field_Query_playoutStatus_args(ctx, field.ArgumentMap(ec.Variables)); err != nil { ec.Error(ctx, err) - return + return fc, err } return fc, nil } @@ -8498,7 +8535,7 @@ func (ec *executionContext) fieldContext_Query_processes(ctx context.Context, fi ctx = graphql.WithFieldContext(ctx, fc) if fc.Args, err = ec.field_Query_processes_args(ctx, field.ArgumentMap(ec.Variables)); err != nil { ec.Error(ctx, err) - return + return fc, err } return fc, nil } @@ -8572,7 +8609,7 @@ func (ec *executionContext) fieldContext_Query_process(ctx context.Context, fiel ctx = graphql.WithFieldContext(ctx, fc) if fc.Args, err = ec.field_Query_process_args(ctx, field.ArgumentMap(ec.Variables)); err != nil { ec.Error(ctx, err) - return + return fc, err } return fc, nil } @@ -8633,7 +8670,7 @@ func (ec *executionContext) fieldContext_Query_probe(ctx context.Context, field ctx = graphql.WithFieldContext(ctx, fc) if fc.Args, err = ec.field_Query_probe_args(ctx, field.ArgumentMap(ec.Variables)); err != nil { ec.Error(ctx, err) - return + return fc, err } return fc, nil } @@ -8707,7 +8744,7 @@ func (ec *executionContext) fieldContext_Query___type(ctx context.Context, field ctx = graphql.WithFieldContext(ctx, fc) if fc.Args, err = ec.field_Query___type_args(ctx, field.ArgumentMap(ec.Variables)); err != nil { ec.Error(ctx, err) - return + return fc, err } return fc, nil } @@ -11227,7 +11264,7 @@ func (ec *executionContext) fieldContext___Type_fields(ctx context.Context, fiel ctx = graphql.WithFieldContext(ctx, fc) if fc.Args, err = ec.field___Type_fields_args(ctx, field.ArgumentMap(ec.Variables)); err != nil { ec.Error(ctx, err) - return + return fc, err } return fc, nil } @@ -11415,7 +11452,7 @@ func (ec *executionContext) fieldContext___Type_enumValues(ctx context.Context, ctx = graphql.WithFieldContext(ctx, fc) if fc.Args, err = ec.field___Type_enumValues_args(ctx, field.ArgumentMap(ec.Variables)); err != nil { ec.Error(ctx, err) - return + return fc, err } return fc, nil } @@ -11597,18 +11634,20 @@ func (ec *executionContext) unmarshalInputMetricInput(ctx context.Context, obj i var err error ctx := graphql.WithPathContext(ctx, graphql.NewPathWithField("name")) - it.Name, err = ec.unmarshalNString2string(ctx, v) + data, err := ec.unmarshalNString2string(ctx, v) if err != nil { return it, err } + it.Name = data case "labels": var err error ctx := graphql.WithPathContext(ctx, graphql.NewPathWithField("labels")) - it.Labels, err = ec.unmarshalOMap2map(ctx, v) + data, err := ec.unmarshalOMap2map(ctx, v) if err != nil { return it, err } + it.Labels = data } } @@ -11633,26 +11672,29 @@ func (ec *executionContext) unmarshalInputMetricsInput(ctx context.Context, obj var err error ctx := graphql.WithPathContext(ctx, graphql.NewPathWithField("timerange_seconds")) - it.TimerangeSeconds, err = ec.unmarshalOInt2ᚖint(ctx, v) + data, err := ec.unmarshalOInt2ᚖint(ctx, v) if err != nil { return it, err } + it.TimerangeSeconds = data case "interval_seconds": var err error ctx := graphql.WithPathContext(ctx, graphql.NewPathWithField("interval_seconds")) - it.IntervalSeconds, err = ec.unmarshalOInt2ᚖint(ctx, v) + data, err := ec.unmarshalOInt2ᚖint(ctx, v) if err != nil { return it, err } + it.IntervalSeconds = data case "metrics": var err error ctx := graphql.WithPathContext(ctx, graphql.NewPathWithField("metrics")) - it.Metrics, err = ec.unmarshalNMetricInput2ᚕᚖgithubᚗcomᚋdatarheiᚋcoreᚋv16ᚋhttpᚋgraphᚋmodelsᚐMetricInputᚄ(ctx, v) + data, err := ec.unmarshalNMetricInput2ᚕᚖgithubᚗcomᚋdatarheiᚋcoreᚋv16ᚋhttpᚋgraphᚋmodelsᚐMetricInputᚄ(ctx, v) if err != nil { return it, err } + it.Metrics = data } } @@ -11694,90 +11736,83 @@ var aVStreamImplementors = []string{"AVStream"} func (ec *executionContext) _AVStream(ctx context.Context, sel ast.SelectionSet, obj *models.AVStream) graphql.Marshaler { fields := graphql.CollectFields(ec.OperationContext, sel, aVStreamImplementors) + out := graphql.NewFieldSet(fields) - var invalids uint32 + deferred := make(map[string]*graphql.FieldSet) for i, field := range fields { switch field.Name { case "__typename": out.Values[i] = graphql.MarshalString("AVStream") case "input": - out.Values[i] = ec._AVStream_input(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "output": - out.Values[i] = ec._AVStream_output(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "aqueue": - out.Values[i] = ec._AVStream_aqueue(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "queue": - out.Values[i] = ec._AVStream_queue(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "dup": - out.Values[i] = ec._AVStream_dup(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "drop": - out.Values[i] = ec._AVStream_drop(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "enc": - out.Values[i] = ec._AVStream_enc(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "looping": - out.Values[i] = ec._AVStream_looping(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "duplicating": - out.Values[i] = ec._AVStream_duplicating(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "gop": - out.Values[i] = ec._AVStream_gop(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } default: panic("unknown field " + strconv.Quote(field.Name)) } } - out.Dispatch() - if invalids > 0 { + out.Dispatch(ctx) + if out.Invalids > 0 { return graphql.Null } + + atomic.AddInt32(&ec.deferred, int32(len(deferred))) + + for label, dfs := range deferred { + ec.processDeferredGroup(graphql.DeferredGroup{ + Label: label, + Path: graphql.GetPath(ctx), + FieldSet: dfs, + Context: ctx, + }) + } + return out } @@ -11785,48 +11820,53 @@ var aVStreamIOImplementors = []string{"AVStreamIO"} func (ec *executionContext) _AVStreamIO(ctx context.Context, sel ast.SelectionSet, obj *models.AVStreamIo) graphql.Marshaler { fields := graphql.CollectFields(ec.OperationContext, sel, aVStreamIOImplementors) + out := graphql.NewFieldSet(fields) - var invalids uint32 + deferred := make(map[string]*graphql.FieldSet) for i, field := range fields { switch field.Name { case "__typename": out.Values[i] = graphql.MarshalString("AVStreamIO") case "state": - out.Values[i] = ec._AVStreamIO_state(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "packet": - out.Values[i] = ec._AVStreamIO_packet(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "time": - out.Values[i] = ec._AVStreamIO_time(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "size_kb": - out.Values[i] = ec._AVStreamIO_size_kb(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } default: panic("unknown field " + strconv.Quote(field.Name)) } } - out.Dispatch() - if invalids > 0 { + out.Dispatch(ctx) + if out.Invalids > 0 { return graphql.Null } + + atomic.AddInt32(&ec.deferred, int32(len(deferred))) + + for label, dfs := range deferred { + ec.processDeferredGroup(graphql.DeferredGroup{ + Label: label, + Path: graphql.GetPath(ctx), + FieldSet: dfs, + Context: ctx, + }) + } + return out } @@ -11834,62 +11874,63 @@ var aboutImplementors = []string{"About"} func (ec *executionContext) _About(ctx context.Context, sel ast.SelectionSet, obj *models.About) graphql.Marshaler { fields := graphql.CollectFields(ec.OperationContext, sel, aboutImplementors) + out := graphql.NewFieldSet(fields) - var invalids uint32 + deferred := make(map[string]*graphql.FieldSet) for i, field := range fields { switch field.Name { case "__typename": out.Values[i] = graphql.MarshalString("About") case "app": - out.Values[i] = ec._About_app(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "id": - out.Values[i] = ec._About_id(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "name": - out.Values[i] = ec._About_name(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "created_at": - out.Values[i] = ec._About_created_at(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "uptime_seconds": - out.Values[i] = ec._About_uptime_seconds(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "version": - out.Values[i] = ec._About_version(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } default: panic("unknown field " + strconv.Quote(field.Name)) } } - out.Dispatch() - if invalids > 0 { + out.Dispatch(ctx) + if out.Invalids > 0 { return graphql.Null } + + atomic.AddInt32(&ec.deferred, int32(len(deferred))) + + for label, dfs := range deferred { + ec.processDeferredGroup(graphql.DeferredGroup{ + Label: label, + Path: graphql.GetPath(ctx), + FieldSet: dfs, + Context: ctx, + }) + } + return out } @@ -11897,62 +11938,63 @@ var aboutVersionImplementors = []string{"AboutVersion"} func (ec *executionContext) _AboutVersion(ctx context.Context, sel ast.SelectionSet, obj *models.AboutVersion) graphql.Marshaler { fields := graphql.CollectFields(ec.OperationContext, sel, aboutVersionImplementors) + out := graphql.NewFieldSet(fields) - var invalids uint32 + deferred := make(map[string]*graphql.FieldSet) for i, field := range fields { switch field.Name { case "__typename": out.Values[i] = graphql.MarshalString("AboutVersion") case "number": - out.Values[i] = ec._AboutVersion_number(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "repository_commit": - out.Values[i] = ec._AboutVersion_repository_commit(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "repository_branch": - out.Values[i] = ec._AboutVersion_repository_branch(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "build_date": - out.Values[i] = ec._AboutVersion_build_date(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "arch": - out.Values[i] = ec._AboutVersion_arch(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "compiler": - out.Values[i] = ec._AboutVersion_compiler(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } default: panic("unknown field " + strconv.Quote(field.Name)) } } - out.Dispatch() - if invalids > 0 { + out.Dispatch(ctx) + if out.Invalids > 0 { return graphql.Null } + + atomic.AddInt32(&ec.deferred, int32(len(deferred))) + + for label, dfs := range deferred { + ec.processDeferredGroup(graphql.DeferredGroup{ + Label: label, + Path: graphql.GetPath(ctx), + FieldSet: dfs, + Context: ctx, + }) + } + return out } @@ -11960,38 +12002,45 @@ var metricImplementors = []string{"Metric"} func (ec *executionContext) _Metric(ctx context.Context, sel ast.SelectionSet, obj *models.Metric) graphql.Marshaler { fields := graphql.CollectFields(ec.OperationContext, sel, metricImplementors) + out := graphql.NewFieldSet(fields) - var invalids uint32 + deferred := make(map[string]*graphql.FieldSet) for i, field := range fields { switch field.Name { case "__typename": out.Values[i] = graphql.MarshalString("Metric") case "name": - out.Values[i] = ec._Metric_name(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "labels": - out.Values[i] = ec._Metric_labels(ctx, field, obj) - case "values": - out.Values[i] = ec._Metric_values(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } default: panic("unknown field " + strconv.Quote(field.Name)) } } - out.Dispatch() - if invalids > 0 { + out.Dispatch(ctx) + if out.Invalids > 0 { return graphql.Null } + + atomic.AddInt32(&ec.deferred, int32(len(deferred))) + + for label, dfs := range deferred { + ec.processDeferredGroup(graphql.DeferredGroup{ + Label: label, + Path: graphql.GetPath(ctx), + FieldSet: dfs, + Context: ctx, + }) + } + return out } @@ -11999,35 +12048,42 @@ var metricsImplementors = []string{"Metrics"} func (ec *executionContext) _Metrics(ctx context.Context, sel ast.SelectionSet, obj *models.Metrics) graphql.Marshaler { fields := graphql.CollectFields(ec.OperationContext, sel, metricsImplementors) + out := graphql.NewFieldSet(fields) - var invalids uint32 + deferred := make(map[string]*graphql.FieldSet) for i, field := range fields { switch field.Name { case "__typename": out.Values[i] = graphql.MarshalString("Metrics") case "timerange_seconds": - out.Values[i] = ec._Metrics_timerange_seconds(ctx, field, obj) - case "interval_seconds": - out.Values[i] = ec._Metrics_interval_seconds(ctx, field, obj) - case "metrics": - out.Values[i] = ec._Metrics_metrics(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } default: panic("unknown field " + strconv.Quote(field.Name)) } } - out.Dispatch() - if invalids > 0 { + out.Dispatch(ctx) + if out.Invalids > 0 { return graphql.Null } + + atomic.AddInt32(&ec.deferred, int32(len(deferred))) + + for label, dfs := range deferred { + ec.processDeferredGroup(graphql.DeferredGroup{ + Label: label, + Path: graphql.GetPath(ctx), + FieldSet: dfs, + Context: ctx, + }) + } + return out } @@ -12040,7 +12096,7 @@ func (ec *executionContext) _Mutation(ctx context.Context, sel ast.SelectionSet) }) out := graphql.NewFieldSet(fields) - var invalids uint32 + deferred := make(map[string]*graphql.FieldSet) for i, field := range fields { innerCtx := graphql.WithRootFieldContext(ctx, &graphql.RootFieldContext{ Object: field.Name, @@ -12051,22 +12107,32 @@ func (ec *executionContext) _Mutation(ctx context.Context, sel ast.SelectionSet) case "__typename": out.Values[i] = graphql.MarshalString("Mutation") case "ping": - out.Values[i] = ec.OperationContext.RootResolverMiddleware(innerCtx, func(ctx context.Context) (res graphql.Marshaler) { return ec._Mutation_ping(ctx, field) }) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } default: panic("unknown field " + strconv.Quote(field.Name)) } } - out.Dispatch() - if invalids > 0 { + out.Dispatch(ctx) + if out.Invalids > 0 { return graphql.Null } + + atomic.AddInt32(&ec.deferred, int32(len(deferred))) + + for label, dfs := range deferred { + ec.processDeferredGroup(graphql.DeferredGroup{ + Label: label, + Path: graphql.GetPath(ctx), + FieldSet: dfs, + Context: ctx, + }) + } + return out } @@ -12074,34 +12140,43 @@ var probeImplementors = []string{"Probe"} func (ec *executionContext) _Probe(ctx context.Context, sel ast.SelectionSet, obj *models.Probe) graphql.Marshaler { fields := graphql.CollectFields(ec.OperationContext, sel, probeImplementors) + out := graphql.NewFieldSet(fields) - var invalids uint32 + deferred := make(map[string]*graphql.FieldSet) for i, field := range fields { switch field.Name { case "__typename": out.Values[i] = graphql.MarshalString("Probe") case "streams": - out.Values[i] = ec._Probe_streams(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "log": - out.Values[i] = ec._Probe_log(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } default: panic("unknown field " + strconv.Quote(field.Name)) } } - out.Dispatch() - if invalids > 0 { + out.Dispatch(ctx) + if out.Invalids > 0 { return graphql.Null } + + atomic.AddInt32(&ec.deferred, int32(len(deferred))) + + for label, dfs := range deferred { + ec.processDeferredGroup(graphql.DeferredGroup{ + Label: label, + Path: graphql.GetPath(ctx), + FieldSet: dfs, + Context: ctx, + }) + } + return out } @@ -12109,132 +12184,113 @@ var probeIOImplementors = []string{"ProbeIO"} func (ec *executionContext) _ProbeIO(ctx context.Context, sel ast.SelectionSet, obj *models.ProbeIo) graphql.Marshaler { fields := graphql.CollectFields(ec.OperationContext, sel, probeIOImplementors) + out := graphql.NewFieldSet(fields) - var invalids uint32 + deferred := make(map[string]*graphql.FieldSet) for i, field := range fields { switch field.Name { case "__typename": out.Values[i] = graphql.MarshalString("ProbeIO") case "url": - out.Values[i] = ec._ProbeIO_url(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "index": - out.Values[i] = ec._ProbeIO_index(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "stream": - out.Values[i] = ec._ProbeIO_stream(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "language": - out.Values[i] = ec._ProbeIO_language(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "type": - out.Values[i] = ec._ProbeIO_type(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "codec": - out.Values[i] = ec._ProbeIO_codec(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "coder": - out.Values[i] = ec._ProbeIO_coder(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "bitrate_kbps": - out.Values[i] = ec._ProbeIO_bitrate_kbps(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "duration_seconds": - out.Values[i] = ec._ProbeIO_duration_seconds(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "fps": - out.Values[i] = ec._ProbeIO_fps(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "pix_fmt": - out.Values[i] = ec._ProbeIO_pix_fmt(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "width": - out.Values[i] = ec._ProbeIO_width(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "height": - out.Values[i] = ec._ProbeIO_height(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "sampling": - out.Values[i] = ec._ProbeIO_sampling(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "layout": - out.Values[i] = ec._ProbeIO_layout(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "channels": - out.Values[i] = ec._ProbeIO_channels(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } default: panic("unknown field " + strconv.Quote(field.Name)) } } - out.Dispatch() - if invalids > 0 { + out.Dispatch(ctx) + if out.Invalids > 0 { return graphql.Null } + + atomic.AddInt32(&ec.deferred, int32(len(deferred))) + + for label, dfs := range deferred { + ec.processDeferredGroup(graphql.DeferredGroup{ + Label: label, + Path: graphql.GetPath(ctx), + FieldSet: dfs, + Context: ctx, + }) + } + return out } @@ -12242,87 +12298,80 @@ var processImplementors = []string{"Process"} func (ec *executionContext) _Process(ctx context.Context, sel ast.SelectionSet, obj *models.Process) graphql.Marshaler { fields := graphql.CollectFields(ec.OperationContext, sel, processImplementors) + out := graphql.NewFieldSet(fields) - var invalids uint32 + deferred := make(map[string]*graphql.FieldSet) for i, field := range fields { switch field.Name { case "__typename": out.Values[i] = graphql.MarshalString("Process") case "id": - out.Values[i] = ec._Process_id(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "owner": - out.Values[i] = ec._Process_owner(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "domain": - out.Values[i] = ec._Process_domain(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "type": - out.Values[i] = ec._Process_type(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "reference": - out.Values[i] = ec._Process_reference(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "created_at": - out.Values[i] = ec._Process_created_at(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "config": - out.Values[i] = ec._Process_config(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "state": - out.Values[i] = ec._Process_state(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "report": - out.Values[i] = ec._Process_report(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "metadata": - out.Values[i] = ec._Process_metadata(ctx, field, obj) - default: panic("unknown field " + strconv.Quote(field.Name)) } } - out.Dispatch() - if invalids > 0 { + out.Dispatch(ctx) + if out.Invalids > 0 { return graphql.Null } + + atomic.AddInt32(&ec.deferred, int32(len(deferred))) + + for label, dfs := range deferred { + ec.processDeferredGroup(graphql.DeferredGroup{ + Label: label, + Path: graphql.GetPath(ctx), + FieldSet: dfs, + Context: ctx, + }) + } + return out } @@ -12330,111 +12379,98 @@ var processConfigImplementors = []string{"ProcessConfig"} func (ec *executionContext) _ProcessConfig(ctx context.Context, sel ast.SelectionSet, obj *models.ProcessConfig) graphql.Marshaler { fields := graphql.CollectFields(ec.OperationContext, sel, processConfigImplementors) + out := graphql.NewFieldSet(fields) - var invalids uint32 + deferred := make(map[string]*graphql.FieldSet) for i, field := range fields { switch field.Name { case "__typename": out.Values[i] = graphql.MarshalString("ProcessConfig") case "id": - out.Values[i] = ec._ProcessConfig_id(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "owner": - out.Values[i] = ec._ProcessConfig_owner(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "domain": - out.Values[i] = ec._ProcessConfig_domain(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "type": - out.Values[i] = ec._ProcessConfig_type(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "reference": - out.Values[i] = ec._ProcessConfig_reference(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "input": - out.Values[i] = ec._ProcessConfig_input(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "output": - out.Values[i] = ec._ProcessConfig_output(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "options": - out.Values[i] = ec._ProcessConfig_options(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "reconnect": - out.Values[i] = ec._ProcessConfig_reconnect(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "reconnect_delay_seconds": - out.Values[i] = ec._ProcessConfig_reconnect_delay_seconds(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "autostart": - out.Values[i] = ec._ProcessConfig_autostart(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "stale_timeout_seconds": - out.Values[i] = ec._ProcessConfig_stale_timeout_seconds(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "limits": - out.Values[i] = ec._ProcessConfig_limits(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } default: panic("unknown field " + strconv.Quote(field.Name)) } } - out.Dispatch() - if invalids > 0 { + out.Dispatch(ctx) + if out.Invalids > 0 { return graphql.Null } + + atomic.AddInt32(&ec.deferred, int32(len(deferred))) + + for label, dfs := range deferred { + ec.processDeferredGroup(graphql.DeferredGroup{ + Label: label, + Path: graphql.GetPath(ctx), + FieldSet: dfs, + Context: ctx, + }) + } + return out } @@ -12442,41 +12478,48 @@ var processConfigIOImplementors = []string{"ProcessConfigIO"} func (ec *executionContext) _ProcessConfigIO(ctx context.Context, sel ast.SelectionSet, obj *models.ProcessConfigIo) graphql.Marshaler { fields := graphql.CollectFields(ec.OperationContext, sel, processConfigIOImplementors) + out := graphql.NewFieldSet(fields) - var invalids uint32 + deferred := make(map[string]*graphql.FieldSet) for i, field := range fields { switch field.Name { case "__typename": out.Values[i] = graphql.MarshalString("ProcessConfigIO") case "id": - out.Values[i] = ec._ProcessConfigIO_id(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "address": - out.Values[i] = ec._ProcessConfigIO_address(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "options": - out.Values[i] = ec._ProcessConfigIO_options(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } default: panic("unknown field " + strconv.Quote(field.Name)) } } - out.Dispatch() - if invalids > 0 { + out.Dispatch(ctx) + if out.Invalids > 0 { return graphql.Null } + + atomic.AddInt32(&ec.deferred, int32(len(deferred))) + + for label, dfs := range deferred { + ec.processDeferredGroup(graphql.DeferredGroup{ + Label: label, + Path: graphql.GetPath(ctx), + FieldSet: dfs, + Context: ctx, + }) + } + return out } @@ -12484,41 +12527,48 @@ var processConfigLimitsImplementors = []string{"ProcessConfigLimits"} func (ec *executionContext) _ProcessConfigLimits(ctx context.Context, sel ast.SelectionSet, obj *models.ProcessConfigLimits) graphql.Marshaler { fields := graphql.CollectFields(ec.OperationContext, sel, processConfigLimitsImplementors) + out := graphql.NewFieldSet(fields) - var invalids uint32 + deferred := make(map[string]*graphql.FieldSet) for i, field := range fields { switch field.Name { case "__typename": out.Values[i] = graphql.MarshalString("ProcessConfigLimits") case "cpu_usage": - out.Values[i] = ec._ProcessConfigLimits_cpu_usage(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "memory_bytes": - out.Values[i] = ec._ProcessConfigLimits_memory_bytes(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "waitfor_seconds": - out.Values[i] = ec._ProcessConfigLimits_waitfor_seconds(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } default: panic("unknown field " + strconv.Quote(field.Name)) } } - out.Dispatch() - if invalids > 0 { + out.Dispatch(ctx) + if out.Invalids > 0 { return graphql.Null } + + atomic.AddInt32(&ec.deferred, int32(len(deferred))) + + for label, dfs := range deferred { + ec.processDeferredGroup(graphql.DeferredGroup{ + Label: label, + Path: graphql.GetPath(ctx), + FieldSet: dfs, + Context: ctx, + }) + } + return out } @@ -12526,48 +12576,53 @@ var processReportImplementors = []string{"ProcessReport", "IProcessReportHistory func (ec *executionContext) _ProcessReport(ctx context.Context, sel ast.SelectionSet, obj *models.ProcessReport) graphql.Marshaler { fields := graphql.CollectFields(ec.OperationContext, sel, processReportImplementors) + out := graphql.NewFieldSet(fields) - var invalids uint32 + deferred := make(map[string]*graphql.FieldSet) for i, field := range fields { switch field.Name { case "__typename": out.Values[i] = graphql.MarshalString("ProcessReport") case "created_at": - out.Values[i] = ec._ProcessReport_created_at(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "prelude": - out.Values[i] = ec._ProcessReport_prelude(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "log": - out.Values[i] = ec._ProcessReport_log(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "history": - out.Values[i] = ec._ProcessReport_history(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } default: panic("unknown field " + strconv.Quote(field.Name)) } } - out.Dispatch() - if invalids > 0 { + out.Dispatch(ctx) + if out.Invalids > 0 { return graphql.Null } + + atomic.AddInt32(&ec.deferred, int32(len(deferred))) + + for label, dfs := range deferred { + ec.processDeferredGroup(graphql.DeferredGroup{ + Label: label, + Path: graphql.GetPath(ctx), + FieldSet: dfs, + Context: ctx, + }) + } + return out } @@ -12575,41 +12630,48 @@ var processReportHistoryEntryImplementors = []string{"ProcessReportHistoryEntry" func (ec *executionContext) _ProcessReportHistoryEntry(ctx context.Context, sel ast.SelectionSet, obj *models.ProcessReportHistoryEntry) graphql.Marshaler { fields := graphql.CollectFields(ec.OperationContext, sel, processReportHistoryEntryImplementors) + out := graphql.NewFieldSet(fields) - var invalids uint32 + deferred := make(map[string]*graphql.FieldSet) for i, field := range fields { switch field.Name { case "__typename": out.Values[i] = graphql.MarshalString("ProcessReportHistoryEntry") case "created_at": - out.Values[i] = ec._ProcessReportHistoryEntry_created_at(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "prelude": - out.Values[i] = ec._ProcessReportHistoryEntry_prelude(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "log": - out.Values[i] = ec._ProcessReportHistoryEntry_log(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } default: panic("unknown field " + strconv.Quote(field.Name)) } } - out.Dispatch() - if invalids > 0 { + out.Dispatch(ctx) + if out.Invalids > 0 { return graphql.Null } + + atomic.AddInt32(&ec.deferred, int32(len(deferred))) + + for label, dfs := range deferred { + ec.processDeferredGroup(graphql.DeferredGroup{ + Label: label, + Path: graphql.GetPath(ctx), + FieldSet: dfs, + Context: ctx, + }) + } + return out } @@ -12617,34 +12679,43 @@ var processReportLogEntryImplementors = []string{"ProcessReportLogEntry"} func (ec *executionContext) _ProcessReportLogEntry(ctx context.Context, sel ast.SelectionSet, obj *models.ProcessReportLogEntry) graphql.Marshaler { fields := graphql.CollectFields(ec.OperationContext, sel, processReportLogEntryImplementors) + out := graphql.NewFieldSet(fields) - var invalids uint32 + deferred := make(map[string]*graphql.FieldSet) for i, field := range fields { switch field.Name { case "__typename": out.Values[i] = graphql.MarshalString("ProcessReportLogEntry") case "timestamp": - out.Values[i] = ec._ProcessReportLogEntry_timestamp(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "data": - out.Values[i] = ec._ProcessReportLogEntry_data(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } default: panic("unknown field " + strconv.Quote(field.Name)) } } - out.Dispatch() - if invalids > 0 { + out.Dispatch(ctx) + if out.Invalids > 0 { return graphql.Null } + + atomic.AddInt32(&ec.deferred, int32(len(deferred))) + + for label, dfs := range deferred { + ec.processDeferredGroup(graphql.DeferredGroup{ + Label: label, + Path: graphql.GetPath(ctx), + FieldSet: dfs, + Context: ctx, + }) + } + return out } @@ -12652,83 +12723,78 @@ var processStateImplementors = []string{"ProcessState"} func (ec *executionContext) _ProcessState(ctx context.Context, sel ast.SelectionSet, obj *models.ProcessState) graphql.Marshaler { fields := graphql.CollectFields(ec.OperationContext, sel, processStateImplementors) + out := graphql.NewFieldSet(fields) - var invalids uint32 + deferred := make(map[string]*graphql.FieldSet) for i, field := range fields { switch field.Name { case "__typename": out.Values[i] = graphql.MarshalString("ProcessState") case "order": - out.Values[i] = ec._ProcessState_order(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "state": - out.Values[i] = ec._ProcessState_state(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "runtime_seconds": - out.Values[i] = ec._ProcessState_runtime_seconds(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "reconnect_seconds": - out.Values[i] = ec._ProcessState_reconnect_seconds(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "last_logline": - out.Values[i] = ec._ProcessState_last_logline(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "progress": - out.Values[i] = ec._ProcessState_progress(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "memory_bytes": - out.Values[i] = ec._ProcessState_memory_bytes(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "cpu_usage": - out.Values[i] = ec._ProcessState_cpu_usage(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "command": - out.Values[i] = ec._ProcessState_command(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } default: panic("unknown field " + strconv.Quote(field.Name)) } } - out.Dispatch() - if invalids > 0 { + out.Dispatch(ctx) + if out.Invalids > 0 { return graphql.Null } + + atomic.AddInt32(&ec.deferred, int32(len(deferred))) + + for label, dfs := range deferred { + ec.processDeferredGroup(graphql.DeferredGroup{ + Label: label, + Path: graphql.GetPath(ctx), + FieldSet: dfs, + Context: ctx, + }) + } + return out } @@ -12736,104 +12802,93 @@ var progressImplementors = []string{"Progress"} func (ec *executionContext) _Progress(ctx context.Context, sel ast.SelectionSet, obj *models.Progress) graphql.Marshaler { fields := graphql.CollectFields(ec.OperationContext, sel, progressImplementors) + out := graphql.NewFieldSet(fields) - var invalids uint32 + deferred := make(map[string]*graphql.FieldSet) for i, field := range fields { switch field.Name { case "__typename": out.Values[i] = graphql.MarshalString("Progress") case "input": - out.Values[i] = ec._Progress_input(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "output": - out.Values[i] = ec._Progress_output(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "frame": - out.Values[i] = ec._Progress_frame(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "packet": - out.Values[i] = ec._Progress_packet(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "fps": - out.Values[i] = ec._Progress_fps(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "q": - out.Values[i] = ec._Progress_q(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "size_kb": - out.Values[i] = ec._Progress_size_kb(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "time": - out.Values[i] = ec._Progress_time(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "bitrate_kbit": - out.Values[i] = ec._Progress_bitrate_kbit(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "speed": - out.Values[i] = ec._Progress_speed(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "drop": - out.Values[i] = ec._Progress_drop(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "dup": - out.Values[i] = ec._Progress_dup(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } default: panic("unknown field " + strconv.Quote(field.Name)) } } - out.Dispatch() - if invalids > 0 { + out.Dispatch(ctx) + if out.Invalids > 0 { return graphql.Null } + + atomic.AddInt32(&ec.deferred, int32(len(deferred))) + + for label, dfs := range deferred { + ec.processDeferredGroup(graphql.DeferredGroup{ + Label: label, + Path: graphql.GetPath(ctx), + FieldSet: dfs, + Context: ctx, + }) + } + return out } @@ -12841,171 +12896,140 @@ var progressIOImplementors = []string{"ProgressIO"} func (ec *executionContext) _ProgressIO(ctx context.Context, sel ast.SelectionSet, obj *models.ProgressIo) graphql.Marshaler { fields := graphql.CollectFields(ec.OperationContext, sel, progressIOImplementors) + out := graphql.NewFieldSet(fields) - var invalids uint32 + deferred := make(map[string]*graphql.FieldSet) for i, field := range fields { switch field.Name { case "__typename": out.Values[i] = graphql.MarshalString("ProgressIO") case "id": - out.Values[i] = ec._ProgressIO_id(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "address": - out.Values[i] = ec._ProgressIO_address(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "index": - out.Values[i] = ec._ProgressIO_index(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "stream": - out.Values[i] = ec._ProgressIO_stream(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "format": - out.Values[i] = ec._ProgressIO_format(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "type": - out.Values[i] = ec._ProgressIO_type(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "codec": - out.Values[i] = ec._ProgressIO_codec(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "coder": - out.Values[i] = ec._ProgressIO_coder(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "frame": - out.Values[i] = ec._ProgressIO_frame(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "fps": - out.Values[i] = ec._ProgressIO_fps(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "packet": - out.Values[i] = ec._ProgressIO_packet(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "pps": - out.Values[i] = ec._ProgressIO_pps(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "size_kb": - out.Values[i] = ec._ProgressIO_size_kb(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "bitrate_kbit": - out.Values[i] = ec._ProgressIO_bitrate_kbit(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "pixfmt": - out.Values[i] = ec._ProgressIO_pixfmt(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "q": - out.Values[i] = ec._ProgressIO_q(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "width": - out.Values[i] = ec._ProgressIO_width(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "height": - out.Values[i] = ec._ProgressIO_height(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "sampling": - out.Values[i] = ec._ProgressIO_sampling(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "layout": - out.Values[i] = ec._ProgressIO_layout(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "channels": - out.Values[i] = ec._ProgressIO_channels(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "avstream": - out.Values[i] = ec._ProgressIO_avstream(ctx, field, obj) - default: panic("unknown field " + strconv.Quote(field.Name)) } } - out.Dispatch() - if invalids > 0 { + out.Dispatch(ctx) + if out.Invalids > 0 { return graphql.Null } + + atomic.AddInt32(&ec.deferred, int32(len(deferred))) + + for label, dfs := range deferred { + ec.processDeferredGroup(graphql.DeferredGroup{ + Label: label, + Path: graphql.GetPath(ctx), + FieldSet: dfs, + Context: ctx, + }) + } + return out } @@ -13018,7 +13042,7 @@ func (ec *executionContext) _Query(ctx context.Context, sel ast.SelectionSet) gr }) out := graphql.NewFieldSet(fields) - var invalids uint32 + deferred := make(map[string]*graphql.FieldSet) for i, field := range fields { innerCtx := graphql.WithRootFieldContext(ctx, &graphql.RootFieldContext{ Object: field.Name, @@ -13031,7 +13055,7 @@ func (ec *executionContext) _Query(ctx context.Context, sel ast.SelectionSet) gr case "ping": field := field - innerFunc := func(ctx context.Context) (res graphql.Marshaler) { + innerFunc := func(ctx context.Context, fs *graphql.FieldSet) (res graphql.Marshaler) { defer func() { if r := recover(); r != nil { ec.Error(ctx, ec.Recover(ctx, r)) @@ -13039,22 +13063,21 @@ func (ec *executionContext) _Query(ctx context.Context, sel ast.SelectionSet) gr }() res = ec._Query_ping(ctx, field) if res == graphql.Null { - atomic.AddUint32(&invalids, 1) + atomic.AddUint32(&fs.Invalids, 1) } return res } rrm := func(ctx context.Context) graphql.Marshaler { - return ec.OperationContext.RootResolverMiddleware(ctx, innerFunc) + return ec.OperationContext.RootResolverMiddleware(ctx, + func(ctx context.Context) graphql.Marshaler { return innerFunc(ctx, out) }) } - out.Concurrently(i, func() graphql.Marshaler { - return rrm(innerCtx) - }) + out.Concurrently(i, func(ctx context.Context) graphql.Marshaler { return rrm(innerCtx) }) case "about": field := field - innerFunc := func(ctx context.Context) (res graphql.Marshaler) { + innerFunc := func(ctx context.Context, fs *graphql.FieldSet) (res graphql.Marshaler) { defer func() { if r := recover(); r != nil { ec.Error(ctx, ec.Recover(ctx, r)) @@ -13065,16 +13088,15 @@ func (ec *executionContext) _Query(ctx context.Context, sel ast.SelectionSet) gr } rrm := func(ctx context.Context) graphql.Marshaler { - return ec.OperationContext.RootResolverMiddleware(ctx, innerFunc) + return ec.OperationContext.RootResolverMiddleware(ctx, + func(ctx context.Context) graphql.Marshaler { return innerFunc(ctx, out) }) } - out.Concurrently(i, func() graphql.Marshaler { - return rrm(innerCtx) - }) + out.Concurrently(i, func(ctx context.Context) graphql.Marshaler { return rrm(innerCtx) }) case "log": field := field - innerFunc := func(ctx context.Context) (res graphql.Marshaler) { + innerFunc := func(ctx context.Context, fs *graphql.FieldSet) (res graphql.Marshaler) { defer func() { if r := recover(); r != nil { ec.Error(ctx, ec.Recover(ctx, r)) @@ -13082,22 +13104,21 @@ func (ec *executionContext) _Query(ctx context.Context, sel ast.SelectionSet) gr }() res = ec._Query_log(ctx, field) if res == graphql.Null { - atomic.AddUint32(&invalids, 1) + atomic.AddUint32(&fs.Invalids, 1) } return res } rrm := func(ctx context.Context) graphql.Marshaler { - return ec.OperationContext.RootResolverMiddleware(ctx, innerFunc) + return ec.OperationContext.RootResolverMiddleware(ctx, + func(ctx context.Context) graphql.Marshaler { return innerFunc(ctx, out) }) } - out.Concurrently(i, func() graphql.Marshaler { - return rrm(innerCtx) - }) + out.Concurrently(i, func(ctx context.Context) graphql.Marshaler { return rrm(innerCtx) }) case "metrics": field := field - innerFunc := func(ctx context.Context) (res graphql.Marshaler) { + innerFunc := func(ctx context.Context, fs *graphql.FieldSet) (res graphql.Marshaler) { defer func() { if r := recover(); r != nil { ec.Error(ctx, ec.Recover(ctx, r)) @@ -13105,22 +13126,21 @@ func (ec *executionContext) _Query(ctx context.Context, sel ast.SelectionSet) gr }() res = ec._Query_metrics(ctx, field) if res == graphql.Null { - atomic.AddUint32(&invalids, 1) + atomic.AddUint32(&fs.Invalids, 1) } return res } rrm := func(ctx context.Context) graphql.Marshaler { - return ec.OperationContext.RootResolverMiddleware(ctx, innerFunc) + return ec.OperationContext.RootResolverMiddleware(ctx, + func(ctx context.Context) graphql.Marshaler { return innerFunc(ctx, out) }) } - out.Concurrently(i, func() graphql.Marshaler { - return rrm(innerCtx) - }) + out.Concurrently(i, func(ctx context.Context) graphql.Marshaler { return rrm(innerCtx) }) case "playoutStatus": field := field - innerFunc := func(ctx context.Context) (res graphql.Marshaler) { + innerFunc := func(ctx context.Context, fs *graphql.FieldSet) (res graphql.Marshaler) { defer func() { if r := recover(); r != nil { ec.Error(ctx, ec.Recover(ctx, r)) @@ -13131,16 +13151,15 @@ func (ec *executionContext) _Query(ctx context.Context, sel ast.SelectionSet) gr } rrm := func(ctx context.Context) graphql.Marshaler { - return ec.OperationContext.RootResolverMiddleware(ctx, innerFunc) + return ec.OperationContext.RootResolverMiddleware(ctx, + func(ctx context.Context) graphql.Marshaler { return innerFunc(ctx, out) }) } - out.Concurrently(i, func() graphql.Marshaler { - return rrm(innerCtx) - }) + out.Concurrently(i, func(ctx context.Context) graphql.Marshaler { return rrm(innerCtx) }) case "processes": field := field - innerFunc := func(ctx context.Context) (res graphql.Marshaler) { + innerFunc := func(ctx context.Context, fs *graphql.FieldSet) (res graphql.Marshaler) { defer func() { if r := recover(); r != nil { ec.Error(ctx, ec.Recover(ctx, r)) @@ -13148,22 +13167,21 @@ func (ec *executionContext) _Query(ctx context.Context, sel ast.SelectionSet) gr }() res = ec._Query_processes(ctx, field) if res == graphql.Null { - atomic.AddUint32(&invalids, 1) + atomic.AddUint32(&fs.Invalids, 1) } return res } rrm := func(ctx context.Context) graphql.Marshaler { - return ec.OperationContext.RootResolverMiddleware(ctx, innerFunc) + return ec.OperationContext.RootResolverMiddleware(ctx, + func(ctx context.Context) graphql.Marshaler { return innerFunc(ctx, out) }) } - out.Concurrently(i, func() graphql.Marshaler { - return rrm(innerCtx) - }) + out.Concurrently(i, func(ctx context.Context) graphql.Marshaler { return rrm(innerCtx) }) case "process": field := field - innerFunc := func(ctx context.Context) (res graphql.Marshaler) { + innerFunc := func(ctx context.Context, fs *graphql.FieldSet) (res graphql.Marshaler) { defer func() { if r := recover(); r != nil { ec.Error(ctx, ec.Recover(ctx, r)) @@ -13174,16 +13192,15 @@ func (ec *executionContext) _Query(ctx context.Context, sel ast.SelectionSet) gr } rrm := func(ctx context.Context) graphql.Marshaler { - return ec.OperationContext.RootResolverMiddleware(ctx, innerFunc) + return ec.OperationContext.RootResolverMiddleware(ctx, + func(ctx context.Context) graphql.Marshaler { return innerFunc(ctx, out) }) } - out.Concurrently(i, func() graphql.Marshaler { - return rrm(innerCtx) - }) + out.Concurrently(i, func(ctx context.Context) graphql.Marshaler { return rrm(innerCtx) }) case "probe": field := field - innerFunc := func(ctx context.Context) (res graphql.Marshaler) { + innerFunc := func(ctx context.Context, fs *graphql.FieldSet) (res graphql.Marshaler) { defer func() { if r := recover(); r != nil { ec.Error(ctx, ec.Recover(ctx, r)) @@ -13191,38 +13208,45 @@ func (ec *executionContext) _Query(ctx context.Context, sel ast.SelectionSet) gr }() res = ec._Query_probe(ctx, field) if res == graphql.Null { - atomic.AddUint32(&invalids, 1) + atomic.AddUint32(&fs.Invalids, 1) } return res } rrm := func(ctx context.Context) graphql.Marshaler { - return ec.OperationContext.RootResolverMiddleware(ctx, innerFunc) + return ec.OperationContext.RootResolverMiddleware(ctx, + func(ctx context.Context) graphql.Marshaler { return innerFunc(ctx, out) }) } - out.Concurrently(i, func() graphql.Marshaler { - return rrm(innerCtx) - }) + out.Concurrently(i, func(ctx context.Context) graphql.Marshaler { return rrm(innerCtx) }) case "__type": - out.Values[i] = ec.OperationContext.RootResolverMiddleware(innerCtx, func(ctx context.Context) (res graphql.Marshaler) { return ec._Query___type(ctx, field) }) - case "__schema": - out.Values[i] = ec.OperationContext.RootResolverMiddleware(innerCtx, func(ctx context.Context) (res graphql.Marshaler) { return ec._Query___schema(ctx, field) }) - default: panic("unknown field " + strconv.Quote(field.Name)) } } - out.Dispatch() - if invalids > 0 { + out.Dispatch(ctx) + if out.Invalids > 0 { return graphql.Null } + + atomic.AddInt32(&ec.deferred, int32(len(deferred))) + + for label, dfs := range deferred { + ec.processDeferredGroup(graphql.DeferredGroup{ + Label: label, + Path: graphql.GetPath(ctx), + FieldSet: dfs, + Context: ctx, + }) + } + return out } @@ -13230,122 +13254,105 @@ var rawAVstreamImplementors = []string{"RawAVstream"} func (ec *executionContext) _RawAVstream(ctx context.Context, sel ast.SelectionSet, obj *models.RawAVstream) graphql.Marshaler { fields := graphql.CollectFields(ec.OperationContext, sel, rawAVstreamImplementors) + out := graphql.NewFieldSet(fields) - var invalids uint32 + deferred := make(map[string]*graphql.FieldSet) for i, field := range fields { switch field.Name { case "__typename": out.Values[i] = graphql.MarshalString("RawAVstream") case "id": - out.Values[i] = ec._RawAVstream_id(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "url": - out.Values[i] = ec._RawAVstream_url(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "stream": - out.Values[i] = ec._RawAVstream_stream(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "queue": - out.Values[i] = ec._RawAVstream_queue(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "aqueue": - out.Values[i] = ec._RawAVstream_aqueue(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "dup": - out.Values[i] = ec._RawAVstream_dup(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "drop": - out.Values[i] = ec._RawAVstream_drop(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "enc": - out.Values[i] = ec._RawAVstream_enc(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "looping": - out.Values[i] = ec._RawAVstream_looping(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "duplicating": - out.Values[i] = ec._RawAVstream_duplicating(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "gop": - out.Values[i] = ec._RawAVstream_gop(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "debug": - out.Values[i] = ec._RawAVstream_debug(ctx, field, obj) - case "input": - out.Values[i] = ec._RawAVstream_input(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "output": - out.Values[i] = ec._RawAVstream_output(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "swap": - out.Values[i] = ec._RawAVstream_swap(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } default: panic("unknown field " + strconv.Quote(field.Name)) } } - out.Dispatch() - if invalids > 0 { + out.Dispatch(ctx) + if out.Invalids > 0 { return graphql.Null } + + atomic.AddInt32(&ec.deferred, int32(len(deferred))) + + for label, dfs := range deferred { + ec.processDeferredGroup(graphql.DeferredGroup{ + Label: label, + Path: graphql.GetPath(ctx), + FieldSet: dfs, + Context: ctx, + }) + } + return out } @@ -13353,48 +13360,53 @@ var rawAVstreamIOImplementors = []string{"RawAVstreamIO"} func (ec *executionContext) _RawAVstreamIO(ctx context.Context, sel ast.SelectionSet, obj *models.RawAVstreamIo) graphql.Marshaler { fields := graphql.CollectFields(ec.OperationContext, sel, rawAVstreamIOImplementors) + out := graphql.NewFieldSet(fields) - var invalids uint32 + deferred := make(map[string]*graphql.FieldSet) for i, field := range fields { switch field.Name { case "__typename": out.Values[i] = graphql.MarshalString("RawAVstreamIO") case "state": - out.Values[i] = ec._RawAVstreamIO_state(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "packet": - out.Values[i] = ec._RawAVstreamIO_packet(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "time": - out.Values[i] = ec._RawAVstreamIO_time(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "size_kb": - out.Values[i] = ec._RawAVstreamIO_size_kb(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } default: panic("unknown field " + strconv.Quote(field.Name)) } } - out.Dispatch() - if invalids > 0 { + out.Dispatch(ctx) + if out.Invalids > 0 { return graphql.Null } + + atomic.AddInt32(&ec.deferred, int32(len(deferred))) + + for label, dfs := range deferred { + ec.processDeferredGroup(graphql.DeferredGroup{ + Label: label, + Path: graphql.GetPath(ctx), + FieldSet: dfs, + Context: ctx, + }) + } + return out } @@ -13402,48 +13414,53 @@ var rawAVstreamSwapImplementors = []string{"RawAVstreamSwap"} func (ec *executionContext) _RawAVstreamSwap(ctx context.Context, sel ast.SelectionSet, obj *models.RawAVstreamSwap) graphql.Marshaler { fields := graphql.CollectFields(ec.OperationContext, sel, rawAVstreamSwapImplementors) + out := graphql.NewFieldSet(fields) - var invalids uint32 + deferred := make(map[string]*graphql.FieldSet) for i, field := range fields { switch field.Name { case "__typename": out.Values[i] = graphql.MarshalString("RawAVstreamSwap") case "url": - out.Values[i] = ec._RawAVstreamSwap_url(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "status": - out.Values[i] = ec._RawAVstreamSwap_status(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "lasturl": - out.Values[i] = ec._RawAVstreamSwap_lasturl(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "lasterror": - out.Values[i] = ec._RawAVstreamSwap_lasterror(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } default: panic("unknown field " + strconv.Quote(field.Name)) } } - out.Dispatch() - if invalids > 0 { + out.Dispatch(ctx) + if out.Invalids > 0 { return graphql.Null } + + atomic.AddInt32(&ec.deferred, int32(len(deferred))) + + for label, dfs := range deferred { + ec.processDeferredGroup(graphql.DeferredGroup{ + Label: label, + Path: graphql.GetPath(ctx), + FieldSet: dfs, + Context: ctx, + }) + } + return out } @@ -13451,52 +13468,55 @@ var __DirectiveImplementors = []string{"__Directive"} func (ec *executionContext) ___Directive(ctx context.Context, sel ast.SelectionSet, obj *introspection.Directive) graphql.Marshaler { fields := graphql.CollectFields(ec.OperationContext, sel, __DirectiveImplementors) + out := graphql.NewFieldSet(fields) - var invalids uint32 + deferred := make(map[string]*graphql.FieldSet) for i, field := range fields { switch field.Name { case "__typename": out.Values[i] = graphql.MarshalString("__Directive") case "name": - out.Values[i] = ec.___Directive_name(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "description": - out.Values[i] = ec.___Directive_description(ctx, field, obj) - case "locations": - out.Values[i] = ec.___Directive_locations(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "args": - out.Values[i] = ec.___Directive_args(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "isRepeatable": - out.Values[i] = ec.___Directive_isRepeatable(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } default: panic("unknown field " + strconv.Quote(field.Name)) } } - out.Dispatch() - if invalids > 0 { + out.Dispatch(ctx) + if out.Invalids > 0 { return graphql.Null } + + atomic.AddInt32(&ec.deferred, int32(len(deferred))) + + for label, dfs := range deferred { + ec.processDeferredGroup(graphql.DeferredGroup{ + Label: label, + Path: graphql.GetPath(ctx), + FieldSet: dfs, + Context: ctx, + }) + } + return out } @@ -13504,42 +13524,47 @@ var __EnumValueImplementors = []string{"__EnumValue"} func (ec *executionContext) ___EnumValue(ctx context.Context, sel ast.SelectionSet, obj *introspection.EnumValue) graphql.Marshaler { fields := graphql.CollectFields(ec.OperationContext, sel, __EnumValueImplementors) + out := graphql.NewFieldSet(fields) - var invalids uint32 + deferred := make(map[string]*graphql.FieldSet) for i, field := range fields { switch field.Name { case "__typename": out.Values[i] = graphql.MarshalString("__EnumValue") case "name": - out.Values[i] = ec.___EnumValue_name(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "description": - out.Values[i] = ec.___EnumValue_description(ctx, field, obj) - case "isDeprecated": - out.Values[i] = ec.___EnumValue_isDeprecated(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "deprecationReason": - out.Values[i] = ec.___EnumValue_deprecationReason(ctx, field, obj) - default: panic("unknown field " + strconv.Quote(field.Name)) } } - out.Dispatch() - if invalids > 0 { + out.Dispatch(ctx) + if out.Invalids > 0 { return graphql.Null } + + atomic.AddInt32(&ec.deferred, int32(len(deferred))) + + for label, dfs := range deferred { + ec.processDeferredGroup(graphql.DeferredGroup{ + Label: label, + Path: graphql.GetPath(ctx), + FieldSet: dfs, + Context: ctx, + }) + } + return out } @@ -13547,56 +13572,57 @@ var __FieldImplementors = []string{"__Field"} func (ec *executionContext) ___Field(ctx context.Context, sel ast.SelectionSet, obj *introspection.Field) graphql.Marshaler { fields := graphql.CollectFields(ec.OperationContext, sel, __FieldImplementors) + out := graphql.NewFieldSet(fields) - var invalids uint32 + deferred := make(map[string]*graphql.FieldSet) for i, field := range fields { switch field.Name { case "__typename": out.Values[i] = graphql.MarshalString("__Field") case "name": - out.Values[i] = ec.___Field_name(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "description": - out.Values[i] = ec.___Field_description(ctx, field, obj) - case "args": - out.Values[i] = ec.___Field_args(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "type": - out.Values[i] = ec.___Field_type(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "isDeprecated": - out.Values[i] = ec.___Field_isDeprecated(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "deprecationReason": - out.Values[i] = ec.___Field_deprecationReason(ctx, field, obj) - default: panic("unknown field " + strconv.Quote(field.Name)) } } - out.Dispatch() - if invalids > 0 { + out.Dispatch(ctx) + if out.Invalids > 0 { return graphql.Null } + + atomic.AddInt32(&ec.deferred, int32(len(deferred))) + + for label, dfs := range deferred { + ec.processDeferredGroup(graphql.DeferredGroup{ + Label: label, + Path: graphql.GetPath(ctx), + FieldSet: dfs, + Context: ctx, + }) + } + return out } @@ -13604,42 +13630,47 @@ var __InputValueImplementors = []string{"__InputValue"} func (ec *executionContext) ___InputValue(ctx context.Context, sel ast.SelectionSet, obj *introspection.InputValue) graphql.Marshaler { fields := graphql.CollectFields(ec.OperationContext, sel, __InputValueImplementors) + out := graphql.NewFieldSet(fields) - var invalids uint32 + deferred := make(map[string]*graphql.FieldSet) for i, field := range fields { switch field.Name { case "__typename": out.Values[i] = graphql.MarshalString("__InputValue") case "name": - out.Values[i] = ec.___InputValue_name(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "description": - out.Values[i] = ec.___InputValue_description(ctx, field, obj) - case "type": - out.Values[i] = ec.___InputValue_type(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "defaultValue": - out.Values[i] = ec.___InputValue_defaultValue(ctx, field, obj) - default: panic("unknown field " + strconv.Quote(field.Name)) } } - out.Dispatch() - if invalids > 0 { + out.Dispatch(ctx) + if out.Invalids > 0 { return graphql.Null } + + atomic.AddInt32(&ec.deferred, int32(len(deferred))) + + for label, dfs := range deferred { + ec.processDeferredGroup(graphql.DeferredGroup{ + Label: label, + Path: graphql.GetPath(ctx), + FieldSet: dfs, + Context: ctx, + }) + } + return out } @@ -13647,53 +13678,54 @@ var __SchemaImplementors = []string{"__Schema"} func (ec *executionContext) ___Schema(ctx context.Context, sel ast.SelectionSet, obj *introspection.Schema) graphql.Marshaler { fields := graphql.CollectFields(ec.OperationContext, sel, __SchemaImplementors) + out := graphql.NewFieldSet(fields) - var invalids uint32 + deferred := make(map[string]*graphql.FieldSet) for i, field := range fields { switch field.Name { case "__typename": out.Values[i] = graphql.MarshalString("__Schema") case "description": - out.Values[i] = ec.___Schema_description(ctx, field, obj) - case "types": - out.Values[i] = ec.___Schema_types(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "queryType": - out.Values[i] = ec.___Schema_queryType(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "mutationType": - out.Values[i] = ec.___Schema_mutationType(ctx, field, obj) - case "subscriptionType": - out.Values[i] = ec.___Schema_subscriptionType(ctx, field, obj) - case "directives": - out.Values[i] = ec.___Schema_directives(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } default: panic("unknown field " + strconv.Quote(field.Name)) } } - out.Dispatch() - if invalids > 0 { + out.Dispatch(ctx) + if out.Invalids > 0 { return graphql.Null } + + atomic.AddInt32(&ec.deferred, int32(len(deferred))) + + for label, dfs := range deferred { + ec.processDeferredGroup(graphql.DeferredGroup{ + Label: label, + Path: graphql.GetPath(ctx), + FieldSet: dfs, + Context: ctx, + }) + } + return out } @@ -13701,63 +13733,56 @@ var __TypeImplementors = []string{"__Type"} func (ec *executionContext) ___Type(ctx context.Context, sel ast.SelectionSet, obj *introspection.Type) graphql.Marshaler { fields := graphql.CollectFields(ec.OperationContext, sel, __TypeImplementors) + out := graphql.NewFieldSet(fields) - var invalids uint32 + deferred := make(map[string]*graphql.FieldSet) for i, field := range fields { switch field.Name { case "__typename": out.Values[i] = graphql.MarshalString("__Type") case "kind": - out.Values[i] = ec.___Type_kind(ctx, field, obj) - if out.Values[i] == graphql.Null { - invalids++ + out.Invalids++ } case "name": - out.Values[i] = ec.___Type_name(ctx, field, obj) - case "description": - out.Values[i] = ec.___Type_description(ctx, field, obj) - case "fields": - out.Values[i] = ec.___Type_fields(ctx, field, obj) - case "interfaces": - out.Values[i] = ec.___Type_interfaces(ctx, field, obj) - case "possibleTypes": - out.Values[i] = ec.___Type_possibleTypes(ctx, field, obj) - case "enumValues": - out.Values[i] = ec.___Type_enumValues(ctx, field, obj) - case "inputFields": - out.Values[i] = ec.___Type_inputFields(ctx, field, obj) - case "ofType": - out.Values[i] = ec.___Type_ofType(ctx, field, obj) - case "specifiedByURL": - out.Values[i] = ec.___Type_specifiedByURL(ctx, field, obj) - default: panic("unknown field " + strconv.Quote(field.Name)) } } - out.Dispatch() - if invalids > 0 { + out.Dispatch(ctx) + if out.Invalids > 0 { return graphql.Null } + + atomic.AddInt32(&ec.deferred, int32(len(deferred))) + + for label, dfs := range deferred { + ec.processDeferredGroup(graphql.DeferredGroup{ + Label: label, + Path: graphql.GetPath(ctx), + FieldSet: dfs, + Context: ctx, + }) + } + return out } diff --git a/http/graph/models/models_gen.go b/http/graph/models/models_gen.go index 56bb286b..64fae4f7 100644 --- a/http/graph/models/models_gen.go +++ b/http/graph/models/models_gen.go @@ -58,24 +58,24 @@ type AboutVersion struct { type Metric struct { Name string `json:"name"` - Labels map[string]interface{} `json:"labels"` + Labels map[string]interface{} `json:"labels,omitempty"` Values []*scalars.MetricsResponseValue `json:"values"` } type MetricInput struct { Name string `json:"name"` - Labels map[string]interface{} `json:"labels"` + Labels map[string]interface{} `json:"labels,omitempty"` } type Metrics struct { - TimerangeSeconds *int `json:"timerange_seconds"` - IntervalSeconds *int `json:"interval_seconds"` + TimerangeSeconds *int `json:"timerange_seconds,omitempty"` + IntervalSeconds *int `json:"interval_seconds,omitempty"` Metrics []*Metric `json:"metrics"` } type MetricsInput struct { - TimerangeSeconds *int `json:"timerange_seconds"` - IntervalSeconds *int `json:"interval_seconds"` + TimerangeSeconds *int `json:"timerange_seconds,omitempty"` + IntervalSeconds *int `json:"interval_seconds,omitempty"` Metrics []*MetricInput `json:"metrics"` } @@ -113,7 +113,7 @@ type Process struct { Config *ProcessConfig `json:"config"` State *ProcessState `json:"state"` Report *ProcessReport `json:"report"` - Metadata map[string]interface{} `json:"metadata"` + Metadata map[string]interface{} `json:"metadata,omitempty"` } type ProcessConfig struct { @@ -257,7 +257,7 @@ type ProgressIo struct { Sampling scalars.Uint64 `json:"sampling"` Layout string `json:"layout"` Channels scalars.Uint64 `json:"channels"` - Avstream *AVStream `json:"avstream"` + Avstream *AVStream `json:"avstream,omitempty"` } type RawAVstream struct { @@ -272,7 +272,7 @@ type RawAVstream struct { Looping bool `json:"looping"` Duplicating bool `json:"duplicating"` Gop string `json:"gop"` - Debug interface{} `json:"debug"` + Debug interface{} `json:"debug,omitempty"` Input *RawAVstreamIo `json:"input"` Output *RawAVstreamIo `json:"output"` Swap *RawAVstreamSwap `json:"swap"` @@ -341,17 +341,17 @@ type State string const ( StateRunning State = "RUNNING" - StateIDLe State = "IDLE" + StateIdle State = "IDLE" ) var AllState = []State{ StateRunning, - StateIDLe, + StateIdle, } func (e State) IsValid() bool { switch e { - case StateRunning, StateIDLe: + case StateRunning, StateIdle: return true } return false diff --git a/http/graph/resolver/about.resolvers.go b/http/graph/resolver/about.resolvers.go index d62771b5..266c7fab 100644 --- a/http/graph/resolver/about.resolvers.go +++ b/http/graph/resolver/about.resolvers.go @@ -2,6 +2,7 @@ package resolver // This file will be automatically regenerated based on the schema, any resolver implementations // will be copied through when generating and any unknown code will be moved to the end. +// Code generated by github.com/99designs/gqlgen version v0.17.33 import ( "context" diff --git a/http/graph/resolver/log.resolvers.go b/http/graph/resolver/log.resolvers.go index 18aa2281..2e29633b 100644 --- a/http/graph/resolver/log.resolvers.go +++ b/http/graph/resolver/log.resolvers.go @@ -2,6 +2,7 @@ package resolver // This file will be automatically regenerated based on the schema, any resolver implementations // will be copied through when generating and any unknown code will be moved to the end. +// Code generated by github.com/99designs/gqlgen version v0.17.33 import ( "context" diff --git a/http/graph/resolver/metrics.resolvers.go b/http/graph/resolver/metrics.resolvers.go index e9ae7d3e..704ba664 100644 --- a/http/graph/resolver/metrics.resolvers.go +++ b/http/graph/resolver/metrics.resolvers.go @@ -2,6 +2,7 @@ package resolver // This file will be automatically regenerated based on the schema, any resolver implementations // will be copied through when generating and any unknown code will be moved to the end. +// Code generated by github.com/99designs/gqlgen version v0.17.33 import ( "context" diff --git a/http/graph/resolver/playout.resolvers.go b/http/graph/resolver/playout.resolvers.go index 6c93ed62..d0b77740 100644 --- a/http/graph/resolver/playout.resolvers.go +++ b/http/graph/resolver/playout.resolvers.go @@ -2,6 +2,7 @@ package resolver // This file will be automatically regenerated based on the schema, any resolver implementations // will be copied through when generating and any unknown code will be moved to the end. +// Code generated by github.com/99designs/gqlgen version v0.17.33 import ( "context" diff --git a/http/graph/resolver/process.resolvers.go b/http/graph/resolver/process.resolvers.go index 2691eeaa..e71b51a0 100644 --- a/http/graph/resolver/process.resolvers.go +++ b/http/graph/resolver/process.resolvers.go @@ -2,6 +2,7 @@ package resolver // This file will be automatically regenerated based on the schema, any resolver implementations // will be copied through when generating and any unknown code will be moved to the end. +// Code generated by github.com/99designs/gqlgen version v0.17.33 import ( "context" diff --git a/http/graph/resolver/schema.resolvers.go b/http/graph/resolver/schema.resolvers.go index 89a0b922..bb30e9e8 100644 --- a/http/graph/resolver/schema.resolvers.go +++ b/http/graph/resolver/schema.resolvers.go @@ -2,6 +2,7 @@ package resolver // This file will be automatically regenerated based on the schema, any resolver implementations // will be copied through when generating and any unknown code will be moved to the end. +// Code generated by github.com/99designs/gqlgen version v0.17.33 import ( "context" diff --git a/iam/identity/identity.go b/iam/identity/identity.go index 4fadf4e7..57ba5710 100644 --- a/iam/identity/identity.go +++ b/iam/identity/identity.go @@ -50,7 +50,7 @@ func (u *User) validate() error { return fmt.Errorf("a name is required") } - chars := `A-Za-z0-9:_-` + chars := `A-Za-z0-9._-` re := regexp.MustCompile(`[^` + chars + `]`) if re.MatchString(u.Name) { diff --git a/rtmp/rtmp.go b/rtmp/rtmp.go index cfdcc7d2..be349b16 100644 --- a/rtmp/rtmp.go +++ b/rtmp/rtmp.go @@ -196,13 +196,13 @@ func (s *server) Channels() []string { return channels } -func (s *server) log(who, what, action, path, message string, client net.Addr) { +func (s *server) log(who, handler, action, resource, message string, client net.Addr) { s.logger.Info().WithFields(log.Fields{ - "who": who, - "what": what, - "action": action, - "path": path, - "client": client.String(), + "who": who, + "handler": handler, + "action": action, + "resource": resource, + "client": client.String(), }).Log(message) } @@ -258,7 +258,7 @@ func (s *server) handlePlay(conn *rtmp.Conn) { identity, err := s.findIdentityFromStreamKey(token) if err != nil { s.logger.Debug().WithError(err).Log("invalid streamkey") - s.log(identity, "PLAY", "FORBIDDEN", playpath, "invalid streamkey ("+token+")", remote) + s.log("", "PLAY", "FORBIDDEN", playpath, "invalid streamkey ("+token+")", remote) return } @@ -476,13 +476,13 @@ func (s *server) findIdentityFromStreamKey(key string) (string, error) { var token string - elements := strings.Split(key, ":") - if len(elements) == 1 { + before, after, found := strings.Cut(key, ":") + if !found { identity = s.iam.GetDefaultVerifier() - token = elements[0] + token = before } else { - identity, err = s.iam.GetVerifier(elements[0]) - token = elements[1] + identity, err = s.iam.GetVerifier(before) + token = after } if err != nil { @@ -490,7 +490,13 @@ func (s *server) findIdentityFromStreamKey(key string) (string, error) { } if ok, err := identity.VerifyServiceToken(token); !ok { - return "$anon", fmt.Errorf("invalid token: %w", err) + if err != nil { + err = fmt.Errorf("invalid token: %w", err) + } else { + err = fmt.Errorf("invalid token") + } + + return "$anon", err } return identity.Name(), nil diff --git a/srt/srt.go b/srt/srt.go index ad19b42f..78a69394 100644 --- a/srt/srt.go +++ b/srt/srt.go @@ -268,10 +268,11 @@ func (s *server) srtlogListener(ctx context.Context) { } } -func (s *server) log(handler, action, resource, message string, client net.Addr) { +func (s *server) log(who, handler, action, resource, message string, client net.Addr) { s.logger.Info().WithFields(log.Fields{ + "who": who, "handler": handler, - "status": action, + "action": action, "resource": resource, "client": client.String(), }).Log(message) @@ -282,14 +283,19 @@ func (s *server) handleConnect(req srt.ConnRequest) srt.ConnType { client := req.RemoteAddr() streamId := req.StreamId() + if req.Version() != 5 { + s.log("", "CONNECT", "INVALID", streamId, "unsupported version", client) + return srt.REJECT + } + si, err := url.ParseStreamId(streamId) if err != nil { - s.log("CONNECT", "INVALID", "", err.Error(), client) + s.log("", "CONNECT", "INVALID", streamId, err.Error(), client) return srt.REJECT } if len(si.Resource) == 0 { - s.log("CONNECT", "INVALID", "", "stream resource not provided", client) + s.log("", "CONNECT", "INVALID", streamId, "stream resource not provided", client) return srt.REJECT } @@ -298,23 +304,23 @@ func (s *server) handleConnect(req srt.ConnRequest) srt.ConnType { } else if si.Mode == "request" { mode = srt.SUBSCRIBE } else { - s.log("CONNECT", "INVALID", si.Resource, "invalid connection mode", client) + s.log("", "CONNECT", "INVALID", si.Resource, "invalid connection mode", client) return srt.REJECT } if len(s.passphrase) != 0 { if !req.IsEncrypted() { - s.log("CONNECT", "FORBIDDEN", si.Resource, "connection has to be encrypted", client) + s.log("", "CONNECT", "FORBIDDEN", si.Resource, "connection has to be encrypted", client) return srt.REJECT } if err := req.SetPassphrase(s.passphrase); err != nil { - s.log("CONNECT", "FORBIDDEN", si.Resource, err.Error(), client) + s.log("", "CONNECT", "FORBIDDEN", si.Resource, err.Error(), client) return srt.REJECT } } else { if req.IsEncrypted() { - s.log("CONNECT", "INVALID", si.Resource, "connection must not be encrypted", client) + s.log("", "CONNECT", "INVALID", si.Resource, "connection must not be encrypted", client) return srt.REJECT } } @@ -322,7 +328,7 @@ func (s *server) handleConnect(req srt.ConnRequest) srt.ConnType { identity, err := s.findIdentityFromToken(si.Token) if err != nil { s.logger.Debug().WithError(err).Log("invalid token") - s.log("CONNECT", "FORBIDDEN", si.Resource, "invalid token", client) + s.log(identity, "CONNECT", "FORBIDDEN", si.Resource, "invalid token", client) return srt.REJECT } @@ -334,7 +340,7 @@ func (s *server) handleConnect(req srt.ConnRequest) srt.ConnType { } if !s.iam.Enforce(identity, domain, resource, action) { - s.log("CONNECT", "FORBIDDEN", si.Resource, "access denied", client) + s.log(identity, "CONNECT", "FORBIDDEN", si.Resource, "access denied", client) return srt.REJECT } @@ -350,6 +356,7 @@ func (s *server) publish(conn srt.Conn, isProxy bool) error { client := conn.RemoteAddr() si, _ := url.ParseStreamId(streamId) + identity, _ := s.findIdentityFromToken(si.Token) // Look for the stream s.lock.Lock() @@ -363,15 +370,15 @@ func (s *server) publish(conn srt.Conn, isProxy bool) error { s.lock.Unlock() if ch == nil { - s.log("PUBLISH", "CONFLICT", si.Resource, "already publishing", client) + s.log(identity, "PUBLISH", "CONFLICT", si.Resource, "already publishing", client) conn.Close() return fmt.Errorf("already publishing this resource") } - s.log("PUBLISH", "START", si.Resource, "", client) + s.log(identity, "PUBLISH", "START", si.Resource, "", client) // Blocks until connection closes - ch.pubsub.Publish(conn) + err := ch.pubsub.Publish(conn) s.lock.Lock() delete(s.channels, si.Resource) @@ -379,7 +386,7 @@ func (s *server) publish(conn srt.Conn, isProxy bool) error { ch.Close() - s.log("PUBLISH", "STOP", si.Resource, "", client) + s.log(identity, "PUBLISH", "STOP", si.Resource, err.Error(), client) conn.Close() @@ -393,6 +400,7 @@ func (s *server) handleSubscribe(conn srt.Conn) { client := conn.RemoteAddr() si, _ := url.ParseStreamId(streamId) + identity, _ := s.findIdentityFromToken(si.Token) // Look for the stream locally s.lock.RLock() @@ -403,7 +411,7 @@ func (s *server) handleSubscribe(conn srt.Conn) { // Check in the cluster for the stream and proxy it srturl, err := s.proxy.GetURL("srt", si.Resource) if err != nil { - s.log("SUBSCRIBE", "NOTFOUND", si.Resource, "no publisher for this resource found", client) + s.log(identity, "PLAY", "NOTFOUND", si.Resource, "no publisher for this resource found", client) return } @@ -412,16 +420,16 @@ func (s *server) handleSubscribe(conn srt.Conn) { config := srt.DefaultConfig() config.StreamId = streamId config.Latency = 200 * time.Millisecond // This might be a value obtained from the cluster - host, err := config.UnmarshalURL(peerurl) + host, port, err := config.UnmarshalURL(peerurl) if err != nil { s.logger.Error().WithField("address", peerurl).WithError(err).Log("Parsing proxy address failed") - s.log("SUBSCRIBE", "NOTFOUND", si.Resource, "no publisher for this resource found", client) + s.log(identity, "PLAY", "NOTFOUND", si.Resource, "no publisher for this resource found", client) return } - src, err := srt.Dial("srt", host, config) + src, err := srt.Dial("srt", host+":"+port, config) if err != nil { s.logger.Error().WithField("address", peerurl).WithError(err).Log("Proxying address failed") - s.log("SUBSCRIBE", "NOTFOUND", si.Resource, "no publisher for this resource found", client) + s.log(identity, "PLAY", "NOTFOUND", si.Resource, "no publisher for this resource found", client) return } @@ -429,13 +437,13 @@ func (s *server) handleSubscribe(conn srt.Conn) { wg.Add(1) go func() { - s.log("SUBSCRIBE", "PROXYSTART", peerurl, "", client) + s.log(identity, "PLAY", "PROXYSTART", peerurl, "", client) wg.Done() err := s.publish(src, true) if err != nil { s.logger.Error().WithField("address", srturl).WithError(err).Log("Proxying address failed") } - s.log("SUBSCRIBE", "PROXYPUBLISHSTOP", peerurl, "", client) + s.log(identity, "PLAY", "PROXYSTOP", peerurl, "", client) }() // Wait for the goroutine to start @@ -463,14 +471,14 @@ func (s *server) handleSubscribe(conn srt.Conn) { } if ch != nil { - s.log("SUBSCRIBE", "START", si.Resource, "", client) + s.log(identity, "PLAY", "START", si.Resource, "", client) id := ch.AddSubscriber(conn, si.Resource) // Blocks until connection closes - ch.pubsub.Subscribe(conn) + err := ch.pubsub.Subscribe(conn) - s.log("SUBSCRIBE", "STOP", si.Resource, "", client) + s.log(identity, "PLAY", "STOP", si.Resource, err.Error(), client) ch.RemoveSubscriber(id) } @@ -486,13 +494,13 @@ func (s *server) findIdentityFromToken(key string) (string, error) { var token string - elements := strings.Split(key, ":") - if len(elements) == 1 { + before, after, found := strings.Cut(key, ":") + if !found { identity = s.iam.GetDefaultVerifier() - token = elements[0] + token = before } else { - identity, err = s.iam.GetVerifier(elements[0]) - token = elements[1] + identity, err = s.iam.GetVerifier(before) + token = after } if err != nil { @@ -500,7 +508,13 @@ func (s *server) findIdentityFromToken(key string) (string, error) { } if ok, err := identity.VerifyServiceToken(token); !ok { - return "$anon", fmt.Errorf("invalid token: %w", err) + if err != nil { + err = fmt.Errorf("invalid token: %w", err) + } else { + err = fmt.Errorf("invalid token") + } + + return "$anon", err } return identity.Name(), nil diff --git a/vendor/github.com/99designs/gqlgen/.golangci.yml b/vendor/github.com/99designs/gqlgen/.golangci.yml index 21099b69..5966bf2c 100644 --- a/vendor/github.com/99designs/gqlgen/.golangci.yml +++ b/vendor/github.com/99designs/gqlgen/.golangci.yml @@ -11,8 +11,6 @@ linters: disable-all: true enable: - bodyclose - - deadcode - - depguard - dupl - errcheck - gocritic @@ -25,11 +23,9 @@ linters: - nakedret - prealloc - staticcheck - - structcheck - typecheck - unconvert - unused - - varcheck issues: exclude-rules: diff --git a/vendor/github.com/99designs/gqlgen/CHANGELOG.md b/vendor/github.com/99designs/gqlgen/CHANGELOG.md index ee9cb3d8..73c93188 100644 --- a/vendor/github.com/99designs/gqlgen/CHANGELOG.md +++ b/vendor/github.com/99designs/gqlgen/CHANGELOG.md @@ -5,10 +5,186 @@ The format is based on [Keep a Changelog](https://keepachangelog.com/en/1.0.0/), and this project adheres to [Semantic Versioning](https://semver.org/spec/v2.0.0.html). -## [Unreleased](https://github.com/99designs/gqlgen/compare/v0.17.30...HEAD) +## [Unreleased](https://github.com/99designs/gqlgen/compare/v0.17.32...HEAD) + +## [v0.17.32](https://github.com/99designs/gqlgen/compare/v0.17.31...v0.17.32) - 2023-06-06 +- 3a81a78b release v0.17.32 + +- dbb61174 Added unit tests for defer (#2657) + +
5c19c841 Addressing few issues in defer feature (#2656) + +And fixed hasNext to only appear in the payload when there is deferred usage + +* Regenerate + +* Use go 1.18 compatible atomic operations + +* Regenerate + +
+ +
8e295024 Update extra fields type definition and plus docs about the feature (#2655) + +* Update extra fields type definition and plus docs about the feature + +* Update docs + +
+ +
adf5da27 Make usage of omitempty tag optional (#2649) + +* Make usage of omitempty tag optional + +* adding probably good enough test + +* some kinda docs + +* lintersssssssssssssssssssssssssssss + +* removing unnecessary fields from config + +
+ +- 7ab33176 Extra fields (#2638) + +
22deb8bd allow binding a GraphQL `Any` field to a struct method returning `*any` (#2644) + +* allow binding GQL `Any` field to struct method returning `*any` + +* add singlefile tests for binding to `*any` case + +* add followschema tests for binding to `*any` case + +* make ptr_to_any binding tests follow binding conventions better + +
+ +
c313bf3d `[@defer](https://github.com/defer)` initial support (#2642) + +* support returning errors with deferred fragments. + + +* update integration tests. + +* fix gotpl indent and pass the correct context to deferred .Dispatch(). + +* Added hasNext in the tests + +* Added back root_.gotpl + +* Regenerate + +* Regenerate recursively + +* Updated schema-expected.graphql + + +* Fixed starwars_test.go + +* Cleanup + +* Add graphql response hasnext omitempty and update tests to match + + +--------- + +
+ +
4d945da2 feat(federation): update Apollo Federation v2 definitions (#2635) + +* feat(federation): update Apollo Federation v2 definitions + +Fix Apollo Federation v2 directive definitions: +* `_FieldSet` was renamed `FieldSet` + + +* regenerate examples + +
+ +- 9796f91d Generate entity resolvers for interfaces with [@key](https://github.com/key) defined (#2634) + +
33fdd1b5 fix enum capitalization (#2630) + +* fix enum capitalization + +* apply suggestion: adding comment + +
+ +
82a110ce Fix uint32 unmarshal (#2631) + +The string unmarshal for uint32 used ParseInt instead of ParseUint, +which would parse the wrong range of valid numbers. + +
+ +- e62a0277 Add Changelog entries for v0.17.31 + +- f707aa8d v0.17.31 postrelease bump + + + + + + +## [v0.17.31](https://github.com/99designs/gqlgen/compare/v0.17.30...v0.17.31) - 2023-05-05 +- 37b26207 release v0.17.31 + +- 4016b2bd fix (#2628) + +- 5a81c3e3 Remove other && + +- fde269c0 Remove extraneous run + +- 47a5b333 Avoid && in command for retry + +- 4d8f850b Add timeout minutes + +- c839b6c1 Bandaid for flaky websocket tests + +
395c362b New option to make comments on resolver optional (#2627) + +* remove 'foo' above resolver + +* regenerate after 6a3869707da1ffff7c196fcbcac44c92 + +* omit resolver template comment + +* re-generate + +
+ +- 239b97ee Omittable input fields (#2585) + +
2ad08fff Bugfix: add missing return statements in GRAPHQL and UrlEncodedForm transports. (#2625) + +Two transports (GRAPHQL and UrlEncodedForm) did not have return +statement at the end of `if err` block. Instead of returning +a 'could not cleanup body' error, we continued processing. + +User still got an error. But instead of early 'could not cleanup' +error, user gor 'Internal system error' which happened a few +lines after the if block. + +Tests are added. + +
+ +- a13eca12 update autogenerated gqlgen.yml with new options. (#2622) + +- f1f63b52 Post Release Changelog entry + +- 81f3469f v0.17.30 postrelease bump + + + + + ## [v0.17.30](https://github.com/99designs/gqlgen/compare/v0.17.29...v0.17.30) - 2023-04-20 - 4754e2b3 release v0.17.30 diff --git a/vendor/github.com/99designs/gqlgen/codegen/args.go b/vendor/github.com/99designs/gqlgen/codegen/args.go index 0fd30fff..c4cecea9 100644 --- a/vendor/github.com/99designs/gqlgen/codegen/args.go +++ b/vendor/github.com/99designs/gqlgen/codegen/args.go @@ -103,9 +103,9 @@ nextArg: return newArgs, nil } -func (a *Data) Args() map[string][]*FieldArgument { +func (d *Data) Args() map[string][]*FieldArgument { ret := map[string][]*FieldArgument{} - for _, o := range a.Objects { + for _, o := range d.Objects { for _, f := range o.Fields { if len(f.Args) > 0 { ret[f.ArgsFunc()] = f.Args @@ -113,9 +113,9 @@ func (a *Data) Args() map[string][]*FieldArgument { } } - for _, d := range a.Directives() { - if len(d.Args) > 0 { - ret[d.ArgsFunc()] = d.Args + for _, directive := range d.Directives() { + if len(directive.Args) > 0 { + ret[directive.ArgsFunc()] = directive.Args } } return ret diff --git a/vendor/github.com/99designs/gqlgen/codegen/config/binder.go b/vendor/github.com/99designs/gqlgen/codegen/config/binder.go index 51f23ede..e479417a 100644 --- a/vendor/github.com/99designs/gqlgen/codegen/config/binder.go +++ b/vendor/github.com/99designs/gqlgen/codegen/config/binder.go @@ -221,91 +221,99 @@ func (ref *TypeReference) Elem() *TypeReference { return nil } -func (t *TypeReference) IsPtr() bool { - _, isPtr := t.GO.(*types.Pointer) +func (ref *TypeReference) IsPtr() bool { + _, isPtr := ref.GO.(*types.Pointer) return isPtr } // fix for https://github.com/golang/go/issues/31103 may make it possible to remove this (may still be useful) -func (t *TypeReference) IsPtrToPtr() bool { - if p, isPtr := t.GO.(*types.Pointer); isPtr { +func (ref *TypeReference) IsPtrToPtr() bool { + if p, isPtr := ref.GO.(*types.Pointer); isPtr { _, isPtr := p.Elem().(*types.Pointer) return isPtr } return false } -func (t *TypeReference) IsNilable() bool { - return IsNilable(t.GO) +func (ref *TypeReference) IsNilable() bool { + return IsNilable(ref.GO) } -func (t *TypeReference) IsSlice() bool { - _, isSlice := t.GO.(*types.Slice) - return t.GQL.Elem != nil && isSlice +func (ref *TypeReference) IsSlice() bool { + _, isSlice := ref.GO.(*types.Slice) + return ref.GQL.Elem != nil && isSlice } -func (t *TypeReference) IsPtrToSlice() bool { - if t.IsPtr() { - _, isPointerToSlice := t.GO.(*types.Pointer).Elem().(*types.Slice) +func (ref *TypeReference) IsPtrToSlice() bool { + if ref.IsPtr() { + _, isPointerToSlice := ref.GO.(*types.Pointer).Elem().(*types.Slice) return isPointerToSlice } return false } -func (t *TypeReference) IsNamed() bool { - _, isSlice := t.GO.(*types.Named) +func (ref *TypeReference) IsPtrToIntf() bool { + if ref.IsPtr() { + _, isPointerToInterface := ref.GO.(*types.Pointer).Elem().(*types.Interface) + return isPointerToInterface + } + return false +} + +func (ref *TypeReference) IsNamed() bool { + _, isSlice := ref.GO.(*types.Named) return isSlice } -func (t *TypeReference) IsStruct() bool { - _, isStruct := t.GO.Underlying().(*types.Struct) +func (ref *TypeReference) IsStruct() bool { + _, isStruct := ref.GO.Underlying().(*types.Struct) return isStruct } -func (t *TypeReference) IsScalar() bool { - return t.Definition.Kind == ast.Scalar +func (ref *TypeReference) IsScalar() bool { + return ref.Definition.Kind == ast.Scalar } -func (t *TypeReference) UniquenessKey() string { +func (ref *TypeReference) UniquenessKey() string { nullability := "O" - if t.GQL.NonNull { + if ref.GQL.NonNull { nullability = "N" } elemNullability := "" - if t.GQL.Elem != nil && t.GQL.Elem.NonNull { + if ref.GQL.Elem != nil && ref.GQL.Elem.NonNull { // Fix for #896 elemNullability = "ᚄ" } - return nullability + t.Definition.Name + "2" + templates.TypeIdentifier(t.GO) + elemNullability + return nullability + ref.Definition.Name + "2" + templates.TypeIdentifier(ref.GO) + elemNullability } -func (t *TypeReference) MarshalFunc() string { - if t.Definition == nil { - panic(errors.New("Definition missing for " + t.GQL.Name())) +func (ref *TypeReference) MarshalFunc() string { + if ref.Definition == nil { + panic(errors.New("Definition missing for " + ref.GQL.Name())) } - if t.Definition.Kind == ast.InputObject { + if ref.Definition.Kind == ast.InputObject { return "" } - return "marshal" + t.UniquenessKey() + return "marshal" + ref.UniquenessKey() } -func (t *TypeReference) UnmarshalFunc() string { - if t.Definition == nil { - panic(errors.New("Definition missing for " + t.GQL.Name())) +func (ref *TypeReference) UnmarshalFunc() string { + if ref.Definition == nil { + panic(errors.New("Definition missing for " + ref.GQL.Name())) } - if !t.Definition.IsInputType() { + if !ref.Definition.IsInputType() { return "" } - return "unmarshal" + t.UniquenessKey() + return "unmarshal" + ref.UniquenessKey() } -func (t *TypeReference) IsTargetNilable() bool { - return IsNilable(t.Target) +func (ref *TypeReference) IsTargetNilable() bool { + return IsNilable(ref.Target) } func (b *Binder) PushRef(ret *TypeReference) { diff --git a/vendor/github.com/99designs/gqlgen/codegen/config/config.go b/vendor/github.com/99designs/gqlgen/codegen/config/config.go index a4c3e47a..df4f6be3 100644 --- a/vendor/github.com/99designs/gqlgen/codegen/config/config.go +++ b/vendor/github.com/99designs/gqlgen/codegen/config/config.go @@ -35,6 +35,7 @@ type Config struct { ReturnPointersInUmarshalInput bool `yaml:"return_pointers_in_unmarshalinput,omitempty"` ResolversAlwaysReturnPointers bool `yaml:"resolvers_always_return_pointers,omitempty"` NullableInputOmittable bool `yaml:"nullable_input_omittable,omitempty"` + EnableModelJsonOmitemptyTag *bool `yaml:"enable_model_json_omitempty_tag,omitempty"` SkipValidation bool `yaml:"skip_validation,omitempty"` SkipModTidy bool `yaml:"skip_mod_tidy,omitempty"` Sources []*ast.Source `yaml:"-"` @@ -324,6 +325,9 @@ func (c *Config) injectTypesFromSchema() error { type TypeMapEntry struct { Model StringList `yaml:"model"` Fields map[string]TypeMapField `yaml:"fields,omitempty"` + + // Key is the Go name of the field. + ExtraFields map[string]ModelExtraField `yaml:"extraFields,omitempty"` } type TypeMapField struct { @@ -332,6 +336,32 @@ type TypeMapField struct { GeneratedMethod string `yaml:"-"` } +type ModelExtraField struct { + // Type is the Go type of the field. + // + // It supports the builtin basic types (like string or int64), named types + // (qualified by the full package path), pointers to those types (prefixed + // with `*`), and slices of those types (prefixed with `[]`). + // + // For example, the following are valid types: + // string + // *github.com/author/package.Type + // []string + // []*github.com/author/package.Type + // + // Note that the type will be referenced from the generated/graphql, which + // means the package it lives in must not reference the generated/graphql + // package to avoid circular imports. + // restrictions. + Type string `yaml:"type"` + + // OverrideTags is an optional override of the Go field tag. + OverrideTags string `yaml:"overrideTags"` + + // Description is an optional the Go field doc-comment. + Description string `yaml:"description"` +} + type StringList []string func (a *StringList) UnmarshalYAML(unmarshal func(interface{}) error) error { diff --git a/vendor/github.com/99designs/gqlgen/codegen/field.gotpl b/vendor/github.com/99designs/gqlgen/codegen/field.gotpl index e47b958d..f974b597 100644 --- a/vendor/github.com/99designs/gqlgen/codegen/field.gotpl +++ b/vendor/github.com/99designs/gqlgen/codegen/field.gotpl @@ -94,7 +94,7 @@ func (ec *executionContext) {{ $field.FieldContextFunc }}(ctx context.Context, f ctx = graphql.WithFieldContext(ctx, fc) if fc.Args, err = ec.{{ $field.ArgsFunc }}(ctx, field.ArgumentMap(ec.Variables)); err != nil { ec.Error(ctx, err) - return + return fc, err } {{- end }} return fc, nil diff --git a/vendor/github.com/99designs/gqlgen/codegen/generated!.gotpl b/vendor/github.com/99designs/gqlgen/codegen/generated!.gotpl index 647b0e46..42e84b65 100644 --- a/vendor/github.com/99designs/gqlgen/codegen/generated!.gotpl +++ b/vendor/github.com/99designs/gqlgen/codegen/generated!.gotpl @@ -14,7 +14,6 @@ {{ reserveImport "github.com/99designs/gqlgen/graphql" }} {{ reserveImport "github.com/99designs/gqlgen/graphql/introspection" }} - {{ if eq .Config.Exec.Layout "single-file" }} // NewExecutableSchema creates an ExecutableSchema from the ResolverRoot interface. func NewExecutableSchema(cfg Config) graphql.ExecutableSchema { @@ -104,7 +103,7 @@ } func (e *executableSchema) Complexity(typeName, field string, childComplexity int, rawArgs map[string]interface{}) (int, bool) { - ec := executionContext{nil, e} + ec := executionContext{nil, e, 0, 0, nil} _ = ec {{ if not .Config.OmitComplexity -}} switch typeName + "." + field { @@ -139,7 +138,7 @@ func (e *executableSchema) Exec(ctx context.Context) graphql.ResponseHandler { rc := graphql.GetOperationContext(ctx) - ec := executionContext{rc, e} + ec := executionContext{rc, e, 0, 0, make(chan graphql.DeferredResult)} inputUnmarshalMap := graphql.BuildUnmarshalerMap( {{- range $input := .Inputs -}} {{ if not $input.HasUnmarshal }} @@ -152,22 +151,39 @@ switch rc.Operation.Operation { {{- if .QueryRoot }} case ast.Query: return func(ctx context.Context) *graphql.Response { - if !first { return nil } - first = false - ctx = graphql.WithUnmarshalerMap(ctx, inputUnmarshalMap) - {{ if .Directives.LocationDirectives "QUERY" -}} - data := ec._queryMiddleware(ctx, rc.Operation, func(ctx context.Context) (interface{}, error){ - return ec._{{.QueryRoot.Name}}(ctx, rc.Operation.SelectionSet), nil - }) - {{- else -}} - data := ec._{{.QueryRoot.Name}}(ctx, rc.Operation.SelectionSet) - {{- end }} + var response graphql.Response + var data graphql.Marshaler + if first { + first = false + ctx = graphql.WithUnmarshalerMap(ctx, inputUnmarshalMap) + {{ if .Directives.LocationDirectives "QUERY" -}} + data = ec._queryMiddleware(ctx, rc.Operation, func(ctx context.Context) (interface{}, error){ + return ec._{{.QueryRoot.Name}}(ctx, rc.Operation.SelectionSet), nil + }) + {{- else -}} + data = ec._{{.QueryRoot.Name}}(ctx, rc.Operation.SelectionSet) + {{- end }} + } else { + if atomic.LoadInt32(&ec.pendingDeferred) > 0 { + result := <-ec.deferredResults + atomic.AddInt32(&ec.pendingDeferred, -1) + data = result.Result + response.Path = result.Path + response.Label = result.Label + response.Errors = result.Errors + } else { + return nil + } + } var buf bytes.Buffer data.MarshalGQL(&buf) - - return &graphql.Response{ - Data: buf.Bytes(), + response.Data = buf.Bytes() + if atomic.LoadInt32(&ec.deferred) > 0 { + hasNext := atomic.LoadInt32(&ec.pendingDeferred) > 0 + response.HasNext = &hasNext } + + return &response } {{ end }} @@ -224,6 +240,28 @@ type executionContext struct { *graphql.OperationContext *executableSchema + deferred int32 + pendingDeferred int32 + deferredResults chan graphql.DeferredResult + } + + func (ec *executionContext) processDeferredGroup(dg graphql.DeferredGroup) { + atomic.AddInt32(&ec.pendingDeferred, 1) + go func () { + ctx := graphql.WithFreshResponseContext(dg.Context) + dg.FieldSet.Dispatch(ctx) + ds := graphql.DeferredResult{ + Path: dg.Path, + Label: dg.Label, + Result: dg.FieldSet, + Errors: graphql.GetErrors(ctx), + } + // null fields should bubble up + if dg.FieldSet.Invalids > 0 { + ds.Result = graphql.Null + } + ec.deferredResults <- ds + }() } func (ec *executionContext) introspectSchema() (*introspection.Schema, error) { diff --git a/vendor/github.com/99designs/gqlgen/codegen/object.gotpl b/vendor/github.com/99designs/gqlgen/codegen/object.gotpl index 1fbdface..adb1df49 100644 --- a/vendor/github.com/99designs/gqlgen/codegen/object.gotpl +++ b/vendor/github.com/99designs/gqlgen/codegen/object.gotpl @@ -25,86 +25,121 @@ func (ec *executionContext) _{{$object.Name}}(ctx context.Context, sel ast.Selec {{- else }} func (ec *executionContext) _{{$object.Name}}(ctx context.Context, sel ast.SelectionSet{{ if not $object.Root }},obj {{$object.Reference | ref }}{{ end }}) graphql.Marshaler { fields := graphql.CollectFields(ec.OperationContext, sel, {{$object.Name|lcFirst}}Implementors) - {{- if $object.Root }} - ctx = graphql.WithFieldContext(ctx, &graphql.FieldContext{ - Object: {{$object.Name|quote}}, - }) - {{end}} + {{- if $object.Root }} + ctx = graphql.WithFieldContext(ctx, &graphql.FieldContext{ + Object: {{$object.Name|quote}}, + }) + {{end}} + out := graphql.NewFieldSet(fields) - var invalids uint32 + deferred := make(map[string]*graphql.FieldSet) for i, field := range fields { - {{- if $object.Root }} - innerCtx := graphql.WithRootFieldContext(ctx, &graphql.RootFieldContext{ - Object: field.Name, - Field: field, - }) - {{end}} - switch field.Name { - case "__typename": - out.Values[i] = graphql.MarshalString({{$object.Name|quote}}) - {{- range $field := $object.Fields }} - case "{{$field.Name}}": - {{- if $field.IsConcurrent }} - field := field + {{- if $object.Root }} + innerCtx := graphql.WithRootFieldContext(ctx, &graphql.RootFieldContext{ + Object: field.Name, + Field: field, + }) + {{end}} + switch field.Name { + case "__typename": + out.Values[i] = graphql.MarshalString({{$object.Name|quote}}) + {{- range $field := $object.Fields }} + case "{{$field.Name}}": + {{- if $field.IsConcurrent }} + field := field - innerFunc := func(ctx context.Context) (res graphql.Marshaler) { - defer func() { - if r := recover(); r != nil { - ec.Error(ctx, ec.Recover(ctx, r)) - } - }() - res = ec._{{$object.Name}}_{{$field.Name}}(ctx, field{{if not $object.Root}}, obj{{end}}) - {{- if $field.TypeReference.GQL.NonNull }} - if res == graphql.Null { - {{- if $object.IsConcurrent }} - atomic.AddUint32(&invalids, 1) - {{- else }} - invalids++ - {{- end }} - } - {{- end }} - return res - } + innerFunc := func(ctx context.Context, fs *graphql.FieldSet) (res graphql.Marshaler) { + defer func() { + if r := recover(); r != nil { + ec.Error(ctx, ec.Recover(ctx, r)) + } + }() + res = ec._{{$object.Name}}_{{$field.Name}}(ctx, field{{if not $object.Root}}, obj{{end}}) + {{- if $field.TypeReference.GQL.NonNull }} + if res == graphql.Null { + {{- if $object.IsConcurrent }} + atomic.AddUint32(&fs.Invalids, 1) + {{- else }} + fs.Invalids++ + {{- end }} + } + {{- end }} + return res + } - {{if $object.Root}} - rrm := func(ctx context.Context) graphql.Marshaler { - return ec.OperationContext.RootResolverMiddleware(ctx, innerFunc) - } - {{end}} + {{if $object.Root}} + rrm := func(ctx context.Context) graphql.Marshaler { + return ec.OperationContext.RootResolverMiddleware(ctx, + func(ctx context.Context) graphql.Marshaler { return innerFunc(ctx, out) }) + } + {{end}} - out.Concurrently(i, func() graphql.Marshaler { - {{- if $object.Root -}} - return rrm(innerCtx) - {{- else -}} - return innerFunc(ctx) - {{end}} - }) - {{- else }} - {{if $object.Root}} - out.Values[i] = ec.OperationContext.RootResolverMiddleware(innerCtx, func(ctx context.Context) (res graphql.Marshaler) { - return ec._{{$object.Name}}_{{$field.Name}}(ctx, field) - }) - {{else}} - out.Values[i] = ec._{{$object.Name}}_{{$field.Name}}(ctx, field, obj) - {{end}} + {{if not $object.Root}} + if field.Deferrable != nil { + dfs, ok := deferred[field.Deferrable.Label] + di := 0 + if ok { + dfs.AddField(field) + di = len(dfs.Values) - 1 + } else { + dfs = graphql.NewFieldSet([]graphql.CollectedField{field}) + deferred[field.Deferrable.Label] = dfs + } + dfs.Concurrently(di, func(ctx context.Context) graphql.Marshaler { + return innerFunc(ctx, dfs) + }) - {{- if $field.TypeReference.GQL.NonNull }} - if out.Values[i] == graphql.Null { - {{- if $object.IsConcurrent }} - atomic.AddUint32(&invalids, 1) - {{- else }} - invalids++ - {{- end }} - } - {{- end }} - {{- end }} - {{- end }} - default: - panic("unknown field " + strconv.Quote(field.Name)) - } + // don't run the out.Concurrently() call below + out.Values[i] = graphql.Null + continue + } + {{end}} + + out.Concurrently(i, func(ctx context.Context) graphql.Marshaler { + {{- if $object.Root -}} + return rrm(innerCtx) + {{- else -}} + return innerFunc(ctx, out) + {{- end -}} + }) + {{- else }} + {{- if $object.Root -}} + out.Values[i] = ec.OperationContext.RootResolverMiddleware(innerCtx, func(ctx context.Context) (res graphql.Marshaler) { + return ec._{{$object.Name}}_{{$field.Name}}(ctx, field) + }) + {{- else -}} + out.Values[i] = ec._{{$object.Name}}_{{$field.Name}}(ctx, field, obj) + {{- end -}} + + {{- if $field.TypeReference.GQL.NonNull }} + if out.Values[i] == graphql.Null { + {{- if $object.IsConcurrent }} + atomic.AddUint32(&out.Invalids, 1) + {{- else }} + out.Invalids++ + {{- end }} + } + {{- end }} + {{- end }} + {{- end }} + default: + panic("unknown field " + strconv.Quote(field.Name)) + } } - out.Dispatch() - if invalids > 0 { return graphql.Null } + out.Dispatch(ctx) + if out.Invalids > 0 { return graphql.Null } + + atomic.AddInt32(&ec.deferred, int32(len(deferred))) + + for label, dfs := range deferred { + ec.processDeferredGroup(graphql.DeferredGroup{ + Label: label, + Path: graphql.GetPath(ctx), + FieldSet: dfs, + Context: ctx, + }) + } + return out } {{- end }} diff --git a/vendor/github.com/99designs/gqlgen/codegen/root_.gotpl b/vendor/github.com/99designs/gqlgen/codegen/root_.gotpl index 5f97a574..dcfc84d0 100644 --- a/vendor/github.com/99designs/gqlgen/codegen/root_.gotpl +++ b/vendor/github.com/99designs/gqlgen/codegen/root_.gotpl @@ -76,7 +76,7 @@ func (e *executableSchema) Schema() *ast.Schema { } func (e *executableSchema) Complexity(typeName, field string, childComplexity int, rawArgs map[string]interface{}) (int, bool) { - ec := executionContext{nil, e} + ec := executionContext{nil, e, 0, 0, nil} _ = ec {{- if not .Config.OmitComplexity }} switch typeName + "." + field { @@ -111,7 +111,7 @@ func (e *executableSchema) Complexity(typeName, field string, childComplexity in func (e *executableSchema) Exec(ctx context.Context) graphql.ResponseHandler { rc := graphql.GetOperationContext(ctx) - ec := executionContext{rc, e} + ec := executionContext{rc, e, 0, 0, make(chan graphql.DeferredResult)} inputUnmarshalMap := graphql.BuildUnmarshalerMap( {{- range $input := .Inputs -}} {{ if not $input.HasUnmarshal }} @@ -124,22 +124,39 @@ func (e *executableSchema) Exec(ctx context.Context) graphql.ResponseHandler { switch rc.Operation.Operation { {{- if .QueryRoot }} case ast.Query: return func(ctx context.Context) *graphql.Response { - if !first { return nil } - first = false - ctx = graphql.WithUnmarshalerMap(ctx, inputUnmarshalMap) - {{ if .Directives.LocationDirectives "QUERY" -}} - data := ec._queryMiddleware(ctx, rc.Operation, func(ctx context.Context) (interface{}, error){ - return ec._{{.QueryRoot.Name}}(ctx, rc.Operation.SelectionSet), nil - }) - {{- else -}} - data := ec._{{.QueryRoot.Name}}(ctx, rc.Operation.SelectionSet) - {{- end }} + var response graphql.Response + var data graphql.Marshaler + if first { + first = false + ctx = graphql.WithUnmarshalerMap(ctx, inputUnmarshalMap) + {{ if .Directives.LocationDirectives "QUERY" -}} + data = ec._queryMiddleware(ctx, rc.Operation, func(ctx context.Context) (interface{}, error){ + return ec._{{.QueryRoot.Name}}(ctx, rc.Operation.SelectionSet), nil + }) + {{- else -}} + data = ec._{{.QueryRoot.Name}}(ctx, rc.Operation.SelectionSet) + {{- end }} + } else { + if atomic.LoadInt32(&ec.pendingDeferred) > 0 { + result := <-ec.deferredResults + atomic.AddInt32(&ec.pendingDeferred, -1) + data = result.Result + response.Path = result.Path + response.Label = result.Label + response.Errors = result.Errors + } else { + return nil + } + } var buf bytes.Buffer data.MarshalGQL(&buf) - - return &graphql.Response{ - Data: buf.Bytes(), + response.Data = buf.Bytes() + if atomic.LoadInt32(&ec.deferred) > 0 { + hasNext := atomic.LoadInt32(&ec.pendingDeferred) > 0 + response.HasNext = &hasNext } + + return &response } {{ end }} @@ -196,6 +213,28 @@ func (e *executableSchema) Exec(ctx context.Context) graphql.ResponseHandler { type executionContext struct { *graphql.OperationContext *executableSchema + deferred int32 + pendingDeferred int32 + deferredResults chan graphql.DeferredResult +} + +func (ec *executionContext) processDeferredGroup(dg graphql.DeferredGroup) { + atomic.AddInt32(&ec.pendingDeferred, 1) + go func () { + ctx := graphql.WithFreshResponseContext(dg.Context) + dg.FieldSet.Dispatch(ctx) + ds := graphql.DeferredResult{ + Path: dg.Path, + Label: dg.Label, + Result: dg.FieldSet, + Errors: graphql.GetErrors(ctx), + } + // null fields should bubble up + if dg.FieldSet.Invalids > 0 { + ds.Result = graphql.Null + } + ec.deferredResults <- ds + }() } func (ec *executionContext) introspectSchema() (*introspection.Schema, error) { diff --git a/vendor/github.com/99designs/gqlgen/codegen/templates/templates.go b/vendor/github.com/99designs/gqlgen/codegen/templates/templates.go index 159df77c..a3b3be0a 100644 --- a/vendor/github.com/99designs/gqlgen/codegen/templates/templates.go +++ b/vendor/github.com/99designs/gqlgen/codegen/templates/templates.go @@ -517,7 +517,25 @@ func wordWalker(str string, f func(*wordInfo)) { } matchCommonInitial := false - if commonInitialisms[strings.ToUpper(word)] { + upperWord := strings.ToUpper(word) + if commonInitialisms[upperWord] { + // If the uppercase word (string(runes[w:i]) is "ID" or "IP" + // AND + // the word is the first two characters of the str + // AND + // that is not the end of the word + // AND + // the length of the string is greater than 3 + // AND + // the third rune is an uppercase one + // THEN + // do NOT count this as an initialism. + switch upperWord { + case "ID", "IP": + if word == str[:2] && !eow && len(str) > 3 && unicode.IsUpper(runes[3]) { + continue + } + } hasCommonInitial = true matchCommonInitial = true } diff --git a/vendor/github.com/99designs/gqlgen/codegen/type.go b/vendor/github.com/99designs/gqlgen/codegen/type.go index 20b09dc9..dcd9d291 100644 --- a/vendor/github.com/99designs/gqlgen/codegen/type.go +++ b/vendor/github.com/99designs/gqlgen/codegen/type.go @@ -26,7 +26,7 @@ func processType(ret map[string]*config.TypeReference, ref *config.TypeReference } ret[key] = ref - if ref.IsSlice() || ref.IsPtrToSlice() || ref.IsPtrToPtr() { + if ref.IsSlice() || ref.IsPtrToSlice() || ref.IsPtrToPtr() || ref.IsPtrToIntf() { processType(ret, ref.Elem()) } } diff --git a/vendor/github.com/99designs/gqlgen/codegen/type.gotpl b/vendor/github.com/99designs/gqlgen/codegen/type.gotpl index eaa17184..5cbd737c 100644 --- a/vendor/github.com/99designs/gqlgen/codegen/type.gotpl +++ b/vendor/github.com/99designs/gqlgen/codegen/type.gotpl @@ -4,7 +4,7 @@ {{- if and $type.IsNilable (not $type.GQL.NonNull) (not $type.IsPtrToPtr) }} if v == nil { return nil, nil } {{- end }} - {{- if $type.IsPtrToSlice }} + {{- if or $type.IsPtrToSlice $type.IsPtrToIntf }} res, err := ec.{{ $type.Elem.UnmarshalFunc }}(ctx, v) return &res, graphql.ErrorOnPath(ctx, err) {{- else if $type.IsSlice }} @@ -89,7 +89,7 @@ {{ with $type.MarshalFunc }} func (ec *executionContext) {{ . }}(ctx context.Context, sel ast.SelectionSet, v {{ $type.GO | ref }}) graphql.Marshaler { - {{- if $type.IsPtrToSlice }} + {{- if or $type.IsPtrToSlice $type.IsPtrToIntf }} return ec.{{ $type.Elem.MarshalFunc }}(ctx, sel, *v) {{- else if $type.IsSlice }} {{- if not $type.GQL.NonNull }} diff --git a/vendor/github.com/99designs/gqlgen/graphql/cache.go b/vendor/github.com/99designs/gqlgen/graphql/cache.go index fe86ca35..e552ce67 100644 --- a/vendor/github.com/99designs/gqlgen/graphql/cache.go +++ b/vendor/github.com/99designs/gqlgen/graphql/cache.go @@ -15,15 +15,15 @@ type Cache interface { type MapCache map[string]interface{} // Get looks up a key's value from the cache. -func (m MapCache) Get(ctx context.Context, key string) (value interface{}, ok bool) { +func (m MapCache) Get(_ context.Context, key string) (value interface{}, ok bool) { v, ok := m[key] return v, ok } // Add adds a value to the cache. -func (m MapCache) Add(ctx context.Context, key string, value interface{}) { m[key] = value } +func (m MapCache) Add(_ context.Context, key string, value interface{}) { m[key] = value } type NoCache struct{} -func (n NoCache) Get(ctx context.Context, key string) (value interface{}, ok bool) { return nil, false } -func (n NoCache) Add(ctx context.Context, key string, value interface{}) {} +func (n NoCache) Get(_ context.Context, _ string) (value interface{}, ok bool) { return nil, false } +func (n NoCache) Add(_ context.Context, _ string, _ interface{}) {} diff --git a/vendor/github.com/99designs/gqlgen/graphql/context_response.go b/vendor/github.com/99designs/gqlgen/graphql/context_response.go index c128fdb4..6d223c8a 100644 --- a/vendor/github.com/99designs/gqlgen/graphql/context_response.go +++ b/vendor/github.com/99designs/gqlgen/graphql/context_response.go @@ -36,6 +36,14 @@ func WithResponseContext(ctx context.Context, presenterFunc ErrorPresenterFunc, }) } +func WithFreshResponseContext(ctx context.Context) context.Context { + e := getResponseContext(ctx) + return context.WithValue(ctx, resultCtx, &responseContext{ + errorPresenter: e.errorPresenter, + recover: e.recover, + }) +} + // AddErrorf writes a formatted error to the client, first passing it through the error presenter. func AddErrorf(ctx context.Context, format string, args ...interface{}) { AddError(ctx, fmt.Errorf(format, args...)) diff --git a/vendor/github.com/99designs/gqlgen/graphql/deferred.go b/vendor/github.com/99designs/gqlgen/graphql/deferred.go new file mode 100644 index 00000000..1aeb48c1 --- /dev/null +++ b/vendor/github.com/99designs/gqlgen/graphql/deferred.go @@ -0,0 +1,26 @@ +package graphql + +import ( + "context" + + "github.com/vektah/gqlparser/v2/ast" + "github.com/vektah/gqlparser/v2/gqlerror" +) + +type Deferrable struct { + Label string +} + +type DeferredGroup struct { + Path ast.Path + Label string + FieldSet *FieldSet + Context context.Context +} + +type DeferredResult struct { + Path ast.Path + Label string + Result Marshaler + Errors gqlerror.List +} diff --git a/vendor/github.com/99designs/gqlgen/graphql/executable_schema.go b/vendor/github.com/99designs/gqlgen/graphql/executable_schema.go index 61891622..58f942a1 100644 --- a/vendor/github.com/99designs/gqlgen/graphql/executable_schema.go +++ b/vendor/github.com/99designs/gqlgen/graphql/executable_schema.go @@ -45,9 +45,19 @@ func collectFields(reqCtx *OperationContext, selSet ast.SelectionSet, satisfies if len(satisfies) > 0 && !instanceOf(sel.TypeCondition, satisfies) { continue } + + shouldDefer, label := deferrable(sel.Directives, reqCtx.Variables) + for _, childField := range collectFields(reqCtx, sel.SelectionSet, satisfies, visited) { - f := getOrCreateAndAppendField(&groupedFields, childField.Name, childField.Alias, childField.ObjectDefinition, func() CollectedField { return childField }) + f := getOrCreateAndAppendField( + &groupedFields, childField.Name, childField.Alias, childField.ObjectDefinition, + func() CollectedField { return childField }) f.Selections = append(f.Selections, childField.Selections...) + if shouldDefer { + f.Deferrable = &Deferrable{ + Label: label, + } + } } case *ast.FragmentSpread: @@ -70,9 +80,16 @@ func collectFields(reqCtx *OperationContext, selSet ast.SelectionSet, satisfies continue } + shouldDefer, label := deferrable(sel.Directives, reqCtx.Variables) + for _, childField := range collectFields(reqCtx, fragment.SelectionSet, satisfies, visited) { - f := getOrCreateAndAppendField(&groupedFields, childField.Name, childField.Alias, childField.ObjectDefinition, func() CollectedField { return childField }) + f := getOrCreateAndAppendField(&groupedFields, + childField.Name, childField.Alias, childField.ObjectDefinition, + func() CollectedField { return childField }) f.Selections = append(f.Selections, childField.Selections...) + if shouldDefer { + f.Deferrable = &Deferrable{Label: label} + } } default: @@ -87,6 +104,7 @@ type CollectedField struct { *ast.Field Selections ast.SelectionSet + Deferrable *Deferrable } func instanceOf(val string, satisfies []string) bool { @@ -150,6 +168,32 @@ func shouldIncludeNode(directives ast.DirectiveList, variables map[string]interf return !skip && include } +func deferrable(directives ast.DirectiveList, variables map[string]interface{}) (shouldDefer bool, label string) { + d := directives.ForName("defer") + if d == nil { + return false, "" + } + + shouldDefer = true + + for _, arg := range d.Arguments { + switch arg.Name { + case "if": + if value, err := arg.Value.Value(variables); err == nil { + shouldDefer, _ = value.(bool) + } + case "label": + if value, err := arg.Value.Value(variables); err == nil { + label, _ = value.(string) + } + default: + panic(fmt.Sprintf("defer: argument '%s' not supported", arg.Name)) + } + } + + return shouldDefer, label +} + func resolveIfArgument(d *ast.Directive, variables map[string]interface{}) bool { arg := d.Arguments.ForName("if") if arg == nil { diff --git a/vendor/github.com/99designs/gqlgen/graphql/fieldset.go b/vendor/github.com/99designs/gqlgen/graphql/fieldset.go index 351e266f..3ba28582 100644 --- a/vendor/github.com/99designs/gqlgen/graphql/fieldset.go +++ b/vendor/github.com/99designs/gqlgen/graphql/fieldset.go @@ -1,19 +1,21 @@ package graphql import ( + "context" "io" "sync" ) type FieldSet struct { - fields []CollectedField - Values []Marshaler - delayed []delayedResult + fields []CollectedField + Values []Marshaler + Invalids uint32 + delayed []delayedResult } type delayedResult struct { i int - f func() Marshaler + f func(context.Context) Marshaler } func NewFieldSet(fields []CollectedField) *FieldSet { @@ -23,15 +25,20 @@ func NewFieldSet(fields []CollectedField) *FieldSet { } } -func (m *FieldSet) Concurrently(i int, f func() Marshaler) { +func (m *FieldSet) AddField(field CollectedField) { + m.fields = append(m.fields, field) + m.Values = append(m.Values, nil) +} + +func (m *FieldSet) Concurrently(i int, f func(context.Context) Marshaler) { m.delayed = append(m.delayed, delayedResult{i: i, f: f}) } -func (m *FieldSet) Dispatch() { +func (m *FieldSet) Dispatch(ctx context.Context) { if len(m.delayed) == 1 { // only one concurrent task, no need to spawn a goroutine or deal create waitgroups d := m.delayed[0] - m.Values[d.i] = d.f() + m.Values[d.i] = d.f(ctx) } else if len(m.delayed) > 1 { // more than one concurrent task, use the main goroutine to do one, only spawn goroutines for the others @@ -39,12 +46,12 @@ func (m *FieldSet) Dispatch() { for _, d := range m.delayed[1:] { wg.Add(1) go func(d delayedResult) { - m.Values[d.i] = d.f() + m.Values[d.i] = d.f(ctx) wg.Done() }(d) } - m.Values[m.delayed[0].i] = m.delayed[0].f() + m.Values[m.delayed[0].i] = m.delayed[0].f(ctx) wg.Wait() } } diff --git a/vendor/github.com/99designs/gqlgen/graphql/handler/extension/complexity.go b/vendor/github.com/99designs/gqlgen/graphql/handler/extension/complexity.go index 2d853802..e88848d1 100644 --- a/vendor/github.com/99designs/gqlgen/graphql/handler/extension/complexity.go +++ b/vendor/github.com/99designs/gqlgen/graphql/handler/extension/complexity.go @@ -59,17 +59,17 @@ func (c *ComplexityLimit) Validate(schema graphql.ExecutableSchema) error { func (c ComplexityLimit) MutateOperationContext(ctx context.Context, rc *graphql.OperationContext) *gqlerror.Error { op := rc.Doc.Operations.ForName(rc.OperationName) - complexity := complexity.Calculate(c.es, op, rc.Variables) + complexityCalcs := complexity.Calculate(c.es, op, rc.Variables) limit := c.Func(ctx, rc) rc.Stats.SetExtension(complexityExtension, &ComplexityStats{ - Complexity: complexity, + Complexity: complexityCalcs, ComplexityLimit: limit, }) - if complexity > limit { - err := gqlerror.Errorf("operation has complexity %d, which exceeds the limit of %d", complexity, limit) + if complexityCalcs > limit { + err := gqlerror.Errorf("operation has complexity %d, which exceeds the limit of %d", complexityCalcs, limit) errcode.Set(err, errComplexityLimit) return err } diff --git a/vendor/github.com/99designs/gqlgen/graphql/response.go b/vendor/github.com/99designs/gqlgen/graphql/response.go index 0d36049a..a82f27e2 100644 --- a/vendor/github.com/99designs/gqlgen/graphql/response.go +++ b/vendor/github.com/99designs/gqlgen/graphql/response.go @@ -5,6 +5,7 @@ import ( "encoding/json" "fmt" + "github.com/vektah/gqlparser/v2/ast" "github.com/vektah/gqlparser/v2/gqlerror" ) @@ -14,6 +15,9 @@ import ( type Response struct { Errors gqlerror.List `json:"errors,omitempty"` Data json.RawMessage `json:"data"` + Label string `json:"label,omitempty"` + Path ast.Path `json:"path,omitempty"` + HasNext *bool `json:"hasNext,omitempty"` Extensions map[string]interface{} `json:"extensions,omitempty"` } diff --git a/vendor/github.com/99designs/gqlgen/graphql/uint.go b/vendor/github.com/99designs/gqlgen/graphql/uint.go index 9349c2f4..26e6aa6b 100644 --- a/vendor/github.com/99designs/gqlgen/graphql/uint.go +++ b/vendor/github.com/99designs/gqlgen/graphql/uint.go @@ -60,7 +60,7 @@ func MarshalUint32(i uint32) Marshaler { func UnmarshalUint32(v interface{}) (uint32, error) { switch v := v.(type) { case string: - iv, err := strconv.ParseInt(v, 10, 32) + iv, err := strconv.ParseUint(v, 10, 32) if err != nil { return 0, err } diff --git a/vendor/github.com/99designs/gqlgen/graphql/version.go b/vendor/github.com/99designs/gqlgen/graphql/version.go index 0a63293a..0fc1e9f2 100644 --- a/vendor/github.com/99designs/gqlgen/graphql/version.go +++ b/vendor/github.com/99designs/gqlgen/graphql/version.go @@ -1,3 +1,3 @@ package graphql -const Version = "v0.17.31" +const Version = "v0.17.33" diff --git a/vendor/github.com/99designs/gqlgen/internal/code/compare.go b/vendor/github.com/99designs/gqlgen/internal/code/compare.go index 1150a24e..e521d31e 100644 --- a/vendor/github.com/99designs/gqlgen/internal/code/compare.go +++ b/vendor/github.com/99designs/gqlgen/internal/code/compare.go @@ -6,7 +6,7 @@ import ( ) // CompatibleTypes isnt a strict comparison, it allows for pointer differences -func CompatibleTypes(expected types.Type, actual types.Type) error { +func CompatibleTypes(expected, actual types.Type) error { // Special case to deal with pointer mismatches { expectedPtr, expectedIsPtr := expected.(*types.Pointer) @@ -84,11 +84,8 @@ func CompatibleTypes(expected types.Type, actual types.Type) error { if err := CompatibleTypes(expected.Params(), actual.Params()); err != nil { return err } - if err := CompatibleTypes(expected.Results(), actual.Results()); err != nil { - return err - } - - return nil + err := CompatibleTypes(expected.Results(), actual.Results()) + return err } case *types.Interface: if actual, ok := actual.(*types.Interface); ok { @@ -114,11 +111,8 @@ func CompatibleTypes(expected types.Type, actual types.Type) error { return err } - if err := CompatibleTypes(expected.Elem(), actual.Elem()); err != nil { - return err - } - - return nil + err := CompatibleTypes(expected.Elem(), actual.Elem()) + return err } case *types.Chan: diff --git a/vendor/github.com/99designs/gqlgen/internal/code/imports.go b/vendor/github.com/99designs/gqlgen/internal/code/imports.go index 0e499a17..89ebab96 100644 --- a/vendor/github.com/99designs/gqlgen/internal/code/imports.go +++ b/vendor/github.com/99designs/gqlgen/internal/code/imports.go @@ -138,7 +138,7 @@ func extractModuleName(content []byte) string { break } s := strings.Trim(string(tkn), " \t") - if len(s) != 0 && !strings.HasPrefix(s, "//") { + if s != "" && !strings.HasPrefix(s, "//") { break } if advance <= len(content) { @@ -171,4 +171,4 @@ func ImportPathForDir(dir string) (res string) { return "" } -var modregex = regexp.MustCompile(`module ([^\s]*)`) +var modregex = regexp.MustCompile(`module (\S*)`) diff --git a/vendor/github.com/99designs/gqlgen/internal/code/packages.go b/vendor/github.com/99designs/gqlgen/internal/code/packages.go index 0b25750a..6cb6ef23 100644 --- a/vendor/github.com/99designs/gqlgen/internal/code/packages.go +++ b/vendor/github.com/99designs/gqlgen/internal/code/packages.go @@ -14,8 +14,10 @@ import ( "golang.org/x/tools/go/packages" ) -var once = sync.Once{} -var modInfo *debug.BuildInfo +var ( + once = sync.Once{} + modInfo *debug.BuildInfo +) var mode = packages.NeedName | packages.NeedFiles | diff --git a/vendor/github.com/99designs/gqlgen/internal/code/util.go b/vendor/github.com/99designs/gqlgen/internal/code/util.go index cbe40858..96c6e03f 100644 --- a/vendor/github.com/99designs/gqlgen/internal/code/util.go +++ b/vendor/github.com/99designs/gqlgen/internal/code/util.go @@ -54,7 +54,7 @@ func QualifyPackagePath(importPath string) string { return pkg.ImportPath } -var invalidPackageNameChar = regexp.MustCompile(`[^\w]`) +var invalidPackageNameChar = regexp.MustCompile(`\W`) func SanitizePackageName(pkg string) string { return invalidPackageNameChar.ReplaceAllLiteralString(filepath.Base(pkg), "_") diff --git a/vendor/github.com/99designs/gqlgen/internal/rewrite/rewriter.go b/vendor/github.com/99designs/gqlgen/internal/rewrite/rewriter.go index 07a5f042..1ca722dc 100644 --- a/vendor/github.com/99designs/gqlgen/internal/rewrite/rewriter.go +++ b/vendor/github.com/99designs/gqlgen/internal/rewrite/rewriter.go @@ -68,7 +68,7 @@ func (r *Rewriter) getFile(filename string) string { return r.files[filename] } -func (r *Rewriter) GetPrevDecl(structname string, methodname string) *ast.FuncDecl { +func (r *Rewriter) GetPrevDecl(structname, methodname string) *ast.FuncDecl { for _, f := range r.pkg.Syntax { for _, d := range f.Decls { d, isFunc := d.(*ast.FuncDecl) @@ -99,7 +99,7 @@ func (r *Rewriter) GetPrevDecl(structname string, methodname string) *ast.FuncDe return nil } -func (r *Rewriter) GetMethodComment(structname string, methodname string) string { +func (r *Rewriter) GetMethodComment(structname, methodname string) string { d := r.GetPrevDecl(structname, methodname) if d != nil { return d.Doc.Text() @@ -107,7 +107,7 @@ func (r *Rewriter) GetMethodComment(structname string, methodname string) string return "" } -func (r *Rewriter) GetMethodBody(structname string, methodname string) string { +func (r *Rewriter) GetMethodBody(structname, methodname string) string { d := r.GetPrevDecl(structname, methodname) if d != nil { return r.getSource(d.Body.Pos()+1, d.Body.End()-1) diff --git a/vendor/github.com/99designs/gqlgen/lint.txt b/vendor/github.com/99designs/gqlgen/lint.txt deleted file mode 100644 index 308c732e..00000000 --- a/vendor/github.com/99designs/gqlgen/lint.txt +++ /dev/null @@ -1,1167 +0,0 @@ -api/generate.go:17:2: Error return value of `syscall.Unlink` is not checked (errcheck) -api/generate.go:19:3: Error return value of `syscall.Unlink` is not checked (errcheck) -api/generate.go:35:8: weakCond: suspicious `urlString != nil && urlString[1] == "https://specs.apollo.dev/federation/v2.0"`; nil check may not be enough, check for len (gocritic) -api/generate.go:86:2: ST1003: should not use underscores in Go names; var data_plugins should be dataPlugins (stylecheck) -api/generate.go:86:2: var-naming: don't use underscores in Go names; var data_plugins should be dataPlugins (revive) -api/generate_test.go:21:6: Error return value of `os.Getwd` is not checked (errcheck) -api/generate_test.go:49:5: Error return value of `os.Chdir` is not checked (errcheck) -api/generate_test.go:51:4: Error return value of `os.Chdir` is not checked (errcheck) -api/option.go:22:54: Comment should end in a period (godot) -api/option.go:29:74: Comment should end in a period (godot) -api/option_test.go:16:32: Comment should end in a period (godot) -api/option_test.go:21:42: Comment should end in a period (godot) -client/client.go:29:51: Comment should end in a period (godot) -client/client.go:33:40: json(snake): got 'operationName' want 'operation_name' (tagliatelle) -client/client.go:47:83: Comment should end in a period (godot) -client/client.go:57:84: Comment should end in a period (godot) -client/client.go:128:7: ST1017: don't use Yoda conditions (stylecheck) -client/client.go:128:7: yodaStyleExpr: consider to change order in expression to contentType == "application/json" (gocritic) -client/client.go:141:1: paramTypeCombine: func(data interface{}, into interface{}) error could be replaced with func(data, into interface{}) error (gocritic) -client/client_test.go:57:10: Error return value of `w.Write` is not checked (errcheck) -client/client_test.go:67:25: Error return value of `bodyWriter.WriteField` is not checked (errcheck) -client/client_test.go:68:25: Error return value of `bodyWriter.WriteField` is not checked (errcheck) -client/client_test.go:73:8: Error return value of `bodyWriter.CreatePart` is not checked (errcheck) -client/client_test.go:74:12: Error return value of `ff.Write` is not checked (errcheck) -client/client_test.go:87:10: Error return value of `w.Write` is not checked (errcheck) -client/client_test.go:102:10: Error return value of `w.Write` is not checked (errcheck) -client/client_test.go:118:10: Error return value of `w.Write` is not checked (errcheck) -client/client_test.go:135:10: Error return value of `w.Write` is not checked (errcheck) -client/errors.go:6:6: var-naming: type RawJsonError should be RawJSONError (revive) -client/errors.go:6:6: ST1003: type RawJsonError should be RawJSONError (stylecheck) -client/options.go:5:49: Comment should end in a period (godot) -client/options.go:16:62: Comment should end in a period (godot) -client/options.go:23:71: Comment should end in a period (godot) -client/options.go:39:1: paramTypeCombine: func(key string, value string) Option could be replaced with func(key, value string) Option (gocritic) -client/options.go:52:51: Comment should end in a period (godot) -client/websocket.go:47:55: Comment should end in a period (godot) -client/websocket.go:50:18: Error return value is not checked (errcheck) -client/websocket.go:54: File is not `gofumpt`-ed (gofumpt) -client/websocket.go:130:13: dynamicFmtString: use errors.New(string(op.Payload)) or fmt.Errorf("%s", string(op.Payload)) instead (gocritic) -client/withfilesoption.go:23:3: typeAssertChain: rewrite if-else to type switch statement (gocritic) -client/withfilesoption.go:47:89: Comment should end in a period (godot) -client/withfilesoption.go:57:16: Error return value of `json.Marshal` is not checked (errcheck) -client/withfilesoption.go:58:24: Error return value of `bodyWriter.WriteField` is not checked (errcheck) -client/withfilesoption.go:76:9: Error return value of `fd.file.Stat` is not checked (errcheck) -client/withfilesoption.go:77:9: Error return value of `.Stat` is not checked (errcheck) -client/withfilesoption.go:100:24: Error return value of `bodyWriter.WriteField` is not checked (errcheck) -client/withfilesoption.go:110:33: sprintfQuotedString: use %q instead of "%s" for quoted strings (gocritic) -client/withfilesoption.go:111:7: Error return value of `os.ReadFile` is not checked (errcheck) -client/withfilesoption.go:113:8: Error return value of `bodyWriter.CreatePart` is not checked (errcheck) -client/withfilesoption.go:114:12: Error return value of `ff.Write` is not checked (errcheck) -client/withfilesoption.go:132:9: sprintfQuotedString: use %q instead of "%s" for quoted strings (gocritic) -client/withfilesoption_test.go:18:13: Error return value of `os.CreateTemp` is not checked (errcheck) -client/withfilesoption_test.go:19:13: Error return value of `os.CreateTemp` is not checked (errcheck) -client/withfilesoption_test.go:20:13: Error return value of `os.CreateTemp` is not checked (errcheck) -client/withfilesoption_test.go:24:23: Error return value of `tempFile1.WriteString` is not checked (errcheck) -client/withfilesoption_test.go:25:23: Error return value of `tempFile2.WriteString` is not checked (errcheck) -client/withfilesoption_test.go:26:23: Error return value of `tempFile3.WriteString` is not checked (errcheck) -client/withfilesoption_test.go:37:8: comparing with == will fail on wrapped errors. Use errors.Is to check for a specific error (errorlint) -client/withfilesoption_test.go:58:11: Error return value of `w.Write` is not checked (errcheck) -client/withfilesoption_test.go:79:8: comparing with == will fail on wrapped errors. Use errors.Is to check for a specific error (errorlint) -client/withfilesoption_test.go:109:11: Error return value of `w.Write` is not checked (errcheck) -client/withfilesoption_test.go:132:8: comparing with == will fail on wrapped errors. Use errors.Is to check for a specific error (errorlint) -client/withfilesoption_test.go:156:27: badRegexp: `,` is duplicated in [0,1,2] (gocritic) -client/withfilesoption_test.go:165:11: Error return value of `w.Write` is not checked (errcheck) -client/withfilesoption_test.go:191:8: comparing with == will fail on wrapped errors. Use errors.Is to check for a specific error (errorlint) -client/withfilesoption_test.go:225:11: Error return value of `w.Write` is not checked (errcheck) -codegen/args.go:28:77: Comment should end in a period (godot) -codegen/args.go:87:4: nestingReduce: invert if cond, replace body with `continue`, move old body after the statement (gocritic) -codegen/args.go:106:16: ST1016: methods on the same type should have the same receiver name (seen 1x "a", 2x "d") (stylecheck) -codegen/config/binder.go:18:71: Comment should end in a period (godot) -codegen/config/binder.go:62:1: paramTypeCombine: func(pkgName string, typeName string) (types.Type, error) could be replaced with func(pkgName, typeName string) (types.Type, error) (gocritic) -codegen/config/binder.go:92:15: dynamicFmtString: use errors.New(name + " not found in typemap") or fmt.Errorf("%s", name + " not found in typemap") instead (gocritic) -codegen/config/binder.go:116:1: paramTypeCombine: func(pkgName string, typeName string) (types.Object, error) could be replaced with func(pkgName, typeName string) (types.Object, error) (gocritic) -codegen/config/binder.go:198:27: ST1016: methods on the same type should have the same receiver name (seen 12x "t", 1x "ref") (stylecheck) -codegen/config/binder.go:214:1: receiver-naming: receiver name t should be consistent with previous receiver name ref for TypeReference (revive) -codegen/config/binder.go:219:111: Comment should end in a period (godot) -codegen/config/binder.go:220:1: receiver-naming: receiver name t should be consistent with previous receiver name ref for TypeReference (revive) -codegen/config/binder.go:228:1: receiver-naming: receiver name t should be consistent with previous receiver name ref for TypeReference (revive) -codegen/config/binder.go:232:1: receiver-naming: receiver name t should be consistent with previous receiver name ref for TypeReference (revive) -codegen/config/binder.go:237:1: receiver-naming: receiver name t should be consistent with previous receiver name ref for TypeReference (revive) -codegen/config/binder.go:245:1: receiver-naming: receiver name t should be consistent with previous receiver name ref for TypeReference (revive) -codegen/config/binder.go:250:1: receiver-naming: receiver name t should be consistent with previous receiver name ref for TypeReference (revive) -codegen/config/binder.go:255:1: receiver-naming: receiver name t should be consistent with previous receiver name ref for TypeReference (revive) -codegen/config/binder.go:259:1: receiver-naming: receiver name t should be consistent with previous receiver name ref for TypeReference (revive) -codegen/config/binder.go:273:1: receiver-naming: receiver name t should be consistent with previous receiver name ref for TypeReference (revive) -codegen/config/binder.go:285:1: receiver-naming: receiver name t should be consistent with previous receiver name ref for TypeReference (revive) -codegen/config/binder.go:297:1: receiver-naming: receiver name t should be consistent with previous receiver name ref for TypeReference (revive) -codegen/config/config.go:46:54: Comment should end in a period (godot) -codegen/config/config.go:60:77: Comment should end in a period (godot) -codegen/config/config.go:101:47: Comment should end in a period (godot) -codegen/config/config.go:280:5: nestingReduce: invert if cond, replace body with `continue`, move old body after the statement (gocritic) -codegen/config/config.go:286:24: Error return value is not checked (errcheck) -codegen/config/config.go:292:20: Error return value is not checked (errcheck) -codegen/config/config.go:322:25: yaml(snake): got 'fieldName' want 'field_name' (tagliatelle) -codegen/config/config.go:481:1: paramTypeCombine: func(name string, goType string) could be replaced with func(name, goType string) (gocritic) -codegen/config/config.go:502:33: Comment should end in a period (godot) -codegen/data.go:16:63: Comment should end in a period (godot) -codegen/data.go:50:130: Comment should end in a period (godot) -codegen/data.go:210:2: var-naming: don't use underscores in Go names; var __type should be _Type (revive) -codegen/data.go:210:2: ST1003: should not use underscores in Go names; var __type should be _Type (stylecheck) -codegen/data.go:224:2: ST1003: should not use underscores in Go names; var __schema should be _Schema (stylecheck) -codegen/data.go:224:2: var-naming: don't use underscores in Go names; var __schema should be _Schema (revive) -codegen/directive.go:14:52: Comment should end in a period (godot) -codegen/directive.go:26:39: Comment should end in a period (godot) -codegen/field.go:165:10: Error return value is not checked (errcheck) -codegen/field.go:229:43: Comment should end in a period (godot) -codegen/field.go:556:10: redundantSprint: use f.TypeReference.GO.String() instead (gocritic) -codegen/field_test.go:44:9: Error return value is not checked (errcheck) -codegen/field_test.go:45:10: Error return value is not checked (errcheck) -codegen/field_test.go:46:10: Error return value is not checked (errcheck) -codegen/field_test.go:47:9: Error return value is not checked (errcheck) -codegen/field_test.go:48:11: Error return value is not checked (errcheck) -codegen/generate.go:100:32: importShadow: shadow of imported from 'github.com/99designs/gqlgen/codegen/config' package 'config' (gocritic) -codegen/generate.go:116:61: ptrToRefParam: consider `builds' to be of non-pointer type (gocritic) -codegen/generate.go:158:29: ptrToRefParam: consider `builds' to be of non-pointer type (gocritic) -codegen/generate.go:170:28: ptrToRefParam: consider `builds' to be of non-pointer type (gocritic) -codegen/generate.go:182:32: ptrToRefParam: consider `builds' to be of non-pointer type (gocritic) -codegen/generate.go:202:37: ptrToRefParam: consider `builds' to be of non-pointer type (gocritic) -codegen/templates/import_test.go:85:6: Error return value of `a.Reserve` is not checked (errcheck) -codegen/templates/import_test.go:86:6: Error return value of `a.Reserve` is not checked (errcheck) -codegen/templates/templates.go:188:1: paramTypeCombine: func(width int, pad string, s string) string could be replaced with func(width int, pad, s string) string (gocritic) -codegen/templates/templates.go:508:68: empty-block: this block is empty, you can remove it (revive) -codegen/templates/templates.go:566:93: Comment should end in a period (godot) -codegen/templates/templates.go:734:8: G306: Expect WriteFile permissions to be 0600 or less (gosec) -codegen/templates/templates_test.go:318: File is not `gofumpt`-ed (gofumpt) -codegen/templates/templates_test.go:323:2: Error return value of `os.Mkdir` is not checked (errcheck) -codegen/templates/templates_test.go:337:18: Error return value of `os.ReadFile` is not checked (errcheck) -codegen/testserver/followschema/complexity_test.go:33:16: json(snake): got 'oneFoo' want 'one_foo' (tagliatelle) -codegen/testserver/followschema/complexity_test.go:34:16: json(snake): got 'twoFoo' want 'two_foo' (tagliatelle) -codegen/testserver/followschema/complexity_test.go:35:16: json(snake): got 'oldFoo' want 'old_foo' (tagliatelle) -codegen/testserver/followschema/complexity_test.go:36:16: json(snake): got 'newFoo' want 'new_foo' (tagliatelle) -codegen/testserver/followschema/complexity_test.go:37:4: ST1003: should not use underscores in Go names; struct field New_foo should be NewFoo (stylecheck) -codegen/testserver/followschema/complexity_test.go:37:4: var-naming: don't use underscores in Go names; struct field New_foo should be NewFoo (revive) -codegen/testserver/followschema/defaults_test.go:12:6: test helper function should start from t.Helper() (thelper) -codegen/testserver/followschema/directive_test.go:57:3: return both the `nil` error and invalid value: use a sentinel error instead (nilnil) -codegen/testserver/followschema/directive_test.go:68:36: TestDirectives$11 - result 1 (error) is always nil (unparam) -codegen/testserver/followschema/directive_test.go:96:14: dynamicFmtString: use errors.New(msg) or fmt.Errorf("%s", msg) instead (gocritic) -codegen/testserver/followschema/directive_test.go:98:13: dynamicFmtString: use errors.New(*message) or fmt.Errorf("%s", *message) instead (gocritic) -codegen/testserver/followschema/directive_test.go:105:10: Error return value is not checked (errcheck) -codegen/testserver/followschema/directive_test.go:157:5: return both the `nil` error and invalid value: use a sentinel error instead (nilnil) -codegen/testserver/followschema/directive_test.go:171:11: Error return value is not checked (errcheck) -codegen/testserver/followschema/directive_test.go:178:11: Error return value is not checked (errcheck) -codegen/testserver/followschema/directive_test.go:187:9: Error return value is not checked (errcheck) -codegen/testserver/followschema/directive_test.go:192:9: Error return value is not checked (errcheck) -codegen/testserver/followschema/embedded.go:3:23: Comment should end in a period (godot) -codegen/testserver/followschema/embedded.go:9:19: Comment should end in a period (godot) -codegen/testserver/followschema/embedded.go:12:47: Comment should end in a period (godot) -codegen/testserver/followschema/embedded.go:15:48: Comment should end in a period (godot) -codegen/testserver/followschema/embedded.go:20:23: Comment should end in a period (godot) -codegen/testserver/followschema/embedded.go:27:50: Comment should end in a period (godot) -codegen/testserver/followschema/embedded.go:32:23: Comment should end in a period (godot) -codegen/testserver/followschema/fields_order.go:4:21: json(snake): got 'firstField' want 'first_field' (tagliatelle) -codegen/testserver/followschema/fields_order_test.go:14:27: json(snake): got 'firstFieldValue' want 'first_field_value' (tagliatelle) -codegen/testserver/followschema/fields_order_test.go:15:4: json(snake): got 'overrideValueViaInput' want 'override_value_via_input' (tagliatelle) -codegen/testserver/followschema/interfaces.go:52:56: Comment should end in a period (godot) -codegen/testserver/followschema/interfaces_test.go:60:4: return both the `nil` error and invalid value: use a sentinel error instead (nilnil) -codegen/testserver/followschema/interfaces_test.go:68:7: return both the `nil` error and invalid value: use a sentinel error instead (nilnil) -codegen/testserver/followschema/introspection_test.go:55:7: json(snake): got '__type' want 'type' (tagliatelle) -codegen/testserver/followschema/invalid-packagename/invalid-identifier.go:1:1: ST1003: should not use underscores in package names (stylecheck) -codegen/testserver/followschema/invalid-packagename/invalid-identifier.go:1:9: var-naming: don't use an underscore in package name (revive) -codegen/testserver/followschema/maps_test.go:19:4: return both the `nil` error and invalid value: use a sentinel error instead (nilnil) -codegen/testserver/followschema/middleware_test.go:41:9: Error return value is not checked (errcheck) -codegen/testserver/followschema/middleware_test.go:46:9: Error return value is not checked (errcheck) -codegen/testserver/followschema/models.go:52:37: unused-parameter: parameter 'v' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/models.go:56:34: unused-parameter: parameter 'w' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/models.go:62:35: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/models.go:62:56: unused-parameter: parameter 'u' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/models.go:71:2: ST1003: struct field IdStr should be IDStr (stylecheck) -codegen/testserver/followschema/models.go:71:2: var-naming: struct field IdStr should be IDStr (revive) -codegen/testserver/followschema/models.go:72:2: ST1003: struct field IdInt should be IDInt (stylecheck) -codegen/testserver/followschema/models.go:72:2: var-naming: struct field IdInt should be IDInt (revive) -codegen/testserver/followschema/mutation_with_custom_scalar.go:27:10: Error return value of `json.Marshal` is not checked (errcheck) -codegen/testserver/followschema/mutation_with_custom_scalar.go:28:9: Error return value of `w.Write` is not checked (errcheck) -codegen/testserver/followschema/nulls_test.go:40:5: var-naming: struct field Id should be ID (revive) -codegen/testserver/followschema/nulls_test.go:40:5: ST1003: struct field Id should be ID (stylecheck) -codegen/testserver/followschema/nulls_test.go:122:93: return both the `nil` error and invalid value: use a sentinel error instead (nilnil) -codegen/testserver/followschema/nulls_test.go:123:93: return both the `nil` error and invalid value: use a sentinel error instead (nilnil) -codegen/testserver/followschema/nulls_test.go:124:93: return both the `nil` error and invalid value: use a sentinel error instead (nilnil) -codegen/testserver/followschema/nulls_test.go:125:93: return both the `nil` error and invalid value: use a sentinel error instead (nilnil) -codegen/testserver/followschema/nulls_test.go:126:93: return both the `nil` error and invalid value: use a sentinel error instead (nilnil) -codegen/testserver/followschema/ptr_to_ptr_input_test.go:13:32: json(snake): got 'updatePtrToPtr' want 'update_ptr_to_ptr' (tagliatelle) -codegen/testserver/followschema/resolver.go:15:10: Comment should end in a period (godot) -codegen/testserver/followschema/resolver.go:16:40: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:16:61: unused-parameter: parameter 'obj' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:20:10: Comment should end in a period (godot) -codegen/testserver/followschema/resolver.go:21:28: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:21:49: unused-parameter: parameter 'obj' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:25:10: Comment should end in a period (godot) -codegen/testserver/followschema/resolver.go:26:28: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:26:49: unused-parameter: parameter 'obj' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:30:10: Comment should end in a period (godot) -codegen/testserver/followschema/resolver.go:31:28: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:31:49: unused-parameter: parameter 'obj' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:35:10: Comment should end in a period (godot) -codegen/testserver/followschema/resolver.go:36:28: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:36:49: unused-parameter: parameter 'obj' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:40:10: Comment should end in a period (godot) -codegen/testserver/followschema/resolver.go:41:28: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:41:49: unused-parameter: parameter 'obj' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:45:10: Comment should end in a period (godot) -codegen/testserver/followschema/resolver.go:46:40: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:46:61: unused-parameter: parameter 'obj' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:50:10: Comment should end in a period (godot) -codegen/testserver/followschema/resolver.go:51:46: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:51:67: unused-parameter: parameter 'obj' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:55:10: Comment should end in a period (godot) -codegen/testserver/followschema/resolver.go:56:41: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:56:62: unused-parameter: parameter 'input' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:60:10: Comment should end in a period (godot) -codegen/testserver/followschema/resolver.go:61:50: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:61:71: unused-parameter: parameter 'input' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:65:10: Comment should end in a period (godot) -codegen/testserver/followschema/resolver.go:66:44: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:66:65: unused-parameter: parameter 'input' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:70:10: Comment should end in a period (godot) -codegen/testserver/followschema/resolver.go:71:43: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:71:64: unused-parameter: parameter 'input' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:75:10: Comment should end in a period (godot) -codegen/testserver/followschema/resolver.go:76:44: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:76:65: unused-parameter: parameter 'obj' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:80:10: Comment should end in a period (godot) -codegen/testserver/followschema/resolver.go:81:45: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:81:66: unused-parameter: parameter 'obj' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:85:10: Comment should end in a period (godot) -codegen/testserver/followschema/resolver.go:86:39: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:86:60: unused-parameter: parameter 'obj' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:86:73: unused-parameter: parameter 'u' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:90:10: Comment should end in a period (godot) -codegen/testserver/followschema/resolver.go:91:31: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:91:52: unused-parameter: parameter 'obj' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:91:62: unused-parameter: parameter 'limit' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:95:10: Comment should end in a period (godot) -codegen/testserver/followschema/resolver.go:96:35: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:96:56: unused-parameter: parameter 'obj' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:100:10: Comment should end in a period (godot) -codegen/testserver/followschema/resolver.go:101:41: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:101:62: unused-parameter: parameter 'obj' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:105:10: Comment should end in a period (godot) -codegen/testserver/followschema/resolver.go:106:39: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:106:60: unused-parameter: parameter 'obj' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:110:10: Comment should end in a period (godot) -codegen/testserver/followschema/resolver.go:111:43: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:115:10: Comment should end in a period (godot) -codegen/testserver/followschema/resolver.go:116:35: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:120:10: Comment should end in a period (godot) -codegen/testserver/followschema/resolver.go:121:34: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:121:55: unused-parameter: parameter 'input' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:125:10: Comment should end in a period (godot) -codegen/testserver/followschema/resolver.go:126:35: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:126:56: unused-parameter: parameter 'input' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:130:10: Comment should end in a period (godot) -codegen/testserver/followschema/resolver.go:131:38: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:131:59: unused-parameter: parameter 'input' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:135:10: Comment should end in a period (godot) -codegen/testserver/followschema/resolver.go:136:39: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:140:10: Comment should end in a period (godot) -codegen/testserver/followschema/resolver.go:141:38: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:145:10: Comment should end in a period (godot) -codegen/testserver/followschema/resolver.go:146:30: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:146:51: unused-parameter: parameter 'id' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:150:10: Comment should end in a period (godot) -codegen/testserver/followschema/resolver.go:151:37: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:151:58: unused-parameter: parameter 'arg' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:155:10: Comment should end in a period (godot) -codegen/testserver/followschema/resolver.go:156:36: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:156:57: unused-parameter: parameter 'arg' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:160:10: Comment should end in a period (godot) -codegen/testserver/followschema/resolver.go:161:44: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:161:65: unused-parameter: parameter 'arg' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:165:10: Comment should end in a period (godot) -codegen/testserver/followschema/resolver.go:166:36: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:170:10: Comment should end in a period (godot) -codegen/testserver/followschema/resolver.go:171:34: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:175:10: Comment should end in a period (godot) -codegen/testserver/followschema/resolver.go:176:41: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:180:10: Comment should end in a period (godot) -codegen/testserver/followschema/resolver.go:181:37: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:185:10: Comment should end in a period (godot) -codegen/testserver/followschema/resolver.go:186:1: paramTypeCombine: func(ctx context.Context, falsyBoolean *bool, truthyBoolean *bool) (*DefaultParametersMirror, error) could be replaced with func(ctx context.Context, falsyBoolean, truthyBoolean *bool) (*DefaultParametersMirror, error) (gocritic) -codegen/testserver/followschema/resolver.go:186:43: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:186:64: unused-parameter: parameter 'falsyBoolean' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:186:84: unused-parameter: parameter 'truthyBoolean' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:190:10: Comment should end in a period (godot) -codegen/testserver/followschema/resolver.go:191:38: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:191:59: unused-parameter: parameter 'arg' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:195:10: Comment should end in a period (godot) -codegen/testserver/followschema/resolver.go:196:1: paramTypeCombine: func(ctx context.Context, arg *int, arg2 *int, arg3 *string) (*string, error) could be replaced with func(ctx context.Context, arg, arg2 *int, arg3 *string) (*string, error) (gocritic) -codegen/testserver/followschema/resolver.go:196:46: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:196:67: unused-parameter: parameter 'arg' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:196:77: unused-parameter: parameter 'arg2' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:196:88: unused-parameter: parameter 'arg3' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:200:10: Comment should end in a period (godot) -codegen/testserver/followschema/resolver.go:201:48: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:201:69: unused-parameter: parameter 'arg' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:205:10: Comment should end in a period (godot) -codegen/testserver/followschema/resolver.go:206:40: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:206:61: unused-parameter: parameter 'arg' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:210:10: Comment should end in a period (godot) -codegen/testserver/followschema/resolver.go:211:44: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:211:65: unused-parameter: parameter 'arg' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:215:10: Comment should end in a period (godot) -codegen/testserver/followschema/resolver.go:216:41: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:220:10: Comment should end in a period (godot) -codegen/testserver/followschema/resolver.go:221:58: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:225:10: Comment should end in a period (godot) -codegen/testserver/followschema/resolver.go:226:43: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:226:64: unused-parameter: parameter 'ret' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:230:10: Comment should end in a period (godot) -codegen/testserver/followschema/resolver.go:231:40: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:235:10: Comment should end in a period (godot) -codegen/testserver/followschema/resolver.go:236:41: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:240:10: Comment should end in a period (godot) -codegen/testserver/followschema/resolver.go:241:48: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:245:10: Comment should end in a period (godot) -codegen/testserver/followschema/resolver.go:246:39: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:250:10: Comment should end in a period (godot) -codegen/testserver/followschema/resolver.go:251:39: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:255:10: Comment should end in a period (godot) -codegen/testserver/followschema/resolver.go:256:39: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:260:10: Comment should end in a period (godot) -codegen/testserver/followschema/resolver.go:261:37: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:261:58: unused-parameter: parameter 'input' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:265:10: Comment should end in a period (godot) -codegen/testserver/followschema/resolver.go:266:32: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:270:10: Comment should end in a period (godot) -codegen/testserver/followschema/resolver.go:271:33: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:275:10: Comment should end in a period (godot) -codegen/testserver/followschema/resolver.go:276:30: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:280:10: Comment should end in a period (godot) -codegen/testserver/followschema/resolver.go:281:41: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:285:10: Comment should end in a period (godot) -codegen/testserver/followschema/resolver.go:286:32: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:290:10: Comment should end in a period (godot) -codegen/testserver/followschema/resolver.go:291:40: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:295:10: Comment should end in a period (godot) -codegen/testserver/followschema/resolver.go:296:29: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:300:10: Comment should end in a period (godot) -codegen/testserver/followschema/resolver.go:301:35: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:305:10: Comment should end in a period (godot) -codegen/testserver/followschema/resolver.go:306:44: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:306:65: unused-parameter: parameter 'in' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:310:10: Comment should end in a period (godot) -codegen/testserver/followschema/resolver.go:311:50: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:311:71: unused-parameter: parameter 'in' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:315:10: Comment should end in a period (godot) -codegen/testserver/followschema/resolver.go:316:37: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:320:10: Comment should end in a period (godot) -codegen/testserver/followschema/resolver.go:321:41: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:325:10: Comment should end in a period (godot) -codegen/testserver/followschema/resolver.go:326:35: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:330:10: Comment should end in a period (godot) -codegen/testserver/followschema/resolver.go:331:32: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:335:10: Comment should end in a period (godot) -codegen/testserver/followschema/resolver.go:336:31: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:340:10: Comment should end in a period (godot) -codegen/testserver/followschema/resolver.go:341:33: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:345:10: Comment should end in a period (godot) -codegen/testserver/followschema/resolver.go:346:32: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:350:10: Comment should end in a period (godot) -codegen/testserver/followschema/resolver.go:351:41: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:355:10: Comment should end in a period (godot) -codegen/testserver/followschema/resolver.go:356:47: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:360:10: Comment should end in a period (godot) -codegen/testserver/followschema/resolver.go:361:45: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:365:10: Comment should end in a period (godot) -codegen/testserver/followschema/resolver.go:366:34: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:370:10: Comment should end in a period (godot) -codegen/testserver/followschema/resolver.go:371:52: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:375:10: Comment should end in a period (godot) -codegen/testserver/followschema/resolver.go:376:51: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:380:10: Comment should end in a period (godot) -codegen/testserver/followschema/resolver.go:381:39: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:381:60: unused-parameter: parameter 'arg' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:385:10: Comment should end in a period (godot) -codegen/testserver/followschema/resolver.go:386:32: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:390:10: Comment should end in a period (godot) -codegen/testserver/followschema/resolver.go:391:37: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:395:10: Comment should end in a period (godot) -codegen/testserver/followschema/resolver.go:396:34: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:396:55: unused-parameter: parameter 'arg' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:400:10: Comment should end in a period (godot) -codegen/testserver/followschema/resolver.go:401:39: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:405:10: Comment should end in a period (godot) -codegen/testserver/followschema/resolver.go:406:38: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:410:10: Comment should end in a period (godot) -codegen/testserver/followschema/resolver.go:411:36: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:415:10: Comment should end in a period (godot) -codegen/testserver/followschema/resolver.go:416:35: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:420:10: Comment should end in a period (godot) -codegen/testserver/followschema/resolver.go:421:39: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:425:10: Comment should end in a period (godot) -codegen/testserver/followschema/resolver.go:426:39: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:430:10: Comment should end in a period (godot) -codegen/testserver/followschema/resolver.go:431:39: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:435:10: Comment should end in a period (godot) -codegen/testserver/followschema/resolver.go:436:36: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:440:10: Comment should end in a period (godot) -codegen/testserver/followschema/resolver.go:441:38: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:445:10: Comment should end in a period (godot) -codegen/testserver/followschema/resolver.go:446:40: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:450:10: Comment should end in a period (godot) -codegen/testserver/followschema/resolver.go:451:44: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:455:10: Comment should end in a period (godot) -codegen/testserver/followschema/resolver.go:456:45: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:456:66: unused-parameter: parameter 'arg' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:460:10: Comment should end in a period (godot) -codegen/testserver/followschema/resolver.go:461:1: paramTypeCombine: func(ctx context.Context, arg *int, arg2 *int, arg3 *string) (<-chan *string, error) could be replaced with func(ctx context.Context, arg, arg2 *int, arg3 *string) (<-chan *string, error) (gocritic) -codegen/testserver/followschema/resolver.go:461:53: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:461:74: unused-parameter: parameter 'arg' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:461:84: unused-parameter: parameter 'arg2' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:461:95: unused-parameter: parameter 'arg3' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:465:10: Comment should end in a period (godot) -codegen/testserver/followschema/resolver.go:466:48: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:470:10: Comment should end in a period (godot) -codegen/testserver/followschema/resolver.go:471:55: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:475:10: Comment should end in a period (godot) -codegen/testserver/followschema/resolver.go:476:42: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:480:10: Comment should end in a period (godot) -codegen/testserver/followschema/resolver.go:481:46: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:485:10: Comment should end in a period (godot) -codegen/testserver/followschema/resolver.go:486:32: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:486:53: unused-parameter: parameter 'obj' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:490:10: Comment should end in a period (godot) -codegen/testserver/followschema/resolver.go:491:29: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:491:50: unused-parameter: parameter 'obj' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:491:61: unused-parameter: parameter 'limit' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:495:10: Comment should end in a period (godot) -codegen/testserver/followschema/resolver.go:496:34: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:496:55: unused-parameter: parameter 'obj' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:496:71: unused-parameter: parameter 'key' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:500:10: Comment should end in a period (godot) -codegen/testserver/followschema/resolver.go:501:36: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:501:57: unused-parameter: parameter 'obj' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:501:75: unused-parameter: parameter 'idx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/resolver.go:554: File is not `gofumpt`-ed (gofumpt) -codegen/testserver/followschema/resolver.go:554:1: typeDefFirst: definition of type 'backedByInterfaceResolver' should appear before its methods (gocritic) -codegen/testserver/followschema/resolver.go:555:1: typeDefFirst: definition of type 'errorsResolver' should appear before its methods (gocritic) -codegen/testserver/followschema/resolver.go:556:1: typeDefFirst: definition of type 'forcedResolverResolver' should appear before its methods (gocritic) -codegen/testserver/followschema/resolver.go:557:1: typeDefFirst: definition of type 'modelMethodsResolver' should appear before its methods (gocritic) -codegen/testserver/followschema/resolver.go:558:1: typeDefFirst: definition of type 'mutationResolver' should appear before its methods (gocritic) -codegen/testserver/followschema/resolver.go:559:1: typeDefFirst: definition of type 'overlappingFieldsResolver' should appear before its methods (gocritic) -codegen/testserver/followschema/resolver.go:560:1: typeDefFirst: definition of type 'panicsResolver' should appear before its methods (gocritic) -codegen/testserver/followschema/resolver.go:561:1: typeDefFirst: definition of type 'petResolver' should appear before its methods (gocritic) -codegen/testserver/followschema/resolver.go:562:1: typeDefFirst: definition of type 'primitiveResolver' should appear before its methods (gocritic) -codegen/testserver/followschema/resolver.go:563:1: typeDefFirst: definition of type 'primitiveStringResolver' should appear before its methods (gocritic) -codegen/testserver/followschema/resolver.go:564:1: typeDefFirst: definition of type 'queryResolver' should appear before its methods (gocritic) -codegen/testserver/followschema/resolver.go:565:1: typeDefFirst: definition of type 'subscriptionResolver' should appear before its methods (gocritic) -codegen/testserver/followschema/resolver.go:566:1: typeDefFirst: definition of type 'userResolver' should appear before its methods (gocritic) -codegen/testserver/followschema/resolver.go:567:1: typeDefFirst: definition of type 'wrappedMapResolver' should appear before its methods (gocritic) -codegen/testserver/followschema/resolver.go:568:1: typeDefFirst: definition of type 'wrappedSliceResolver' should appear before its methods (gocritic) -codegen/testserver/followschema/response_extension_test.go:31:7: Error return value of `c.RawPost` is not checked (errcheck) -codegen/testserver/followschema/scalar_context.go:21:16: Error return value of `io.WriteString` is not checked (errcheck) -codegen/testserver/followschema/scalar_context.go:25:79: unused-parameter: parameter 'v' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/scalar_context.go:30:39: unused-parameter: parameter 'v' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/scalar_context.go:32:17: Error return value of `io.WriteString` is not checked (errcheck) -codegen/testserver/followschema/scalar_context.go:37:62: unused-parameter: parameter 'v' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/subscription_test.go:93:9: Error return value is not checked (errcheck) -codegen/testserver/followschema/subscription_test.go:98:9: Error return value is not checked (errcheck) -codegen/testserver/followschema/subscription_test.go:121:12: Error return value is not checked (errcheck) -codegen/testserver/followschema/subscription_test.go:157:12: Error return value is not checked (errcheck) -codegen/testserver/followschema/subscription_test.go:171:6: var-naming: struct field Id should be ID (revive) -codegen/testserver/followschema/subscription_test.go:171:6: ST1003: struct field Id should be ID (stylecheck) -codegen/testserver/followschema/subscription_test.go:184:12: Error return value is not checked (errcheck) -codegen/testserver/followschema/v-ok.go:3:22: Comment should end in a period (godot) -codegen/testserver/followschema/v-ok.go:10:20: Comment should end in a period (godot) -codegen/testserver/followschema/validtypes_test.go:26:16: json(snake): got 'differentCase' want 'different_case' (tagliatelle) -codegen/testserver/followschema/variadic.go:12:30: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/followschema/variadic.go:12:61: unused-parameter: parameter 'opts' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/complexity_test.go:33:16: json(snake): got 'oneFoo' want 'one_foo' (tagliatelle) -codegen/testserver/singlefile/complexity_test.go:34:16: json(snake): got 'twoFoo' want 'two_foo' (tagliatelle) -codegen/testserver/singlefile/complexity_test.go:35:16: json(snake): got 'oldFoo' want 'old_foo' (tagliatelle) -codegen/testserver/singlefile/complexity_test.go:36:16: json(snake): got 'newFoo' want 'new_foo' (tagliatelle) -codegen/testserver/singlefile/complexity_test.go:37:4: var-naming: don't use underscores in Go names; struct field New_foo should be NewFoo (revive) -codegen/testserver/singlefile/complexity_test.go:37:4: ST1003: should not use underscores in Go names; struct field New_foo should be NewFoo (stylecheck) -codegen/testserver/singlefile/defaults_test.go:12:6: test helper function should start from t.Helper() (thelper) -codegen/testserver/singlefile/directive_test.go:57:3: return both the `nil` error and invalid value: use a sentinel error instead (nilnil) -codegen/testserver/singlefile/directive_test.go:68:36: TestDirectives$11 - result 1 (error) is always nil (unparam) -codegen/testserver/singlefile/directive_test.go:96:14: dynamicFmtString: use errors.New(msg) or fmt.Errorf("%s", msg) instead (gocritic) -codegen/testserver/singlefile/directive_test.go:98:13: dynamicFmtString: use errors.New(*message) or fmt.Errorf("%s", *message) instead (gocritic) -codegen/testserver/singlefile/directive_test.go:105:10: Error return value is not checked (errcheck) -codegen/testserver/singlefile/directive_test.go:157:5: return both the `nil` error and invalid value: use a sentinel error instead (nilnil) -codegen/testserver/singlefile/directive_test.go:171:11: Error return value is not checked (errcheck) -codegen/testserver/singlefile/directive_test.go:178:11: Error return value is not checked (errcheck) -codegen/testserver/singlefile/directive_test.go:187:9: Error return value is not checked (errcheck) -codegen/testserver/singlefile/directive_test.go:192:9: Error return value is not checked (errcheck) -codegen/testserver/singlefile/embedded.go:3:23: Comment should end in a period (godot) -codegen/testserver/singlefile/embedded.go:9:19: Comment should end in a period (godot) -codegen/testserver/singlefile/embedded.go:12:47: Comment should end in a period (godot) -codegen/testserver/singlefile/embedded.go:15:48: Comment should end in a period (godot) -codegen/testserver/singlefile/embedded.go:20:23: Comment should end in a period (godot) -codegen/testserver/singlefile/embedded.go:27:50: Comment should end in a period (godot) -codegen/testserver/singlefile/embedded.go:32:23: Comment should end in a period (godot) -codegen/testserver/singlefile/fields_order.go:4:21: json(snake): got 'firstField' want 'first_field' (tagliatelle) -codegen/testserver/singlefile/fields_order_test.go:14:27: json(snake): got 'firstFieldValue' want 'first_field_value' (tagliatelle) -codegen/testserver/singlefile/fields_order_test.go:15:4: json(snake): got 'overrideValueViaInput' want 'override_value_via_input' (tagliatelle) -codegen/testserver/singlefile/interfaces.go:52:56: Comment should end in a period (godot) -codegen/testserver/singlefile/interfaces_test.go:60:4: return both the `nil` error and invalid value: use a sentinel error instead (nilnil) -codegen/testserver/singlefile/interfaces_test.go:68:7: return both the `nil` error and invalid value: use a sentinel error instead (nilnil) -codegen/testserver/singlefile/introspection_test.go:55:7: json(snake): got '__type' want 'type' (tagliatelle) -codegen/testserver/singlefile/invalid-packagename/invalid-identifier.go:1:1: ST1003: should not use underscores in package names (stylecheck) -codegen/testserver/singlefile/invalid-packagename/invalid-identifier.go:1:9: var-naming: don't use an underscore in package name (revive) -codegen/testserver/singlefile/maps_test.go:19:4: return both the `nil` error and invalid value: use a sentinel error instead (nilnil) -codegen/testserver/singlefile/middleware_test.go:49:9: Error return value is not checked (errcheck) -codegen/testserver/singlefile/middleware_test.go:54:9: Error return value is not checked (errcheck) -codegen/testserver/singlefile/models.go:52:37: unused-parameter: parameter 'v' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/models.go:56:34: unused-parameter: parameter 'w' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/models.go:62:35: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/models.go:62:56: unused-parameter: parameter 'u' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/models.go:71:2: ST1003: struct field IdStr should be IDStr (stylecheck) -codegen/testserver/singlefile/models.go:71:2: var-naming: struct field IdStr should be IDStr (revive) -codegen/testserver/singlefile/models.go:72:2: var-naming: struct field IdInt should be IDInt (revive) -codegen/testserver/singlefile/models.go:72:2: ST1003: struct field IdInt should be IDInt (stylecheck) -codegen/testserver/singlefile/mutation_with_custom_scalar.go:27:10: Error return value of `json.Marshal` is not checked (errcheck) -codegen/testserver/singlefile/mutation_with_custom_scalar.go:28:9: Error return value of `w.Write` is not checked (errcheck) -codegen/testserver/singlefile/nulls_test.go:40:5: var-naming: struct field Id should be ID (revive) -codegen/testserver/singlefile/nulls_test.go:40:5: ST1003: struct field Id should be ID (stylecheck) -codegen/testserver/singlefile/nulls_test.go:122:93: return both the `nil` error and invalid value: use a sentinel error instead (nilnil) -codegen/testserver/singlefile/nulls_test.go:123:93: return both the `nil` error and invalid value: use a sentinel error instead (nilnil) -codegen/testserver/singlefile/nulls_test.go:124:93: return both the `nil` error and invalid value: use a sentinel error instead (nilnil) -codegen/testserver/singlefile/nulls_test.go:125:93: return both the `nil` error and invalid value: use a sentinel error instead (nilnil) -codegen/testserver/singlefile/nulls_test.go:126:93: return both the `nil` error and invalid value: use a sentinel error instead (nilnil) -codegen/testserver/singlefile/ptr_to_ptr_input_test.go:13:32: json(snake): got 'updatePtrToPtr' want 'update_ptr_to_ptr' (tagliatelle) -codegen/testserver/singlefile/resolver.go:15:10: Comment should end in a period (godot) -codegen/testserver/singlefile/resolver.go:16:40: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:16:61: unused-parameter: parameter 'obj' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:20:10: Comment should end in a period (godot) -codegen/testserver/singlefile/resolver.go:21:28: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:21:49: unused-parameter: parameter 'obj' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:25:10: Comment should end in a period (godot) -codegen/testserver/singlefile/resolver.go:26:28: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:26:49: unused-parameter: parameter 'obj' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:30:10: Comment should end in a period (godot) -codegen/testserver/singlefile/resolver.go:31:28: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:31:49: unused-parameter: parameter 'obj' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:35:10: Comment should end in a period (godot) -codegen/testserver/singlefile/resolver.go:36:28: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:36:49: unused-parameter: parameter 'obj' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:40:10: Comment should end in a period (godot) -codegen/testserver/singlefile/resolver.go:41:28: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:41:49: unused-parameter: parameter 'obj' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:45:10: Comment should end in a period (godot) -codegen/testserver/singlefile/resolver.go:46:40: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:46:61: unused-parameter: parameter 'obj' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:50:10: Comment should end in a period (godot) -codegen/testserver/singlefile/resolver.go:51:46: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:51:67: unused-parameter: parameter 'obj' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:55:10: Comment should end in a period (godot) -codegen/testserver/singlefile/resolver.go:56:41: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:56:62: unused-parameter: parameter 'input' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:60:10: Comment should end in a period (godot) -codegen/testserver/singlefile/resolver.go:61:50: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:61:71: unused-parameter: parameter 'input' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:65:10: Comment should end in a period (godot) -codegen/testserver/singlefile/resolver.go:66:44: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:66:65: unused-parameter: parameter 'input' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:70:10: Comment should end in a period (godot) -codegen/testserver/singlefile/resolver.go:71:43: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:71:64: unused-parameter: parameter 'input' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:75:10: Comment should end in a period (godot) -codegen/testserver/singlefile/resolver.go:76:44: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:76:65: unused-parameter: parameter 'obj' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:80:10: Comment should end in a period (godot) -codegen/testserver/singlefile/resolver.go:81:45: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:81:66: unused-parameter: parameter 'obj' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:85:10: Comment should end in a period (godot) -codegen/testserver/singlefile/resolver.go:86:39: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:86:60: unused-parameter: parameter 'obj' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:86:73: unused-parameter: parameter 'u' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:90:10: Comment should end in a period (godot) -codegen/testserver/singlefile/resolver.go:91:31: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:91:52: unused-parameter: parameter 'obj' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:91:62: unused-parameter: parameter 'limit' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:95:10: Comment should end in a period (godot) -codegen/testserver/singlefile/resolver.go:96:35: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:96:56: unused-parameter: parameter 'obj' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:100:10: Comment should end in a period (godot) -codegen/testserver/singlefile/resolver.go:101:41: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:101:62: unused-parameter: parameter 'obj' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:105:10: Comment should end in a period (godot) -codegen/testserver/singlefile/resolver.go:106:39: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:106:60: unused-parameter: parameter 'obj' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:110:10: Comment should end in a period (godot) -codegen/testserver/singlefile/resolver.go:111:43: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:115:10: Comment should end in a period (godot) -codegen/testserver/singlefile/resolver.go:116:35: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:120:10: Comment should end in a period (godot) -codegen/testserver/singlefile/resolver.go:121:34: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:121:55: unused-parameter: parameter 'input' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:125:10: Comment should end in a period (godot) -codegen/testserver/singlefile/resolver.go:126:35: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:126:56: unused-parameter: parameter 'input' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:130:10: Comment should end in a period (godot) -codegen/testserver/singlefile/resolver.go:131:38: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:131:59: unused-parameter: parameter 'input' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:135:10: Comment should end in a period (godot) -codegen/testserver/singlefile/resolver.go:136:39: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:140:10: Comment should end in a period (godot) -codegen/testserver/singlefile/resolver.go:141:38: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:145:10: Comment should end in a period (godot) -codegen/testserver/singlefile/resolver.go:146:30: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:146:51: unused-parameter: parameter 'id' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:150:10: Comment should end in a period (godot) -codegen/testserver/singlefile/resolver.go:151:37: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:151:58: unused-parameter: parameter 'arg' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:155:10: Comment should end in a period (godot) -codegen/testserver/singlefile/resolver.go:156:36: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:156:57: unused-parameter: parameter 'arg' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:160:10: Comment should end in a period (godot) -codegen/testserver/singlefile/resolver.go:161:44: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:161:65: unused-parameter: parameter 'arg' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:165:10: Comment should end in a period (godot) -codegen/testserver/singlefile/resolver.go:166:36: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:170:10: Comment should end in a period (godot) -codegen/testserver/singlefile/resolver.go:171:34: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:175:10: Comment should end in a period (godot) -codegen/testserver/singlefile/resolver.go:176:41: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:180:10: Comment should end in a period (godot) -codegen/testserver/singlefile/resolver.go:181:37: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:185:10: Comment should end in a period (godot) -codegen/testserver/singlefile/resolver.go:186:1: paramTypeCombine: func(ctx context.Context, falsyBoolean *bool, truthyBoolean *bool) (*DefaultParametersMirror, error) could be replaced with func(ctx context.Context, falsyBoolean, truthyBoolean *bool) (*DefaultParametersMirror, error) (gocritic) -codegen/testserver/singlefile/resolver.go:186:43: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:186:64: unused-parameter: parameter 'falsyBoolean' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:186:84: unused-parameter: parameter 'truthyBoolean' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:190:10: Comment should end in a period (godot) -codegen/testserver/singlefile/resolver.go:191:38: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:191:59: unused-parameter: parameter 'arg' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:195:10: Comment should end in a period (godot) -codegen/testserver/singlefile/resolver.go:196:1: paramTypeCombine: func(ctx context.Context, arg *int, arg2 *int, arg3 *string) (*string, error) could be replaced with func(ctx context.Context, arg, arg2 *int, arg3 *string) (*string, error) (gocritic) -codegen/testserver/singlefile/resolver.go:196:46: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:196:67: unused-parameter: parameter 'arg' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:196:77: unused-parameter: parameter 'arg2' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:196:88: unused-parameter: parameter 'arg3' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:200:10: Comment should end in a period (godot) -codegen/testserver/singlefile/resolver.go:201:48: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:201:69: unused-parameter: parameter 'arg' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:205:10: Comment should end in a period (godot) -codegen/testserver/singlefile/resolver.go:206:40: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:206:61: unused-parameter: parameter 'arg' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:210:10: Comment should end in a period (godot) -codegen/testserver/singlefile/resolver.go:211:44: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:211:65: unused-parameter: parameter 'arg' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:215:10: Comment should end in a period (godot) -codegen/testserver/singlefile/resolver.go:216:41: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:220:10: Comment should end in a period (godot) -codegen/testserver/singlefile/resolver.go:221:58: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:225:10: Comment should end in a period (godot) -codegen/testserver/singlefile/resolver.go:226:43: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:226:64: unused-parameter: parameter 'ret' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:230:10: Comment should end in a period (godot) -codegen/testserver/singlefile/resolver.go:231:40: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:235:10: Comment should end in a period (godot) -codegen/testserver/singlefile/resolver.go:236:41: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:240:10: Comment should end in a period (godot) -codegen/testserver/singlefile/resolver.go:241:48: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:245:10: Comment should end in a period (godot) -codegen/testserver/singlefile/resolver.go:246:39: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:250:10: Comment should end in a period (godot) -codegen/testserver/singlefile/resolver.go:251:39: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:255:10: Comment should end in a period (godot) -codegen/testserver/singlefile/resolver.go:256:39: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:260:10: Comment should end in a period (godot) -codegen/testserver/singlefile/resolver.go:261:37: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:261:58: unused-parameter: parameter 'input' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:265:10: Comment should end in a period (godot) -codegen/testserver/singlefile/resolver.go:266:32: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:270:10: Comment should end in a period (godot) -codegen/testserver/singlefile/resolver.go:271:33: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:275:10: Comment should end in a period (godot) -codegen/testserver/singlefile/resolver.go:276:30: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:280:10: Comment should end in a period (godot) -codegen/testserver/singlefile/resolver.go:281:41: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:285:10: Comment should end in a period (godot) -codegen/testserver/singlefile/resolver.go:286:32: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:290:10: Comment should end in a period (godot) -codegen/testserver/singlefile/resolver.go:291:40: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:295:10: Comment should end in a period (godot) -codegen/testserver/singlefile/resolver.go:296:29: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:300:10: Comment should end in a period (godot) -codegen/testserver/singlefile/resolver.go:301:35: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:305:10: Comment should end in a period (godot) -codegen/testserver/singlefile/resolver.go:306:44: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:306:65: unused-parameter: parameter 'in' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:310:10: Comment should end in a period (godot) -codegen/testserver/singlefile/resolver.go:311:50: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:311:71: unused-parameter: parameter 'in' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:315:10: Comment should end in a period (godot) -codegen/testserver/singlefile/resolver.go:316:37: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:320:10: Comment should end in a period (godot) -codegen/testserver/singlefile/resolver.go:321:41: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:325:10: Comment should end in a period (godot) -codegen/testserver/singlefile/resolver.go:326:35: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:330:10: Comment should end in a period (godot) -codegen/testserver/singlefile/resolver.go:331:32: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:335:10: Comment should end in a period (godot) -codegen/testserver/singlefile/resolver.go:336:31: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:340:10: Comment should end in a period (godot) -codegen/testserver/singlefile/resolver.go:341:33: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:345:10: Comment should end in a period (godot) -codegen/testserver/singlefile/resolver.go:346:32: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:350:10: Comment should end in a period (godot) -codegen/testserver/singlefile/resolver.go:351:41: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:355:10: Comment should end in a period (godot) -codegen/testserver/singlefile/resolver.go:356:47: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:360:10: Comment should end in a period (godot) -codegen/testserver/singlefile/resolver.go:361:45: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:365:10: Comment should end in a period (godot) -codegen/testserver/singlefile/resolver.go:366:34: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:370:10: Comment should end in a period (godot) -codegen/testserver/singlefile/resolver.go:371:52: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:375:10: Comment should end in a period (godot) -codegen/testserver/singlefile/resolver.go:376:51: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:380:10: Comment should end in a period (godot) -codegen/testserver/singlefile/resolver.go:381:39: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:381:60: unused-parameter: parameter 'arg' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:385:10: Comment should end in a period (godot) -codegen/testserver/singlefile/resolver.go:386:32: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:390:10: Comment should end in a period (godot) -codegen/testserver/singlefile/resolver.go:391:37: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:395:10: Comment should end in a period (godot) -codegen/testserver/singlefile/resolver.go:396:34: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:396:55: unused-parameter: parameter 'arg' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:400:10: Comment should end in a period (godot) -codegen/testserver/singlefile/resolver.go:401:39: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:405:10: Comment should end in a period (godot) -codegen/testserver/singlefile/resolver.go:406:38: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:410:10: Comment should end in a period (godot) -codegen/testserver/singlefile/resolver.go:411:36: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:415:10: Comment should end in a period (godot) -codegen/testserver/singlefile/resolver.go:416:35: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:420:10: Comment should end in a period (godot) -codegen/testserver/singlefile/resolver.go:421:39: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:425:10: Comment should end in a period (godot) -codegen/testserver/singlefile/resolver.go:426:39: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:430:10: Comment should end in a period (godot) -codegen/testserver/singlefile/resolver.go:431:39: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:435:10: Comment should end in a period (godot) -codegen/testserver/singlefile/resolver.go:436:36: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:440:10: Comment should end in a period (godot) -codegen/testserver/singlefile/resolver.go:441:38: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:445:10: Comment should end in a period (godot) -codegen/testserver/singlefile/resolver.go:446:40: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:450:10: Comment should end in a period (godot) -codegen/testserver/singlefile/resolver.go:451:44: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:455:10: Comment should end in a period (godot) -codegen/testserver/singlefile/resolver.go:456:45: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:456:66: unused-parameter: parameter 'arg' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:460:10: Comment should end in a period (godot) -codegen/testserver/singlefile/resolver.go:461:1: paramTypeCombine: func(ctx context.Context, arg *int, arg2 *int, arg3 *string) (<-chan *string, error) could be replaced with func(ctx context.Context, arg, arg2 *int, arg3 *string) (<-chan *string, error) (gocritic) -codegen/testserver/singlefile/resolver.go:461:53: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:461:74: unused-parameter: parameter 'arg' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:461:84: unused-parameter: parameter 'arg2' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:461:95: unused-parameter: parameter 'arg3' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:465:10: Comment should end in a period (godot) -codegen/testserver/singlefile/resolver.go:466:48: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:470:10: Comment should end in a period (godot) -codegen/testserver/singlefile/resolver.go:471:55: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:475:10: Comment should end in a period (godot) -codegen/testserver/singlefile/resolver.go:476:42: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:480:10: Comment should end in a period (godot) -codegen/testserver/singlefile/resolver.go:481:46: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:485:10: Comment should end in a period (godot) -codegen/testserver/singlefile/resolver.go:486:32: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:486:53: unused-parameter: parameter 'obj' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:490:10: Comment should end in a period (godot) -codegen/testserver/singlefile/resolver.go:491:29: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:491:50: unused-parameter: parameter 'obj' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:491:61: unused-parameter: parameter 'limit' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:495:10: Comment should end in a period (godot) -codegen/testserver/singlefile/resolver.go:496:34: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:496:55: unused-parameter: parameter 'obj' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:496:71: unused-parameter: parameter 'key' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:500:10: Comment should end in a period (godot) -codegen/testserver/singlefile/resolver.go:501:36: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:501:57: unused-parameter: parameter 'obj' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:501:75: unused-parameter: parameter 'idx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/resolver.go:554: File is not `gofumpt`-ed (gofumpt) -codegen/testserver/singlefile/resolver.go:554:1: typeDefFirst: definition of type 'backedByInterfaceResolver' should appear before its methods (gocritic) -codegen/testserver/singlefile/resolver.go:555:1: typeDefFirst: definition of type 'errorsResolver' should appear before its methods (gocritic) -codegen/testserver/singlefile/resolver.go:556:1: typeDefFirst: definition of type 'forcedResolverResolver' should appear before its methods (gocritic) -codegen/testserver/singlefile/resolver.go:557:1: typeDefFirst: definition of type 'modelMethodsResolver' should appear before its methods (gocritic) -codegen/testserver/singlefile/resolver.go:558:1: typeDefFirst: definition of type 'mutationResolver' should appear before its methods (gocritic) -codegen/testserver/singlefile/resolver.go:559:1: typeDefFirst: definition of type 'overlappingFieldsResolver' should appear before its methods (gocritic) -codegen/testserver/singlefile/resolver.go:560:1: typeDefFirst: definition of type 'panicsResolver' should appear before its methods (gocritic) -codegen/testserver/singlefile/resolver.go:561:1: typeDefFirst: definition of type 'petResolver' should appear before its methods (gocritic) -codegen/testserver/singlefile/resolver.go:562:1: typeDefFirst: definition of type 'primitiveResolver' should appear before its methods (gocritic) -codegen/testserver/singlefile/resolver.go:563:1: typeDefFirst: definition of type 'primitiveStringResolver' should appear before its methods (gocritic) -codegen/testserver/singlefile/resolver.go:564:1: typeDefFirst: definition of type 'queryResolver' should appear before its methods (gocritic) -codegen/testserver/singlefile/resolver.go:565:1: typeDefFirst: definition of type 'subscriptionResolver' should appear before its methods (gocritic) -codegen/testserver/singlefile/resolver.go:566:1: typeDefFirst: definition of type 'userResolver' should appear before its methods (gocritic) -codegen/testserver/singlefile/resolver.go:567:1: typeDefFirst: definition of type 'wrappedMapResolver' should appear before its methods (gocritic) -codegen/testserver/singlefile/resolver.go:568:1: typeDefFirst: definition of type 'wrappedSliceResolver' should appear before its methods (gocritic) -codegen/testserver/singlefile/response_extension_test.go:31:7: Error return value of `c.RawPost` is not checked (errcheck) -codegen/testserver/singlefile/scalar_context.go:21:16: Error return value of `io.WriteString` is not checked (errcheck) -codegen/testserver/singlefile/scalar_context.go:25:79: unused-parameter: parameter 'v' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/scalar_context.go:30:39: unused-parameter: parameter 'v' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/scalar_context.go:32:17: Error return value of `io.WriteString` is not checked (errcheck) -codegen/testserver/singlefile/scalar_context.go:37:62: unused-parameter: parameter 'v' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/subscription_test.go:93:9: Error return value is not checked (errcheck) -codegen/testserver/singlefile/subscription_test.go:98:9: Error return value is not checked (errcheck) -codegen/testserver/singlefile/subscription_test.go:121:12: Error return value is not checked (errcheck) -codegen/testserver/singlefile/subscription_test.go:157:12: Error return value is not checked (errcheck) -codegen/testserver/singlefile/subscription_test.go:171:6: var-naming: struct field Id should be ID (revive) -codegen/testserver/singlefile/subscription_test.go:171:6: ST1003: struct field Id should be ID (stylecheck) -codegen/testserver/singlefile/subscription_test.go:184:12: Error return value is not checked (errcheck) -codegen/testserver/singlefile/v-ok.go:3:22: Comment should end in a period (godot) -codegen/testserver/singlefile/v-ok.go:10:20: Comment should end in a period (godot) -codegen/testserver/singlefile/validtypes_test.go:26:16: json(snake): got 'differentCase' want 'different_case' (tagliatelle) -codegen/testserver/singlefile/variadic.go:12:30: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -codegen/testserver/singlefile/variadic.go:12:61: unused-parameter: parameter 'opts' seems to be unused, consider removing or renaming it as _ (revive) -codegen/type.go:21:18: redundantSprint: use existing.GQL.String() instead (gocritic) -codegen/type.go:22:13: redundantSprint: use ref.GQL.String() instead (gocritic) -codegen/type.go:24:10: sprintfQuotedString: use %q instead of "%s" for quoted strings (gocritic) -codegen/util.go:11:3: return both the `nil` error and invalid value: use a sentinel error instead (nilnil) -codegen/util.go:16:15: ST1005: error strings should not end with punctuation or newlines (stylecheck) -codegen/util.go:16:26: error-strings: error strings should not be capitalized or end with punctuation or a newline (revive) -codegen/util.go:24:3: return both the `nil` error and invalid value: use a sentinel error instead (nilnil) -codegen/util.go:31:3: return both the `nil` error and invalid value: use a sentinel error instead (nilnil) -graphql/bool.go:11:48: Error return value of `w.Write` is not checked (errcheck) -graphql/bool.go:13:47: Error return value of `w.Write` is not checked (errcheck) -graphql/bool.go:19:10: equalFold: consider replacing with strings.EqualFold(v, "true") (gocritic) -graphql/cache.go:5:57: Comment should end in a period (godot) -graphql/cache.go:14:112: Comment should end in a period (godot) -graphql/cache.go:18:23: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -graphql/cache.go:24:23: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -graphql/cache.go:28:22: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -graphql/cache.go:28:43: unused-parameter: parameter 'key' seems to be unused, consider removing or renaming it as _ (revive) -graphql/cache.go:29:22: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -graphql/cache.go:29:43: unused-parameter: parameter 'key' seems to be unused, consider removing or renaming it as _ (revive) -graphql/cache.go:29:55: unused-parameter: parameter 'value' seems to be unused, consider removing or renaming it as _ (revive) -graphql/coercion_test.go:11: File is not `gofumpt`-ed (gofumpt) -graphql/coercion_test.go:37: File is not `gofumpt`-ed (gofumpt) -graphql/context_field.go:14:40: Comment should end in a period (godot) -graphql/context_field.go:84:43: Comment should end in a period (godot) -graphql/context_field.go:101:1: paramTypeCombine: func(a ast.Path, b ast.Path) bool could be replaced with func(a, b ast.Path) bool (gocritic) -graphql/context_operation.go:12:72: Comment should end in a period (godot) -graphql/context_operation.go:31:37: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -graphql/context_operation.go:56:75: Comment should end in a period (godot) -graphql/context_operation.go:80:62: Comment should end in a period (godot) -graphql/context_operation.go:105:55: Comment should end in a period (godot) -graphql/context_operation.go:113:20: type assertion on error will fail on wrapped errors. Use errors.As to check for specific errors (errorlint) -graphql/context_response.go:60:69: Comment should end in a period (godot) -graphql/context_response.go:80:76: Comment should end in a period (godot) -graphql/context_response.go:119:81: Comment should end in a period (godot) -graphql/context_response.go:136:81: Comment should end in a period (godot) -graphql/errcode/codes.go:15:85: Comment should end in a period (godot) -graphql/errcode/codes.go:17:53: Comment should end in a period (godot) -graphql/errcode/codes.go:27:22: Comment should end in a period (godot) -graphql/errcode/codes.go:32:57: Comment should end in a period (godot) -graphql/errcode/codes.go:37:16: type assertion on error will fail on wrapped errors. Use errors.As to check for specific errors (errorlint) -graphql/errcode/codes.go:49:99: Comment should end in a period (godot) -graphql/executable_schema.go:101:1: paramTypeCombine: func(c *[]CollectedField, name string, alias string, objectDefinition *ast.Definition, creator func() CollectedField) *CollectedField could be replaced with func(c *[]CollectedField, name, alias string, objectDefinition *ast.Definition, creator func() CollectedField) *CollectedField (gocritic) -graphql/executable_schema.go:103:3: nestingReduce: invert if cond, replace body with `continue`, move old body after the statement (gocritic) -graphql/executor/executor.go:83:17: type assertion on error will fail on wrapped errors. Use errors.As to check for specific errors (errorlint) -graphql/executor/executor.go:193:17: type assertion on error will fail on wrapped errors. Use errors.As to check for specific errors (errorlint) -graphql/executor/executor.go:205:11: Error return value is not checked (errcheck) -graphql/executor/executor.go:205:16: type assertion on error will fail on wrapped errors. Use errors.As to check for specific errors (errorlint) -graphql/executor/executor_test.go:148:17: Function `query` should pass the context parameter (contextcheck) -graphql/executor/executor_test.go:161:17: Function `query` should pass the context parameter (contextcheck) -graphql/executor/executor_test.go:179:37: unused-parameter: parameter 's' seems to be unused, consider removing or renaming it as _ (revive) -graphql/executor/executor_test.go:195:35: unused-parameter: parameter 's' seems to be unused, consider removing or renaming it as _ (revive) -graphql/executor/extensions.go:31:104: Comment should end in a period (godot) -graphql/executor/extensions.go:36:113: Comment should end in a period (godot) -graphql/executor/extensions.go:41:112: Comment should end in a period (godot) -graphql/executor/extensions.go:46:110: Comment should end in a period (godot) -graphql/executor/extensions.go:135:32: unused-parameter: parameter 'schema' seems to be unused, consider removing or renaming it as _ (revive) -graphql/executor/extensions.go:152:34: unused-parameter: parameter 'schema' seems to be unused, consider removing or renaming it as _ (revive) -graphql/executor/extensions.go:169:35: unused-parameter: parameter 'schema' seems to be unused, consider removing or renaming it as _ (revive) -graphql/executor/extensions.go:186:39: unused-parameter: parameter 'schema' seems to be unused, consider removing or renaming it as _ (revive) -graphql/executor/testexecutor/testexecutor.go:21:38: unused-parameter: parameter 'v' seems to be unused, consider removing or renaming it as _ (revive) -graphql/executor/testexecutor/testexecutor.go:83:8: commentedOutCode: may want to remove commented-out code (gocritic) -graphql/fieldset.go:53:14: Error return value of `writer.Write` is not checked (errcheck) -graphql/fieldset.go:56:16: Error return value of `writer.Write` is not checked (errcheck) -graphql/fieldset.go:59:15: Error return value of `writer.Write` is not checked (errcheck) -graphql/fieldset.go:62:14: Error return value of `writer.Write` is not checked (errcheck) -graphql/float.go:14:3: preferFprint: suggestion: fmt.Fprintf(w, "%g", f) (gocritic) -graphql/float.go:14:17: Error return value of `io.WriteString` is not checked (errcheck) -graphql/float.go:40:3: preferFprint: suggestion: fmt.Fprintf(w, "%g", f) (gocritic) -graphql/float.go:40:17: Error return value of `io.WriteString` is not checked (errcheck) -graphql/float.go:45:28: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -graphql/handler.go:27:40: json(snake): got 'operationName' want 'operation_name' (tagliatelle) -graphql/handler.go:87:46: Comment should end in a period (godot) -graphql/handler.go:92:117: Comment should end in a period (godot) -graphql/handler/apollofederatedtracingv1/tracing.go:33:51: Comment should end in a period (godot) -graphql/handler/apollofederatedtracingv1/tracing.go:38:111: Comment should end in a period (godot) -graphql/handler/apollofederatedtracingv1/tracing.go:58:131: Comment should end in a period (godot) -graphql/handler/apollofederatedtracingv1/tracing.go:67:97: Comment should end in a period (godot) -graphql/handler/apollofederatedtracingv1/tracing.go:80:74: Comment should end in a period (godot) -graphql/handler/apollofederatedtracingv1/tracing_test.go:127:34: unused-parameter: parameter 'schema' seems to be unused, consider removing or renaming it as _ (revive) -graphql/handler/apollofederatedtracingv1/tree_builder.go:29:119: Comment should end in a period (godot) -graphql/handler/apollofederatedtracingv1/tree_builder.go:46:92: Comment should end in a period (godot) -graphql/handler/apollofederatedtracingv1/tree_builder.go:62:110: Comment should end in a period (godot) -graphql/handler/apollofederatedtracingv1/tree_builder.go:63:34: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -graphql/handler/apollofederatedtracingv1/tree_builder.go:78:113: Comment should end in a period (godot) -graphql/handler/apollofederatedtracingv1/tree_builder.go:100:133: Comment should end in a period (godot) -graphql/handler/apollofederatedtracingv1/tree_builder.go:132:52: Comment should end in a period (godot) -graphql/handler/apollotracing/tracer.go:18:28: json(snake): got 'startTime' want 'start_time' (tagliatelle) -graphql/handler/apollotracing/tracer.go:19:28: json(snake): got 'endTime' want 'end_time' (tagliatelle) -graphql/handler/apollotracing/tracer.go:29:29: json(snake): got 'startOffset' want 'start_offset' (tagliatelle) -graphql/handler/apollotracing/tracer.go:35:29: json(snake): got 'parentType' want 'parent_type' (tagliatelle) -graphql/handler/apollotracing/tracer.go:36:29: json(snake): got 'fieldName' want 'field_name' (tagliatelle) -graphql/handler/apollotracing/tracer.go:37:29: json(snake): got 'returnType' want 'return_type' (tagliatelle) -graphql/handler/apollotracing/tracer.go:38:29: json(snake): got 'startOffset' want 'start_offset' (tagliatelle) -graphql/handler/debug/tracer.go:11:2: dot-imports: should not use dot imports (revive) -graphql/handler/debug/tracer.go:11:2: ST1001: should not use dot imports (stylecheck) -graphql/handler/debug/tracer.go:33:27: unused-parameter: parameter 'schema' seems to be unused, consider removing or renaming it as _ (revive) -graphql/handler/debug/tracer.go:43:2: ST1003: var valueJson should be valueJSON (stylecheck) -graphql/handler/debug/tracer.go:43:2: var-naming: var valueJson should be valueJSON (revive) -graphql/handler/extension/apq.go:49:43: unused-parameter: parameter 'schema' seems to be unused, consider removing or renaming it as _ (revive) -graphql/handler/extension/apq.go:62:18: mapstructure(kebab): got 'sha256Hash' want 'sha256-hash' (tagliatelle) -graphql/handler/extension/apq.go:83:21: Error return value is not checked (errcheck) -graphql/handler/extension/apq.go:107:5: Error return value is not checked (errcheck) -graphql/handler/extension/complexity.go:39:69: Comment should end in a period (godot) -graphql/handler/extension/complexity.go:62:2: importShadow: shadow of imported from 'github.com/99designs/gqlgen/complexity' package 'complexity' (gocritic) -graphql/handler/extension/complexity.go:86:5: Error return value is not checked (errcheck) -graphql/handler/extension/complexity_test.go:110:1: paramTypeCombine: func(handler http.Handler, method string, target string, body string) *httptest.ResponseRecorder could be replaced with func(handler http.Handler, method, target, body string) *httptest.ResponseRecorder (gocritic) -graphql/handler/extension/complexity_test.go:110:38: `doRequest` - `method` always receives `"POST"` (unparam) -graphql/handler/extension/complexity_test.go:110:53: `doRequest` - `target` always receives `"/graphql"` (unparam) -graphql/handler/extension/introspection.go:22:33: unused-parameter: parameter 'schema' seems to be unused, consider removing or renaming it as _ (revive) -graphql/handler/extension/introspection.go:26:47: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -graphql/handler/lru/lru.go:26:18: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -graphql/handler/lru/lru.go:30:18: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -graphql/handler/server.go:52:31: importShadow: shadow of imported from 'github.com/99designs/gqlgen/graphql/handler/transport' package 'transport' (gocritic) -graphql/handler/server.go:68:22: importShadow: shadow of imported from 'github.com/99designs/gqlgen/graphql/handler/extension' package 'extension' (gocritic) -graphql/handler/server.go:72:104: Comment should end in a period (godot) -graphql/handler/server.go:77:108: Comment should end in a period (godot) -graphql/handler/server.go:82:112: Comment should end in a period (godot) -graphql/handler/server.go:87:110: Comment should end in a period (godot) -graphql/handler/server.go:105:12: Error return value is not checked (errcheck) -graphql/handler/server.go:105:17: type assertion on error will fail on wrapped errors. Use errors.As to check for specific errors (errorlint) -graphql/handler/server.go:107:7: Error return value of `json.Marshal` is not checked (errcheck) -graphql/handler/server.go:109:11: Error return value of `w.Write` is not checked (errcheck) -graphql/handler/server.go:115:2: importShadow: shadow of imported from 'github.com/99designs/gqlgen/graphql/handler/transport' package 'transport' (gocritic) -graphql/handler/server.go:130:9: Error return value of `w.Write` is not checked (errcheck) -graphql/handler/server.go:143:33: unused-parameter: parameter 'schema' seems to be unused, consider removing or renaming it as _ (revive) -graphql/handler/server.go:160:32: unused-parameter: parameter 'schema' seems to be unused, consider removing or renaming it as _ (revive) -graphql/handler/server.go:177:29: unused-parameter: parameter 'schema' seems to be unused, consider removing or renaming it as _ (revive) -graphql/handler/server_test.go:168:34: unused-parameter: parameter 'r' seems to be unused, consider removing or renaming it as _ (revive) -graphql/handler/server_test.go:172:1: receiver-naming: receiver name h should be consistent with previous receiver name t for panicTransport (revive) -graphql/handler/server_test.go:172:25: ST1016: methods on the same type should have the same receiver name (seen 1x "h", 1x "t") (stylecheck) -graphql/handler/server_test.go:172:28: unused-parameter: parameter 'w' seems to be unused, consider removing or renaming it as _ (revive) -graphql/handler/server_test.go:172:51: unused-parameter: parameter 'r' seems to be unused, consider removing or renaming it as _ (revive) -graphql/handler/server_test.go:172:68: unused-parameter: parameter 'exec' seems to be unused, consider removing or renaming it as _ (revive) -graphql/handler/server_test.go:188:27: "GET" can be replaced by http.MethodGet (usestdlibvars) -graphql/handler/server_test.go:196:27: "POST" can be replaced by http.MethodPost (usestdlibvars) -graphql/handler/transport/error.go:13:23: Comment should end in a period (godot) -graphql/handler/transport/error.go:20:9: Error return value of `w.Write` is not checked (errcheck) -graphql/handler/transport/error.go:23:56: Comment should end in a period (godot) -graphql/handler/transport/http_form.go:108:6: comparing with == will fail on wrapped errors. Use errors.Is to check for a specific error (errorlint) -graphql/handler/transport/http_form.go:158:4: deferInLoop: Possible resource leak, 'defer' is called in the 'for' loop (gocritic) -graphql/handler/transport/http_form.go:183:5: deferInLoop: Possible resource leak, 'defer' is called in the 'for' loop (gocritic) -graphql/handler/transport/http_form_test.go:211:12: "POST" can be replaced by http.MethodPost (usestdlibvars) -graphql/handler/transport/http_form_test.go:279:6: test helper function should start from t.Helper() (thelper) -graphql/handler/transport/http_form_test.go:291:32: sprintfQuotedString: use %q instead of "%s" for quoted strings (gocritic) -graphql/handler/transport/http_form_test.go:301:29: should rewrite http.NewRequestWithContext or add (*Request).WithContext (noctx) -graphql/handler/transport/http_form_test.go:301:30: "POST" can be replaced by http.MethodPost (usestdlibvars) -graphql/handler/transport/http_post_test.go:98:21: sprintfQuotedString: use %q instead of "%s" for quoted strings (gocritic) -graphql/handler/transport/http_post_test.go:104:1: paramTypeCombine: func(handler http.Handler, method string, target string, body string) *httptest.ResponseRecorder could be replaced with func(handler http.Handler, method, target, body string) *httptest.ResponseRecorder (gocritic) -graphql/handler/transport/options.go:10:54: Comment should end in a period (godot) -graphql/handler/transport/options.go:22:61: unused-parameter: parameter 'exec' seems to be unused, consider removing or renaming it as _ (revive) -graphql/handler/transport/reader.go:22:2: naked return in func `Read` with 10 lines of code (nakedret) -graphql/handler/transport/reader_test.go:23:11: Error return value of `r.Read` is not checked (errcheck) -graphql/handler/transport/reader_test.go:27:11: Error return value of `r.Read` is not checked (errcheck) -graphql/handler/transport/reader_test.go:53:8: comparing with == will fail on wrapped errors. Use errors.Is to check for a specific error (errorlint) -graphql/handler/transport/reader_test.go:77:8: comparing with == will fail on wrapped errors. Use errors.Is to check for a specific error (errorlint) -graphql/handler/transport/reader_test.go:99:8: comparing with == will fail on wrapped errors. Use errors.Is to check for a specific error (errorlint) -graphql/handler/transport/reader_test.go:119:8: comparing with == will fail on wrapped errors. Use errors.Is to check for a specific error (errorlint) -graphql/handler/transport/sse.go:104:6: var-naming: func writeJsonWithSSE should be writeJSONWithSSE (revive) -graphql/handler/transport/sse.go:104:6: ST1003: func writeJsonWithSSE should be writeJSONWithSSE (stylecheck) -graphql/handler/transport/sse_test.go:39:30: should rewrite http.NewRequestWithContext or add (*Request).WithContext (noctx) -graphql/handler/transport/sse_test.go:39:31: "POST" can be replaced by http.MethodPost (usestdlibvars) -graphql/handler/transport/sse_test.go:92: File is not `gofumpt`-ed (gofumpt) -graphql/handler/transport/util.go:12:6: var-naming: func writeJson should be writeJSON (revive) -graphql/handler/transport/util.go:12:6: ST1003: func writeJson should be writeJSON (stylecheck) -graphql/handler/transport/util.go:17:9: Error return value of `w.Write` is not checked (errcheck) -graphql/handler/transport/util.go:20:6: var-naming: func writeJsonError should be writeJSONError (revive) -graphql/handler/transport/util.go:20:6: ST1003: func writeJsonError should be writeJSONError (stylecheck) -graphql/handler/transport/util.go:24:6: var-naming: func writeJsonErrorf should be writeJSONErrorf (revive) -graphql/handler/transport/util.go:24:6: ST1003: func writeJsonErrorf should be writeJSONErrorf (stylecheck) -graphql/handler/transport/util.go:28:6: var-naming: func writeJsonGraphqlError should be writeJSONGraphqlError (revive) -graphql/handler/transport/util.go:28:6: ST1003: func writeJsonGraphqlError should be writeJSONGraphqlError (stylecheck) -graphql/handler/transport/websocket.go:88:18: Error return value of `ws.WriteMessage` is not checked (errcheck) -graphql/handler/transport/websocket.go:111:10: Function `run->subscribe` should pass the context parameter (contextcheck) -graphql/handler/transport/websocket.go:155:6: comparing with == will fail on wrapped errors. Use errors.Is to check for a specific error (errorlint) -graphql/handler/transport/websocket.go:160:6: comparing with == will fail on wrapped errors. Use errors.Is to check for a specific error (errorlint) -graphql/handler/transport/websocket.go:236:25: Error return value of `c.conn.SetReadDeadline` is not checked (errcheck) -graphql/handler/transport/websocket.go:271:26: Error return value of `c.conn.SetReadDeadline` is not checked (errcheck) -graphql/handler/transport/websocket.go:407:45: importShadow: shadow of imported package 'errors' (gocritic) -graphql/handler/transport/websocket.go:430:2: Error return value of `c.conn.WriteMessage` is not checked (errcheck) -graphql/handler/transport/websocket_close_reason.go:8:56: Comment should end in a period (godot) -graphql/handler/transport/websocket_close_reason.go:20:10: Error return value is not checked (errcheck) -graphql/handler/transport/websocket_init.go:23:8: Error return value is not checked (errcheck) -graphql/handler/transport/websocket_resolver_error.go:10:56: Comment should end in a period (godot) -graphql/handler/transport/websocket_resolver_error.go:52:70: Comment should end in a period (godot) -graphql/handler/transport/websocket_resolver_error.go:63:5: Error return value is not checked (errcheck) -graphql/handler/transport/websocket_test.go:28:2: importShadow: shadow of imported from 'github.com/99designs/gqlgen/graphql/handler' package 'handler' (gocritic) -graphql/handler/transport/websocket_test.go:52:49: type assertion on error will fail on wrapped errors. Use errors.As to check for specific errors (errorlint) -graphql/handler/transport/websocket_test.go:87:49: type assertion on error will fail on wrapped errors. Use errors.As to check for specific errors (errorlint) -graphql/handler/transport/websocket_test.go:142:20: Error return value of `c.SetReadDeadline` is not checked (errcheck) -graphql/handler/transport/websocket_test.go:152: File is not `gofumpt`-ed (gofumpt) -graphql/handler/transport/websocket_test.go:273:21: Error return value is not checked (errcheck) -graphql/handler/transport/websocket_test.go:339:4: Error return value of `c.ReadJSON` is not checked (errcheck) -graphql/handler/transport/websocket_test.go:361:20: type assertion on error will fail on wrapped errors. Use errors.As to check for specific errors (errorlint) -graphql/handler/transport/websocket_test.go:469:3: importShadow: shadow of imported from 'github.com/99designs/gqlgen/graphql/handler' package 'handler' (gocritic) -graphql/handler/transport/websocket_test.go:514:20: Error return value of `c.SetReadDeadline` is not checked (errcheck) -graphql/handler/transport/websocket_test.go:523:46: TestWebsocketWithPingPongInterval$1 - result 0 (*github.com/99designs/gqlgen/graphql/handler/testserver.TestServer) is never used (unparam) -graphql/handler_test.go:14:9: Error return value of `os.Open` is not checked (errcheck) -graphql/handler_test.go:30:9: Error return value of `os.Open` is not checked (errcheck) -graphql/handler_test.go:58:9: Error return value of `os.Open` is not checked (errcheck) -graphql/id.go:29:10: indent-error-flow: if block ends with a return statement, so drop this else and outdent its block (revive) -graphql/int.go:12:17: Error return value of `io.WriteString` is not checked (errcheck) -graphql/int.go:33:17: Error return value of `io.WriteString` is not checked (errcheck) -graphql/int.go:54:17: Error return value of `io.WriteString` is not checked (errcheck) -graphql/introspection/query.go:3:74: Comment should end in a period (godot) -graphql/jsonw.go:74:14: Error return value of `writer.Write` is not checked (errcheck) -graphql/jsonw.go:77:16: Error return value of `writer.Write` is not checked (errcheck) -graphql/jsonw.go:81:14: Error return value of `writer.Write` is not checked (errcheck) -graphql/jsonw.go:87:9: Error return value of `w.Write` is not checked (errcheck) -graphql/jsonw.go:90:32: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -graphql/jsonw.go:91:9: Error return value of `w.Write` is not checked (errcheck) -graphql/playground/altair_playground.go:66:66: Comment should end in a period (godot) -graphql/playground/apollo_sandbox_playground.go:49:73: Comment should end in a period (godot) -graphql/playground/playground.go:76:53: Comment should end in a period (godot) -graphql/playground/playground.go:77:1: paramTypeCombine: func(title string, endpoint string) http.HandlerFunc could be replaced with func(title, endpoint string) http.HandlerFunc (gocritic) -graphql/playground/playground_test.go:29:29: regexpSimplify: can re-write `(?m)^.*url\s*=\s*['"]https:\/\/example\.org\/query["'].*$` as `(?m)^.*url\s*=\s*['"]https://example\.org/query["'].*$` (gocritic) -graphql/playground/playground_test.go:39:47: regexpSimplify: can re-write `\n\s{0,}\n\s{0,}.*` as `<head>\n\s*<meta charset="utf-8">\n\s*.*<title>` (gocritic) -graphql/recovery.go:14:21: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -graphql/response.go:20:20: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -graphql/stats.go:36:18: Comment should end in a period (godot) -graphql/string.go:20:16: Error return value of `io.WriteString` is not checked (errcheck) -graphql/string.go:24:18: Error return value of `io.WriteString` is not checked (errcheck) -graphql/string.go:28:19: Error return value of `io.WriteString` is not checked (errcheck) -graphql/string.go:30:19: Error return value of `io.WriteString` is not checked (errcheck) -graphql/string.go:32:19: Error return value of `io.WriteString` is not checked (errcheck) -graphql/string.go:34:19: Error return value of `io.WriteString` is not checked (errcheck) -graphql/string.go:36:19: Error return value of `io.WriteString` is not checked (errcheck) -graphql/string.go:38:19: Error return value of `io.WriteString` is not checked (errcheck) -graphql/string.go:39:12: Error return value of `w.Write` is not checked (errcheck) -graphql/string.go:46:16: Error return value of `io.WriteString` is not checked (errcheck) -graphql/string.go:47:16: Error return value of `io.WriteString` is not checked (errcheck) -graphql/string.go:65:10: indent-error-flow: if block ends with a return statement, so drop this else and outdent its block (revive) -graphql/time.go:16:17: Error return value of `io.WriteString` is not checked (errcheck) -graphql/uint.go:12:6: Error return value of `io.WriteString` is not checked (errcheck) -graphql/uint.go:35:6: Error return value of `io.WriteString` is not checked (errcheck) -graphql/uint.go:56:6: Error return value of `io.WriteString` is not checked (errcheck) -graphql/upload.go:17:10: Error return value of `io.Copy` is not checked (errcheck) -handler/handler.go:17:45: Comment should end in a period (godot) -handler/handler.go:75:45: Comment should end in a period (godot) -handler/handler.go:94:45: Comment should end in a period (godot) -handler/handler.go:97:45: Comment should end in a period (godot) -handler/handler.go:104:45: Comment should end in a period (godot) -handler/handler.go:105:18: param recover has same name as predeclared identifier (predeclared) -handler/handler.go:105:18: builtinShadow: shadowing of predeclared identifier: recover (gocritic) -handler/handler.go:114:45: Comment should end in a period (godot) -handler/handler.go:123:45: Comment should end in a period (godot) -handler/handler.go:132:45: Comment should end in a period (godot) -handler/handler.go:142:45: Comment should end in a period (godot) -handler/handler.go:151:45: Comment should end in a period (godot) -handler/handler.go:160:45: Comment should end in a period (godot) -handler/handler.go:169:45: Comment should end in a period (godot) -handler/handler.go:178:45: Comment should end in a period (godot) -handler/handler.go:187:45: Comment should end in a period (godot) -handler/handler.go:197:45: Comment should end in a period (godot) -handler/handler.go:208:45: Comment should end in a period (godot) -handler/handler.go:222:45: Comment should end in a period (godot) -handler/handler.go:250:46: Comment should end in a period (godot) -handler/handler.go:251:1: paramTypeCombine: func(title string, endpoint string) http.HandlerFunc could be replaced with func(title, endpoint string) http.HandlerFunc (gocritic) -handler/handler.go:255:49: Comment should end in a period (godot) -integration/remote_api/user.go:1:1: ST1003: should not use underscores in package names (stylecheck) -integration/remote_api/user.go:1:9: var-naming: don't use an underscore in package name (revive) -integration/resolver.go:39:33: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -integration/resolver.go:46:38: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -integration/resolver.go:46:59: unused-parameter: parameter 'obj' seems to be unused, consider removing or renaming it as _ (revive) -integration/resolver.go:50:33: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -integration/resolver.go:56:31: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -integration/resolver.go:64:30: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -integration/resolver.go:68:34: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -integration/resolver.go:68:55: unused-parameter: parameter 'input' seems to be unused, consider removing or renaming it as _ (revive) -integration/resolver.go:72:30: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -integration/resolver.go:88:32: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -integration/resolver.go:94:38: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -integration/resolver.go:98:36: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -integration/resolver.go:98:57: unused-parameter: parameter 'value' seems to be unused, consider removing or renaming it as _ (revive) -integration/resolver.go:104:30: unused-parameter: parameter 'ctx' seems to be unused, consider removing or renaming it as _ (revive) -integration/server/server.go:50:12: G114: Use of net/http serve function that has no support for setting timeouts (gosec) -integration/testomitempty/testmodel.go:4:21: json(snake): got 'newDesc' want 'new_desc' (tagliatelle) -internal/code/compare.go:8:79: Comment should end in a period (godot) -internal/code/compare.go:9:1: paramTypeCombine: func(expected types.Type, actual types.Type) error could be replaced with func(expected, actual types.Type) error (gocritic) -internal/code/compare.go:87:4: if-return: redundant if ...; err != nil check, just return error instead. (revive) -internal/code/compare.go:117:4: if-return: redundant if ...; err != nil check, just return error instead. (revive) -internal/code/imports.go:59:28: Comment should end in a period (godot) -internal/code/imports.go:141:6: emptyStringTest: replace `len(s) != 0` with `s != ""` (gocritic) -internal/code/imports.go:152:82: Comment should end in a period (godot) -internal/code/imports.go:174:35: regexpSimplify: can re-write `module ([^\s]*)` as `module (\S*)` (gocritic) -internal/code/packages.go:35:55: Comment should end in a period (godot) -internal/code/packages.go:184:18: whyNoLint: include an explanation for nolint directive (gocritic) -internal/code/packages.go:184:18: directive `//nolint:prealloc` is unused for linter "prealloc" (nolintlint) -internal/code/packages_test.go:53:6: test helper function should start from t.Helper() (thelper) -internal/code/util.go:11:93: Comment should end in a period (godot) -internal/code/util.go:12:1: unnamedResult: consider giving a name to these results (gocritic) -internal/code/util.go:26:39: Comment should end in a period (godot) -internal/code/util.go:42:6: Error return value of `os.Getwd` is not checked (errcheck) -internal/code/util.go:57:49: regexpSimplify: can re-write `[^\w]` as `\W` (gocritic) -internal/imports/prune.go:26:36: Comment should end in a period (godot) -internal/rewrite/rewriter.go:71:1: paramTypeCombine: func(structname string, methodname string) *ast.FuncDecl could be replaced with func(structname, methodname string) *ast.FuncDecl (gocritic) -internal/rewrite/rewriter.go:102:1: paramTypeCombine: func(structname string, methodname string) string could be replaced with func(structname, methodname string) string (gocritic) -internal/rewrite/rewriter.go:110:1: paramTypeCombine: func(structname string, methodname string) string could be replaced with func(structname, methodname string) string (gocritic) -main.go:66:10: ST1005: error strings should not end with punctuation or newlines (stylecheck) -main.go:66:21: error-strings: error strings should not be capitalized or end with punctuation or a newline (revive) -main.go:68:12: G306: Expect WriteFile permissions to be 0600 or less (gosec) -main.go:69:10: ST1005: error strings should not end with punctuation or newlines (stylecheck) -main.go:69:21: error-strings: error strings should not be capitalized or end with punctuation or a newline (revive) -main.go:110:11: ST1005: error strings should not end with punctuation or newlines (stylecheck) -main.go:110:22: error-strings: error strings should not be capitalized or end with punctuation or a newline (revive) -main.go:121:11: ST1005: error strings should not end with punctuation or newlines (stylecheck) -main.go:121:22: error-strings: error strings should not be capitalized or end with punctuation or a newline (revive) -main.go:187:3: if-return: redundant if ...; err != nil check, just return error instead. (revive) -plugin/federation/entity.go:39:43: Comment should end in a period (godot) -plugin/federation/federation.go:27:50: Comment should end in a period (godot) -plugin/federation/federation.go:36:32: Comment should end in a period (godot) -plugin/federation/federation.go:41:42: Comment should end in a period (godot) -plugin/federation/federation.go:121:42: Comment should end in a period (godot) -plugin/federation/federation.go:282:16: Error return value is not checked (errcheck) -plugin/federation/federation_entityresolver_test.go:39:6: json(snake): got '_entities' want 'entities' (tagliatelle) -plugin/federation/federation_entityresolver_test.go:78:6: json(snake): got '_entities' want 'entities' (tagliatelle) -plugin/federation/federation_entityresolver_test.go:132:6: json(snake): got '_entities' want 'entities' (tagliatelle) -plugin/federation/federation_entityresolver_test.go:171:6: json(snake): got '_entities' want 'entities' (tagliatelle) -plugin/federation/federation_entityresolver_test.go:215:6: json(snake): got '_entities' want 'entities' (tagliatelle) -plugin/federation/federation_entityresolver_test.go:256:6: json(snake): got '_entities' want 'entities' (tagliatelle) -plugin/federation/federation_entityresolver_test.go:294:6: json(snake): got '_entities' want 'entities' (tagliatelle) -plugin/federation/federation_entityresolver_test.go:337:6: json(snake): got '_entities' want 'entities' (tagliatelle) -plugin/federation/federation_entityresolver_test.go:377:6: json(snake): got '_entities' want 'entities' (tagliatelle) -plugin/federation/federation_entityresolver_test.go:418:6: json(snake): got '_entities' want 'entities' (tagliatelle) -plugin/federation/federation_entityresolver_test.go:455:6: json(snake): got '_entities' want 'entities' (tagliatelle) -plugin/federation/federation_entityresolver_test.go:490:6: json(snake): got '_entities' want 'entities' (tagliatelle) -plugin/federation/federation_entityresolver_test.go:528:6: json(snake): got '_entities' want 'entities' (tagliatelle) -plugin/federation/federation_entityresolver_test.go:571:6: json(snake): got '_entities' want 'entities' (tagliatelle) -plugin/federation/fedruntime/runtime.go:5:9: Comment should end in a period (godot) -plugin/federation/fedruntime/runtime.go:10:42: Comment should end in a period (godot) -plugin/federation/fedruntime/runtime.go:15:31: Comment should end in a period (godot) -plugin/federation/fieldset/fieldset.go:16:49: Comment should end in a period (godot) -plugin/federation/fieldset/fieldset.go:54:10: sprintfQuotedString: use %q instead of "%s" for quoted strings (gocritic) -plugin/federation/fieldset/fieldset.go:143:1: unnamedResult: consider giving a name to these results (gocritic) -plugin/federation/test_data/model/federation.go:3:23: whyNoLint: include an explanation for nolint directive (gocritic) -plugin/modelgen/models.go:265:10: indent-error-flow: if block ends with a return statement, so drop this else and outdent its block (revive) -plugin/modelgen/models.go:401:21: unused-parameter: parameter 'td' seems to be unused, consider removing or renaming it as _ (revive) -plugin/modelgen/models.go:409:11: Error return value is not checked (errcheck) -plugin/modelgen/models.go:415:13: Error return value is not checked (errcheck) -plugin/modelgen/models.go:458:18: unused-parameter: parameter 'td' seems to be unused, consider removing or renaming it as _ (revive) -plugin/modelgen/models.go:464:16: Error return value is not checked (errcheck) -plugin/modelgen/models_test.go:346:2: importShadow: shadow of imported from 'github.com/99designs/gqlgen/plugin/modelgen/out' package 'out' (gocritic) -plugin/modelgen/out_struct_pointers/existing.go:1:1: ST1003: should not use underscores in package names (stylecheck) -plugin/modelgen/out_struct_pointers/existing.go:1:9: var-naming: don't use an underscore in package name (revive) -plugin/plugin.go:33:57: Comment should end in a period (godot) -plugin/resolvergen/resolver.go:131:9: var-naming: don't use underscores in Go names; var resolver_implementer should be resolverImplementer (revive) -plugin/resolvergen/resolver.go:131:9: ST1003: should not use underscores in Go names; var resolver_implementer should be resolverImplementer (stylecheck) -plugin/resolvergen/resolver.go:134:9: var-naming: don't use underscores in Go names; var p_cast should be pCast (revive) -plugin/resolvergen/resolver.go:134:9: ST1003: should not use underscores in Go names; var p_cast should be pCast (stylecheck) -plugin/resolvergen/resolver.go:225:7: Error return value of `templates.CurrentImports.Reserve` is not checked (errcheck) -plugin/resolvergen/resolver.go:227:7: Error return value of `templates.CurrentImports.Reserve` is not checked (errcheck) -plugin/resolvergen/resolver.go:241:1: paramTypeCombine: func(base string, gqlname, filenameTmpl string) string could be replaced with func(base, gqlname, filenameTmpl string) string (gocritic) -plugin/resolvergen/resolver_test.go:16:2: Error return value of `syscall.Unlink` is not checked (errcheck) -plugin/resolvergen/resolver_test.go:68:6: test helper function should start from t.Helper() (thelper) -plugin/resolvergen/resolver_test.go:69:2: Error return value of `syscall.Unlink` is not checked (errcheck) -plugin/resolvergen/resolver_test.go:86:6: test helper function should start from t.Helper() (thelper) -plugin/stubgen/stubs.go:19:1: paramTypeCombine: func(filename string, typename string) plugin.Plugin could be replaced with func(filename, typename string) plugin.Plugin (gocritic) -plugin/stubgen/stubs.go:37:31: unused-parameter: parameter 'cfg' seems to be unused, consider removing or renaming it as _ (revive) -plugin/stubgen/stubs.go:38:2: Error return value of `syscall.Unlink` is not checked (errcheck) diff --git a/vendor/github.com/99designs/gqlgen/plugin/federation/federation.go b/vendor/github.com/99designs/gqlgen/plugin/federation/federation.go index 27d0fe68..4cc8708d 100644 --- a/vendor/github.com/99designs/gqlgen/plugin/federation/federation.go +++ b/vendor/github.com/99designs/gqlgen/plugin/federation/federation.go @@ -86,28 +86,55 @@ func (f *federation) MutateConfig(cfg *config.Config) error { } func (f *federation) InjectSourceEarly() *ast.Source { - input := ` - scalar _Any - scalar _FieldSet - directive @requires(fields: _FieldSet!) on FIELD_DEFINITION - directive @provides(fields: _FieldSet!) on FIELD_DEFINITION - directive @extends on OBJECT | INTERFACE -` + input := `` + // add version-specific changes on key directive, as well as adding the new directives for federation 2 if f.Version == 1 { input += ` directive @key(fields: _FieldSet!) repeatable on OBJECT | INTERFACE + directive @requires(fields: _FieldSet!) on FIELD_DEFINITION + directive @provides(fields: _FieldSet!) on FIELD_DEFINITION + directive @extends on OBJECT | INTERFACE directive @external on FIELD_DEFINITION + scalar _Any + scalar _FieldSet ` } else if f.Version == 2 { input += ` - directive @key(fields: _FieldSet!, resolvable: Boolean = true) repeatable on OBJECT | INTERFACE - directive @external on FIELD_DEFINITION | OBJECT + directive @composeDirective(name: String!) repeatable on SCHEMA + directive @extends on OBJECT | INTERFACE + directive @external on OBJECT | FIELD_DEFINITION + directive @key(fields: FieldSet!, resolvable: Boolean = true) repeatable on OBJECT | INTERFACE + directive @inaccessible on + | ARGUMENT_DEFINITION + | ENUM + | ENUM_VALUE + | FIELD_DEFINITION + | INPUT_FIELD_DEFINITION + | INPUT_OBJECT + | INTERFACE + | OBJECT + | SCALAR + | UNION + directive @interfaceObject on OBJECT directive @link(import: [String!], url: String!) repeatable on SCHEMA - directive @shareable on OBJECT | FIELD_DEFINITION - directive @tag(name: String!) repeatable on FIELD_DEFINITION | INTERFACE | OBJECT | UNION | ARGUMENT_DEFINITION | SCALAR | ENUM | ENUM_VALUE | INPUT_OBJECT | INPUT_FIELD_DEFINITION directive @override(from: String!) on FIELD_DEFINITION - directive @inaccessible on SCALAR | OBJECT | FIELD_DEFINITION | ARGUMENT_DEFINITION | INTERFACE | UNION | ENUM | ENUM_VALUE | INPUT_OBJECT | INPUT_FIELD_DEFINITION + directive @provides(fields: FieldSet!) on FIELD_DEFINITION + directive @requires(fields: FieldSet!) on FIELD_DEFINITION + directive @shareable repeatable on FIELD_DEFINITION | OBJECT + directive @tag(name: String!) repeatable on + | ARGUMENT_DEFINITION + | ENUM + | ENUM_VALUE + | FIELD_DEFINITION + | INPUT_FIELD_DEFINITION + | INPUT_OBJECT + | INTERFACE + | OBJECT + | SCALAR + | UNION + scalar _Any + scalar FieldSet ` } return &ast.Source{ @@ -123,11 +150,18 @@ func (f *federation) InjectSourceLate(schema *ast.Schema) *ast.Source { f.setEntities(schema) var entities, resolvers, entityResolverInputDefinitions string - for i, e := range f.Entities { - if i != 0 { - entities += " | " + for _, e := range f.Entities { + + if e.Def.Kind != ast.Interface { + if entities != "" { + entities += " | " + } + entities += e.Name + } else if len(schema.GetPossibleTypes(e.Def)) == 0 { + fmt.Println( + "skipping @key field on interface " + e.Def.Name + " as no types implement it", + ) } - entities += e.Name for _, r := range e.Resolvers { if e.Multi { @@ -206,6 +240,16 @@ func (f *federation) GenerateCode(data *codegen.Data) error { for _, e := range f.Entities { obj := data.Objects.ByName(e.Def.Name) + if e.Def.Kind == ast.Interface { + if len(data.Interfaces[e.Def.Name].Implementors) == 0 { + fmt.Println( + "skipping @key field on interface " + e.Def.Name + " as no types implement it", + ) + continue + } + obj = data.Objects.ByName(data.Interfaces[e.Def.Name].Implementors[0].Name) + } + for _, r := range e.Resolvers { // fill in types for key fields // @@ -267,6 +311,12 @@ func (f *federation) setEntities(schema *ast.Schema) { if !ok { continue } + + if (schemaType.Kind == ast.Interface) && (len(schema.GetPossibleTypes(schemaType)) == 0) { + fmt.Printf("@key directive found on unused \"interface %s\". Will be ignored.\n", schemaType.Name) + continue + } + e := &Entity{ Name: schemaType.Name, Def: schemaType, @@ -385,10 +435,12 @@ func isFederatedEntity(schemaType *ast.Definition) ([]*ast.Directive, bool) { return keys, true } case ast.Interface: - // TODO: support @key and @extends for interfaces - if dir := schemaType.Directives.ForName("key"); dir != nil { - fmt.Printf("@key directive found on \"interface %s\". Will be ignored.\n", schemaType.Name) + keys := schemaType.Directives.ForNames("key") + if len(keys) > 0 { + return keys, true } + + // TODO: support @extends for interfaces if dir := schemaType.Directives.ForName("extends"); dir != nil { panic( fmt.Sprintf( diff --git a/vendor/github.com/99designs/gqlgen/plugin/modelgen/models.go b/vendor/github.com/99designs/gqlgen/plugin/modelgen/models.go index 44ae557c..a649a237 100644 --- a/vendor/github.com/99designs/gqlgen/plugin/modelgen/models.go +++ b/vendor/github.com/99designs/gqlgen/plugin/modelgen/models.go @@ -374,7 +374,7 @@ func (m *Plugin) generateFields(cfg *config.Config, schemaType *ast.Definition) GoName: name, Type: typ, Description: field.Description, - Tag: getStructTagFromField(field), + Tag: getStructTagFromField(cfg, field), Omittable: cfg.NullableInputOmittable && schemaType.Kind == ast.InputObject && !field.Type.NonNull, } @@ -409,11 +409,40 @@ func (m *Plugin) generateFields(cfg *config.Config, schemaType *ast.Definition) fields = append(fields, f) } + // appending extra fields at the end of the fields list. + modelcfg := cfg.Models[schemaType.Name] + if len(modelcfg.ExtraFields) > 0 { + ff := make([]*Field, 0, len(modelcfg.ExtraFields)) + for fname, fspec := range modelcfg.ExtraFields { + ftype := buildType(fspec.Type) + + tag := `json:"-"` + if fspec.OverrideTags != "" { + tag = fspec.OverrideTags + } + + ff = append(ff, + &Field{ + Name: fname, + GoName: fname, + Type: ftype, + Description: fspec.Description, + Tag: tag, + }) + } + + sort.Slice(ff, func(i, j int) bool { + return ff[i].Name < ff[j].Name + }) + + fields = append(fields, ff...) + } + return fields, nil } -func getStructTagFromField(field *ast.FieldDefinition) string { - if !field.Type.NonNull { +func getStructTagFromField(cfg *config.Config, field *ast.FieldDefinition) string { + if !field.Type.NonNull && (cfg.EnableModelJsonOmitemptyTag == nil || *cfg.EnableModelJsonOmitemptyTag) { return `json:"` + field.Name + `,omitempty"` } return `json:"` + field.Name + `"` diff --git a/vendor/github.com/99designs/gqlgen/plugin/modelgen/types.go b/vendor/github.com/99designs/gqlgen/plugin/modelgen/types.go new file mode 100644 index 00000000..32926934 --- /dev/null +++ b/vendor/github.com/99designs/gqlgen/plugin/modelgen/types.go @@ -0,0 +1,47 @@ +package modelgen + +import ( + "go/types" + "strings" +) + +// buildType constructs a types.Type for the given string (using the syntax +// from the extra field config Type field). +func buildType(typeString string) types.Type { + switch { + case typeString[0] == '*': + return types.NewPointer(buildType(typeString[1:])) + case strings.HasPrefix(typeString, "[]"): + return types.NewSlice(buildType(typeString[2:])) + default: + return buildNamedType(typeString) + } +} + +// buildNamedType returns the specified named or builtin type. +// +// Note that we don't look up the full types.Type object from the appropriate +// package -- gqlgen doesn't give us the package-map we'd need to do so. +// Instead we construct a placeholder type that has all the fields gqlgen +// wants. This is roughly what gqlgen itself does, anyway: +// https://github.com/99designs/gqlgen/blob/master/plugin/modelgen/models.go#L119 +func buildNamedType(fullName string) types.Type { + dotIndex := strings.LastIndex(fullName, ".") + if dotIndex == -1 { // builtinType + return types.Universe.Lookup(fullName).Type() + } + + // type is pkg.Name + pkgPath := fullName[:dotIndex] + typeName := fullName[dotIndex+1:] + + pkgName := pkgPath + slashIndex := strings.LastIndex(pkgPath, "/") + if slashIndex != -1 { + pkgName = pkgPath[slashIndex+1:] + } + + pkg := types.NewPackage(pkgPath, pkgName) + // gqlgen doesn't use some of the fields, so we leave them 0/nil + return types.NewNamed(types.NewTypeName(0, pkg, typeName, nil), nil, nil) +} diff --git a/vendor/github.com/adhocore/gronx/.gitignore b/vendor/github.com/adhocore/gronx/.gitignore index b085b1d8..12ae865c 100644 --- a/vendor/github.com/adhocore/gronx/.gitignore +++ b/vendor/github.com/adhocore/gronx/.gitignore @@ -5,3 +5,7 @@ vendor/ dist/ .env +bin/ +*.php +test/*.go +*.txt diff --git a/vendor/github.com/adhocore/gronx/.goreleaser.yml b/vendor/github.com/adhocore/gronx/.goreleaser.yml new file mode 100644 index 00000000..b52f6d99 --- /dev/null +++ b/vendor/github.com/adhocore/gronx/.goreleaser.yml @@ -0,0 +1,67 @@ +project_name: tasker + +release: + prerelease: auto + name_template: "Version v{{.Version}}" + # draft: true + mode: "keep-existing" + +before: + hooks: + - go mod tidy + +builds: + - <<: &build_defaults + binary: bin/tasker + main: ./cmd/tasker + ldflags: + - -X main.Version={{.Version}} + env: + - CGO_ENABLED=0 + id: macOS + goos: [darwin] + goarch: [amd64, arm64] + + - <<: *build_defaults + id: linux + goos: [linux] + goarch: [386, arm, amd64, arm64] + + - <<: *build_defaults + id: windows + goos: [windows] + goarch: [amd64] + +archives: + - id: nix + builds: [macOS, linux] + <<: &archive_defaults + name_template: "{{ .ProjectName }}_{{ .Version }}_{{ .Os }}_{{ .Arch }}{{ if .Arm }}v{{ .Arm }}{{ end }}" + wrap_in_directory: true + rlcp: true + format: tar.gz + files: + - LICENSE + + - id: windows + builds: [windows] + <<: *archive_defaults + wrap_in_directory: false + format: zip + files: + - LICENSE + +checksum: + name_template: 'checksums.txt' + algorithm: sha256 + +changelog: + skip: true + use: github + sort: desc + filters: + exclude: + - '^doc:' + - '^dev:' + - '^build:' + - '^ci:' diff --git a/vendor/github.com/adhocore/gronx/README.md b/vendor/github.com/adhocore/gronx/README.md index 59edd0aa..6093eb44 100644 --- a/vendor/github.com/adhocore/gronx/README.md +++ b/vendor/github.com/adhocore/gronx/README.md @@ -6,16 +6,16 @@ [![Test](https://github.com/adhocore/gronx/actions/workflows/test-action.yml/badge.svg)](https://github.com/adhocore/gronx/actions/workflows/test-action.yml) [![Lint](https://github.com/adhocore/gronx/actions/workflows/lint-action.yml/badge.svg)](https://github.com/adhocore/gronx/actions/workflows/lint-action.yml) [![Codecov](https://img.shields.io/codecov/c/github/adhocore/gronx/main.svg?style=flat-square)](https://codecov.io/gh/adhocore/gronx) -[![Donate 15](https://img.shields.io/badge/donate-paypal-blue.svg?style=flat-square&label=donate+15)](https://www.paypal.me/ji10/15usd) -[![Donate 25](https://img.shields.io/badge/donate-paypal-blue.svg?style=flat-square&label=donate+25)](https://www.paypal.me/ji10/25usd) -[![Donate 50](https://img.shields.io/badge/donate-paypal-blue.svg?style=flat-square&label=donate+50)](https://www.paypal.me/ji10/50usd) +[![Support](https://img.shields.io/static/v1?label=Support&message=%E2%9D%A4&logo=GitHub)](https://github.com/sponsors/adhocore) [![Tweet](https://img.shields.io/twitter/url/http/shields.io.svg?style=social)](https://twitter.com/intent/tweet?text=Lightweight+fast+and+deps+free+cron+expression+parser+for+Golang&url=https://github.com/adhocore/gronx&hashtags=go,golang,parser,cron,cronexpr,cronparser) -`gronx` is Golang cron expression parser ported from [adhocore/cron-expr](https://github.com/adhocore/php-cron-expr) with task runner +`gronx` is Golang [cron expression](#cron-expression) parser ported from [adhocore/cron-expr](https://github.com/adhocore/php-cron-expr) with task runner and daemon that supports crontab like task list file. Use it programatically in Golang or as standalone binary instead of crond. - Zero dependency. - Very **fast** because it bails early in case a segment doesn't match. +- Built in crontab like daemon. +- Supports time granularity of Seconds. Find gronx in [pkg.go.dev](https://pkg.go.dev/github.com/adhocore/gronx). @@ -47,9 +47,32 @@ gron.IsDue(expr) // true|false, nil gron.IsDue(expr, time.Date(2021, time.April, 1, 1, 1, 0, 0, time.UTC)) // true|false, nil ``` +### Batch Due Check + +If you have multiple cron expressions to check due on same reference time use `BatchDue()`: +```go +gron := gronx.New() +exprs := []string{"* * * * *", "0 */5 * * * *"} + +// gives []gronx.Expr{} array, each item has Due flag and Err enountered. +dues := gron.BatchDue(exprs) + +for _, expr := range dues { + if expr.Err != nil { + // Handle err + } else if expr.Due { + // Handle due + } +} + +// Or with given time +ref := time.Now() +gron.BatchDue(exprs, ref) +``` + ### Next Tick -To find out when is the cron due next (onwards): +To find out when is the cron due next (in near future): ```go allowCurrent = true // includes current time as well nextTime, err := gron.NextTick(expr, allowCurrent) // gives time.Time, error @@ -60,11 +83,26 @@ allowCurrent = false // excludes the ref time nextTime, err := gron.NextTickAfter(expr, refTime, allowCurrent) // gives time.Time, error ``` +### Prev Tick + +To find out when was the cron due previously (in near past): +```go +allowCurrent = true // includes current time as well +prevTime, err := gron.PrevTick(expr, allowCurrent) // gives time.Time, error + +// OR, prev tick before certain reference time +refTime = time.Date(2022, time.November, 1, 1, 1, 0, 0, time.UTC) +allowCurrent = false // excludes the ref time +nextTime, err := gron.PrevTickBefore(expr, refTime, allowCurrent) // gives time.Time, error +``` + +> The working of `PrevTick*()` and `NextTick*()` are mostly the same except the direction. +> They differ in lookback or lookahead. + ### Standalone Daemon In a more practical level, you would use this tool to manage and invoke jobs in app itself and not -mess around with `crontab` for each and every new tasks/jobs. ~~It doesn't yet replace that but rather supplements it. -There is a plan though [#1](https://github.com/adhocore/gronx/issues/1)~~. +mess around with `crontab` for each and every new tasks/jobs. In crontab just put one entry with `* * * * *` which points to your Go entry point that uses this tool. Then in that entry point you would invoke different tasks if the corresponding Cron expr is due. @@ -75,7 +113,7 @@ Check the section below for more sophisticated way of managing tasks automatical --- ### Go Tasker -Tasker is a task manager that can be programatically used in Golang applications. It runs as a daemon and and invokes tasks scheduled with cron expression: +Tasker is a task manager that can be programatically used in Golang applications. It runs as a daemon and invokes tasks scheduled with cron expression: ```go package main @@ -108,8 +146,12 @@ func main() { return 0, nil }) + // run task without overlap, set concurrent flag to false: + concurrent := false + taskr.Task("* * * * * *", , tasker.Taskify("sleep 2", tasker.Option{}), concurrent) + // every 10 minute with arbitrary command - taskr.Task("@10minutes", taskr.Taskify("command --option val -- args")) + taskr.Task("@10minutes", taskr.Taskify("command --option val -- args", tasker.Option{Shell: "/bin/sh -c"})) // ... add more tasks @@ -122,14 +164,31 @@ func main() { } ``` +#### Concurrency + +By default the tasks can run concurrently i.e if previous run is still not finished +but it is now due again, it will run again. +If you want to run only one instance of a task at a time, set concurrent flag to false: + +```go +taskr := tasker.New(tasker.Option{}) + +concurrent := false +expr, task := "* * * * * *", tasker.Taskify("php -r 'sleep(2);'") +taskr.Task(expr, task, concurrent) +``` + ### Task Daemon + It can also be used as standalone task daemon instead of programmatic usage for Golang application. First, just install tasker command: ```sh -go get -u github.com/adhocore/gronx/cmd/tasker +go install github.com/adhocore/gronx/cmd/tasker@latest ``` +Or you can also download latest prebuilt binary from [release](https://github.com/adhocore/gronx/releases/latest) for platform of your choice. + Then prepare a taskfile ([example](./tests/../test/taskfile.txt)) in crontab format (or can even point to existing crontab). > `user` is not supported: it is just cron expr followed by the command. @@ -141,6 +200,7 @@ tasker -file path/to/taskfile > You can pass more options to control the behavior of task daemon, see below. #### Tasker command options: + ```txt -file string <required> The task file in crontab format @@ -169,6 +229,7 @@ tasker -tz America/New_York -file path/to/taskfile -shell zsh # run all tasks us > Same timezone applies for all tasks currently and it might support overriding timezone per task in future release. #### Notes on Windows + In Windows if it doesn't find `bash.exe` or `git-bash.exe` it will use `powershell`. `powershell` may not be compatible with Unix flavored commands. Also to note: you can't do chaining with `cmd1 && cmd2` but rather `cmd1 ; cmd2`. @@ -176,29 +237,40 @@ you can't do chaining with `cmd1 && cmd2` but rather `cmd1 ; cmd2`. --- ### Cron Expression -Cron expression normally consists of 5 segments viz: +A complete cron expression consists of 7 segments viz: +``` +<second> <minute> <hour> <day> <month> <weekday> <year> +``` + +However only 5 will do and this is most commonly used. 5 segments are interpreted as: ``` <minute> <hour> <day> <month> <weekday> ``` -and sometimes there can be 6th segment for `<year>` at the end. +in which case a default value of 0 is prepended for `<second>` position. -For each segments you can have multiple choices separated by comma: -> Eg: `0,30 * * * *` means either 0th or 30th minute. +In a 6 segments expression, if 6th segment matches `<year>` (i.e 4 digits at least) it will be interpreted as: +``` +<minute> <hour> <day> <month> <weekday> <year> +``` +and a default value of 0 is prepended for `<second>` position. -To specify range of values you can use dash: -> Eg: `10-15 * * * *` means 10th, 11th, 12th, 13th, 14th and 15th minute. +For each segments you can have **multiple choices** separated by comma: +> Eg: `0 0,30 * * * *` means either 0th or 30th minute. -To specify range of step you can combine a dash and slash: -> Eg: `10-15/2 * * * *` means every 2 minutes between 10 and 15 i.e 10th, 12th and 14th minute. +To specify **range of values** you can use dash: +> Eg: `0 10-15 * * * *` means 10th, 11th, 12th, 13th, 14th and 15th minute. -For the 3rd and 5th segment, there are additional [modifiers](#modifiers) (optional). +To specify **range of step** you can combine a dash and slash: +> Eg: `0 10-15/2 * * * *` means every 2 minutes between 10 and 15 i.e 10th, 12th and 14th minute. -And if you want, you can mix them up: -> `5,12-20/4,55 * * * *` matches if any one of `5` or `12-20/4` or `55` matches the minute. +For the `<day>` and `<weekday>` segment, there are additional [**modifiers**](#modifiers) (optional). + +And if you want, you can mix the multiple choices, ranges and steps in a single expression: +> `0 5,12-20/4,55 * * * *` matches if any one of `5` or `12-20/4` or `55` matches the minute. ### Real Abbreviations -You can use real abbreviations for month and week days. eg: `JAN`, `dec`, `fri`, `SUN` +You can use real abbreviations (3 chars) for month and week days. eg: `JAN`, `dec`, `fri`, `SUN` ### Tags @@ -214,8 +286,13 @@ Following tags are available and they are converted to real cron expressions bef - *@15minutes* - every 15 minutes - *@30minutes* - every 30 minutes - *@always* - every minute +- *@everysecond* - every second + +> For BC reasons, `@always` still means every minute for now, in future release it may mean every seconds instead. ```go +// Use tags like so: +gron.IsDue("@hourly") gron.IsDue("@5minutes") ``` @@ -223,10 +300,10 @@ gron.IsDue("@5minutes") Following modifiers supported -- *Day of Month / 3rd segment:* +- *Day of Month / 3rd of 5 segments / 4th of 6+ segments:* - `L` stands for last day of month (eg: `L` could mean 29th for February in leap year) - `W` stands for closest week day (eg: `10W` is closest week days (MON-FRI) to 10th date) -- *Day of Week / 5th segment:* +- *Day of Week / 5th of 5 segments / 6th of 6+ segments:* - `L` stands for last weekday of month (eg: `2L` is last monday) - `#` stands for nth day of week in the month (eg: `1#2` is second sunday) @@ -242,9 +319,10 @@ release managed by [please](https://github.com/adhocore/please). --- ### Other projects + My other golang projects you might find interesting and useful: - [**urlsh**](https://github.com/adhocore/urlsh) - URL shortener and bookmarker service with UI, API, Cache, Hits Counter and forwarder using postgres and redis in backend, bulma in frontend; has [web](https://urlssh.xyz) and cli client - [**fast**](https://github.com/adhocore/fast) - Check your internet speed with ease and comfort right from the terminal - [**goic**](https://github.com/adhocore/goic) - Go Open ID Connect, is OpenID connect client library for Golang, supports the Authorization Code Flow of OpenID Connect specification. -- [**chin**](https://github.com/adhocore/chin) - A GO lang command line tool to show a spinner as user waits for some long running jobs to finish. +- [**chin**](https://github.com/adhocore/chin) - A Go lang command line tool to show a spinner as user waits for some long running jobs to finish. diff --git a/vendor/github.com/adhocore/gronx/batch.go b/vendor/github.com/adhocore/gronx/batch.go new file mode 100644 index 00000000..63d85ec2 --- /dev/null +++ b/vendor/github.com/adhocore/gronx/batch.go @@ -0,0 +1,51 @@ +package gronx + +import ( + "strings" + "time" +) + +// Expr represents an item in array for batch check +type Expr struct { + Expr string + Due bool + Err error +} + +// BatchDue checks if multiple expressions are due for given time (or now). +// It returns []Expr with filled in Due and Err values. +func (g *Gronx) BatchDue(exprs []string, ref ...time.Time) []Expr { + ref = append(ref, time.Now()) + g.C.SetRef(ref[0]) + + var segs []string + + cache, batch := map[string]Expr{}, make([]Expr, len(exprs)) + for i := range exprs { + batch[i].Expr = exprs[i] + segs, batch[i].Err = Segments(exprs[i]) + key := strings.Join(segs, " ") + if batch[i].Err != nil { + cache[key] = batch[i] + continue + } + + if c, ok := cache[key]; ok { + batch[i] = c + batch[i].Expr = exprs[i] + continue + } + + due := true + for pos, seg := range segs { + if seg != "*" && seg != "?" { + if due, batch[i].Err = g.C.CheckDue(seg, pos); !due || batch[i].Err != nil { + break + } + } + } + batch[i].Due = due + cache[key] = batch[i] + } + return batch +} diff --git a/vendor/github.com/adhocore/gronx/checker.go b/vendor/github.com/adhocore/gronx/checker.go index 46988d4a..78fd0cca 100644 --- a/vendor/github.com/adhocore/gronx/checker.go +++ b/vendor/github.com/adhocore/gronx/checker.go @@ -1,6 +1,7 @@ package gronx import ( + "fmt" "strconv" "strings" "time" @@ -30,26 +31,25 @@ func (c *SegmentChecker) SetRef(ref time.Time) { // CheckDue checks if the cron segment at given position is due. // It returns bool or error if any. -func (c *SegmentChecker) CheckDue(segment string, pos int) (bool, error) { +func (c *SegmentChecker) CheckDue(segment string, pos int) (due bool, err error) { ref, last := c.GetRef(), -1 val, loc := valueByPos(ref, pos), ref.Location() + isMonth, isWeekDay := pos == 3, pos == 5 for _, offset := range strings.Split(segment, ",") { - mod := pos == 2 || pos == 4 - due, err := c.isOffsetDue(offset, val, pos) - - if due || (!mod && err != nil) { - return due, err + mod := (isMonth || isWeekDay) && strings.ContainsAny(offset, "LW#") + if due, err = c.isOffsetDue(offset, val, pos); due || (!mod && err != nil) { + return } - if mod && !strings.ContainsAny(offset, "LW#") { + if !mod { continue } if last == -1 { last = time.Date(ref.Year(), ref.Month(), 1, 0, 0, 0, 0, loc).AddDate(0, 1, 0).Add(-time.Nanosecond).Day() } - if pos == 2 { + if isMonth { due, err = isValidMonthDay(offset, last, ref) - } else if pos == 4 { + } else if isWeekDay { due, err = isValidWeekDay(offset, last, ref) } if due || err != nil { @@ -64,17 +64,19 @@ func (c *SegmentChecker) isOffsetDue(offset string, val, pos int) (bool, error) if offset == "*" || offset == "?" { return true, nil } + + bounds, isWeekDay := boundsByPos(pos), pos == 5 if strings.Contains(offset, "/") { - return inStep(val, offset) + return inStep(val, offset, bounds) } if strings.Contains(offset, "-") { - if pos == 4 { + if isWeekDay { offset = strings.Replace(offset, "7-", "0-", 1) } - return inRange(val, offset) + return inRange(val, offset, bounds) } - if pos != 4 && (val == 0 || offset == "0") { + if !isWeekDay && (val == 0 || offset == "0") { return offset == "0" && val == 0, nil } @@ -82,29 +84,48 @@ func (c *SegmentChecker) isOffsetDue(offset string, val, pos int) (bool, error) if err != nil { return false, err } - - if pos == 4 && nval == 7 { - nval = 0 + if nval < bounds[0] || nval > bounds[1] { + return false, fmt.Errorf("segment#%d: '%s' out of bounds(%d, %d)", pos, offset, bounds[0], bounds[1]) } - return nval == val, nil + return nval == val || (isWeekDay && nval == 7 && val == 0), nil } -func valueByPos(ref time.Time, pos int) int { +func valueByPos(ref time.Time, pos int) (val int) { switch pos { case 0: - return ref.Minute() + val = ref.Second() case 1: - return ref.Hour() + val = ref.Minute() case 2: - return ref.Day() + val = ref.Hour() case 3: - return int(ref.Month()) + val = ref.Day() case 4: - return int(ref.Weekday()) + val = int(ref.Month()) case 5: - return ref.Year() + val = int(ref.Weekday()) + case 6: + val = ref.Year() } - - return 0 + return +} + +func boundsByPos(pos int) (bounds []int) { + bounds = []int{0, 0} + switch pos { + case 0, 1: + bounds = []int{0, 59} + case 2: + bounds = []int{0, 23} + case 3: + bounds = []int{1, 31} + case 4: + bounds = []int{1, 12} + case 5: + bounds = []int{0, 7} + case 6: + bounds = []int{1, 9999} + } + return } diff --git a/vendor/github.com/adhocore/gronx/gronx.go b/vendor/github.com/adhocore/gronx/gronx.go index 4b57da2a..f86f904d 100644 --- a/vendor/github.com/adhocore/gronx/gronx.go +++ b/vendor/github.com/adhocore/gronx/gronx.go @@ -25,10 +25,13 @@ var expressions = map[string]string{ "@10minutes": "*/10 * * * *", "@15minutes": "*/15 * * * *", "@30minutes": "0,30 * * * *", + + "@everysecond": "* * * * * *", } // SpaceRe is regex for whitespace. var SpaceRe = regexp.MustCompile(`\s+`) +var yearRe = regexp.MustCompile(`\d{4}`) func normalize(expr string) []string { expr = strings.Trim(expr, " \t") @@ -55,11 +58,8 @@ func New() Gronx { // IsDue checks if cron expression is due for given reference time (or now). // It returns bool or error if any. func (g *Gronx) IsDue(expr string, ref ...time.Time) (bool, error) { - if len(ref) > 0 { - g.C.SetRef(ref[0]) - } else { - g.C.SetRef(time.Now()) - } + ref = append(ref, time.Now()) + g.C.SetRef(ref[0]) segs, err := Segments(expr) if err != nil { @@ -69,12 +69,25 @@ func (g *Gronx) IsDue(expr string, ref ...time.Time) (bool, error) { return g.SegmentsDue(segs) } +func (g *Gronx) isDue(expr string, ref time.Time) bool { + due, err := g.IsDue(expr, ref) + return err == nil && due +} + // Segments splits expr into array array of cron parts. +// If expression contains 5 parts or 6th part is year like, it prepends a second. // It returns array or error. func Segments(expr string) ([]string, error) { segs := normalize(expr) - if len(segs) < 5 || len(segs) > 6 { - return []string{}, errors.New("expr should contain 5-6 segments separated by space") + slen := len(segs) + if slen < 5 || slen > 7 { + return []string{}, errors.New("expr should contain 5-7 segments separated by space") + } + + // Prepend second if required + prepend := slen == 5 || (slen == 6 && yearRe.MatchString(segs[5])) + if prepend { + segs = append([]string{"0"}, segs...) } return segs, nil @@ -82,8 +95,8 @@ func Segments(expr string) ([]string, error) { // SegmentsDue checks if all cron parts are due. // It returns bool. You should use IsDue(expr) instead. -func (g *Gronx) SegmentsDue(segments []string) (bool, error) { - for pos, seg := range segments { +func (g *Gronx) SegmentsDue(segs []string) (bool, error) { + for pos, seg := range segs { if seg == "*" || seg == "?" { continue } @@ -99,7 +112,17 @@ func (g *Gronx) SegmentsDue(segments []string) (bool, error) { // IsValid checks if cron expression is valid. // It returns bool. func (g *Gronx) IsValid(expr string) bool { - _, err := g.IsDue(expr) + segs, err := Segments(expr) + if err != nil { + return false + } - return err == nil + g.C.SetRef(time.Now()) + for pos, seg := range segs { + if _, err := g.C.CheckDue(seg, pos); err != nil { + return false + } + } + + return true } diff --git a/vendor/github.com/adhocore/gronx/next.go b/vendor/github.com/adhocore/gronx/next.go index 7700fe91..9b940ffb 100644 --- a/vendor/github.com/adhocore/gronx/next.go +++ b/vendor/github.com/adhocore/gronx/next.go @@ -22,58 +22,64 @@ func NextTick(expr string, inclRefTime bool) (time.Time, error) { // NextTickAfter gives next run time from the provided time.Time func NextTickAfter(expr string, start time.Time, inclRefTime bool) (time.Time, error) { - gron, next := New(), start.Truncate(time.Minute) + gron, next := New(), start.Truncate(time.Second) due, err := gron.IsDue(expr, start) if err != nil || (due && inclRefTime) { return start, err } segments, _ := Segments(expr) - if len(segments) > 5 && isPastYear(segments[5], next, inclRefTime) { - return next, fmt.Errorf("unreachable year segment: %s", segments[5]) + if len(segments) > 6 && isUnreachableYear(segments[6], next, inclRefTime, false) { + return next, fmt.Errorf("unreachable year segment: %s", segments[6]) } - if next, err = loop(gron, segments, next, inclRefTime); err != nil { - // Ignore superfluous err - if due, _ = gron.IsDue(expr, next); due { - err = nil - } + next, err = loop(gron, segments, next, inclRefTime, false) + // Ignore superfluous err + if err != nil && gron.isDue(expr, next) { + err = nil } return next, err } -func loop(gron Gronx, segments []string, start time.Time, incl bool) (next time.Time, err error) { - iter, next, bumped := 1000, start, false +func loop(gron Gronx, segments []string, start time.Time, incl bool, reverse bool) (next time.Time, err error) { + iter, next, bumped := 500, start, false +over: for iter > 0 { - over: iter-- for pos, seg := range segments { if seg == "*" || seg == "?" { continue } - if next, bumped, err = bumpUntilDue(gron.C, seg, pos, next); bumped { + if next, bumped, err = bumpUntilDue(gron.C, seg, pos, next, reverse); bumped { goto over } } - if !incl && next.Format(CronDateFormat) == start.Format(CronDateFormat) { - next, _, err = bumpUntilDue(gron.C, segments[0], 0, next.Add(time.Minute)) + if !incl && next.Format(FullDateFormat) == start.Format(FullDateFormat) { + delta := time.Second + if reverse { + delta = -time.Second + } + next, _, err = bumpUntilDue(gron.C, segments[0], 0, next.Add(delta), reverse) continue } - return next, err + return } return start, errors.New("tried so hard") } var dashRe = regexp.MustCompile(`/.*$`) -func isPastYear(year string, ref time.Time, incl bool) bool { +func isUnreachableYear(year string, ref time.Time, incl bool, reverse bool) bool { if year == "*" || year == "?" { return false } - min := ref.Year() + edge, inc := ref.Year(), 1 if !incl { - min++ + if reverse { + inc = -1 + } + edge += inc } for _, offset := range strings.Split(year, ",") { if strings.Index(offset, "*/") == 0 || strings.Index(offset, "0/") == 0 { @@ -81,7 +87,7 @@ func isPastYear(year string, ref time.Time, incl bool) bool { } for _, part := range strings.Split(dashRe.ReplaceAllString(offset, ""), "-") { val, err := strconv.Atoi(part) - if err != nil || val >= min { + if err != nil || (!reverse && val >= edge) || (reverse && val < edge) { return false } } @@ -89,34 +95,41 @@ func isPastYear(year string, ref time.Time, incl bool) bool { return true } -var limit = map[int]int{0: 60, 1: 24, 2: 31, 3: 12, 4: 366, 5: 100} +var limit = map[int]int{0: 60, 1: 60, 2: 24, 3: 31, 4: 12, 5: 366, 6: 100} -func bumpUntilDue(c Checker, segment string, pos int, ref time.Time) (time.Time, bool, error) { - // <minute> <hour> <day> <month> <weekday> +func bumpUntilDue(c Checker, segment string, pos int, ref time.Time, reverse bool) (time.Time, bool, error) { + // <second> <minute> <hour> <day> <month> <weekday> <year> iter := limit[pos] for iter > 0 { c.SetRef(ref) if ok, _ := c.CheckDue(segment, pos); ok { return ref, iter != limit[pos], nil } - ref = bump(ref, pos) + ref = bump(ref, pos, reverse) iter-- } return ref, false, errors.New("tried so hard") } -func bump(ref time.Time, pos int) time.Time { +func bump(ref time.Time, pos int, reverse bool) time.Time { + factor := 1 + if reverse { + factor = -1 + } + switch pos { case 0: - ref = ref.Add(time.Minute) + ref = ref.Add(time.Duration(factor) * time.Second) case 1: - ref = ref.Add(time.Hour) - case 2, 4: - ref = ref.AddDate(0, 0, 1) - case 3: - ref = ref.AddDate(0, 1, 0) - case 5: - ref = ref.AddDate(1, 0, 0) + ref = ref.Add(time.Duration(factor) * time.Minute) + case 2: + ref = ref.Add(time.Duration(factor) * time.Hour) + case 3, 5: + ref = ref.AddDate(0, 0, factor) + case 4: + ref = ref.AddDate(0, factor, 0) + case 6: + ref = ref.AddDate(factor, 0, 0) } return ref } diff --git a/vendor/github.com/adhocore/gronx/prev.go b/vendor/github.com/adhocore/gronx/prev.go new file mode 100644 index 00000000..d900bf73 --- /dev/null +++ b/vendor/github.com/adhocore/gronx/prev.go @@ -0,0 +1,32 @@ +package gronx + +import ( + "fmt" + "time" +) + +// PrevTick gives previous run time before now +func PrevTick(expr string, inclRefTime bool) (time.Time, error) { + return PrevTickBefore(expr, time.Now(), inclRefTime) +} + +// PrevTickBefore gives previous run time before given reference time +func PrevTickBefore(expr string, start time.Time, inclRefTime bool) (time.Time, error) { + gron, prev := New(), start.Truncate(time.Second) + due, err := gron.IsDue(expr, start) + if err != nil || (due && inclRefTime) { + return prev, err + } + + segments, _ := Segments(expr) + if len(segments) > 6 && isUnreachableYear(segments[6], prev, inclRefTime, true) { + return prev, fmt.Errorf("unreachable year segment: %s", segments[6]) + } + + prev, err = loop(gron, segments, prev, inclRefTime, true) + // Ignore superfluous err + if err != nil && gron.isDue(expr, prev) { + err = nil + } + return prev, err +} diff --git a/vendor/github.com/adhocore/gronx/validator.go b/vendor/github.com/adhocore/gronx/validator.go index 074415b8..d772ad7f 100644 --- a/vendor/github.com/adhocore/gronx/validator.go +++ b/vendor/github.com/adhocore/gronx/validator.go @@ -2,12 +2,13 @@ package gronx import ( "errors" + "fmt" "strconv" "strings" "time" ) -func inStep(val int, s string) (bool, error) { +func inStep(val int, s string, bounds []int) (bool, error) { parts := strings.Split(s, "/") step, err := strconv.Atoi(parts[1]) if err != nil { @@ -34,10 +35,14 @@ func inStep(val int, s string) (bool, error) { } } + if (len(sub) > 1 && end < start) || start < bounds[0] || end > bounds[1] { + return false, fmt.Errorf("step '%s' out of bounds(%d, %d)", parts[0], bounds[0], bounds[1]) + } + return inStepRange(val, start, end, step), nil } -func inRange(val int, s string) (bool, error) { +func inRange(val int, s string, bounds []int) (bool, error) { parts := strings.Split(s, "-") start, err := strconv.Atoi(parts[0]) if err != nil { @@ -49,6 +54,10 @@ func inRange(val int, s string) (bool, error) { return false, err } + if end < start || start < bounds[0] || end > bounds[1] { + return false, fmt.Errorf("range '%s' out of bounds(%d, %d)", s, bounds[0], bounds[1]) + } + return start <= val && val <= end, nil } @@ -61,7 +70,7 @@ func inStepRange(val, start, end, step int) bool { return false } -func isValidMonthDay(val string, last int, ref time.Time) (bool, error) { +func isValidMonthDay(val string, last int, ref time.Time) (valid bool, err error) { day, loc := ref.Day(), ref.Location() if val == "L" { return day == last, nil @@ -84,12 +93,13 @@ func isValidMonthDay(val string, last int, ref time.Time) (bool, error) { week := int(iref.Weekday()) if week > 0 && week < 6 && iref.Month() == ref.Month() { - return day == iref.Day(), nil + valid = day == iref.Day() + break } } } - return false, nil + return valid, nil } func isValidWeekDay(val string, last int, ref time.Time) (bool, error) { diff --git a/vendor/github.com/caddyserver/certmagic/README.md b/vendor/github.com/caddyserver/certmagic/README.md index b60f0130..691fca81 100644 --- a/vendor/github.com/caddyserver/certmagic/README.md +++ b/vendor/github.com/caddyserver/certmagic/README.md @@ -238,16 +238,17 @@ if err != nil { For more control (particularly, if you need a different way of managing each certificate), you'll make and use a `Cache` and a `Config` like so: ```go -cache := certmagic.NewCache(certmagic.CacheOptions{ +// First make a pointer to a Cache as we need to reference the same Cache in +// GetConfigForCert below. +var cache *certmagic.Cache +cache = certmagic.NewCache(certmagic.CacheOptions{ GetConfigForCert: func(cert certmagic.Certificate) (*certmagic.Config, error) { - // do whatever you need to do to get the right - // configuration for this certificate; keep in - // mind that this config value is used as a - // template, and will be completed with any - // defaults that are set in the Default config - return &certmagic.Config{ + // Here we use New to get a valid Config associated with the same cache. + // The provided Config is used as a template and will be completed with + // any defaults that are set in the Default config. + return certmagic.New(cache, &certmagic.config{ // ... - }, nil + }), nil }, ... }) diff --git a/vendor/github.com/caddyserver/certmagic/acmeissuer.go b/vendor/github.com/caddyserver/certmagic/acmeissuer.go index 83073b5c..e930878b 100644 --- a/vendor/github.com/caddyserver/certmagic/acmeissuer.go +++ b/vendor/github.com/caddyserver/certmagic/acmeissuer.go @@ -115,6 +115,10 @@ type ACMEIssuer struct { // desired, set this to zap.NewNop(). Logger *zap.Logger + // Set a http proxy to use when issuing a certificate. + // Default is http.ProxyFromEnvironment + HTTPProxy func(*http.Request) (*url.URL, error) + config *Config httpClient *http.Client @@ -204,6 +208,13 @@ func NewACMEIssuer(cfg *Config, template ACMEIssuer) *ACMEIssuer { template.Logger = defaultLogger } + if template.HTTPProxy == nil { + template.HTTPProxy = DefaultACME.HTTPProxy + } + if template.HTTPProxy == nil { + template.HTTPProxy = http.ProxyFromEnvironment + } + template.config = cfg template.mu = new(sync.Mutex) @@ -223,7 +234,7 @@ func NewACMEIssuer(cfg *Config, template ACMEIssuer) *ACMEIssuer { } } transport := &http.Transport{ - Proxy: http.ProxyFromEnvironment, + Proxy: template.HTTPProxy, DialContext: dialer.DialContext, TLSHandshakeTimeout: 30 * time.Second, // increase to 30s requested in #175 ResponseHeaderTimeout: 30 * time.Second, // increase to 30s requested in #175 @@ -506,9 +517,10 @@ type ChainPreference struct { // DefaultACME specifies default settings to use for ACMEIssuers. // Using this value is optional but can be convenient. var DefaultACME = ACMEIssuer{ - CA: LetsEncryptProductionCA, - TestCA: LetsEncryptStagingCA, - Logger: defaultLogger, + CA: LetsEncryptProductionCA, + TestCA: LetsEncryptStagingCA, + Logger: defaultLogger, + HTTPProxy: http.ProxyFromEnvironment, } // Some well-known CA endpoints available to use. diff --git a/vendor/github.com/caddyserver/certmagic/cache.go b/vendor/github.com/caddyserver/certmagic/cache.go index f5ab8684..a28021cc 100644 --- a/vendor/github.com/caddyserver/certmagic/cache.go +++ b/vendor/github.com/caddyserver/certmagic/cache.go @@ -145,7 +145,8 @@ type CacheOptions struct { // used for managing a certificate, or for accessing // that certificate's asset storage (e.g. for // OCSP staples, etc). The returned Config MUST - // be associated with the same Cache as the caller. + // be associated with the same Cache as the caller, + // use New to obtain a valid Config. // // The reason this is a callback function, dynamically // returning a Config (instead of attaching a static @@ -197,14 +198,29 @@ func (certCache *Cache) cacheCertificate(cert Certificate) { // This function is NOT safe for concurrent use. Callers MUST acquire // a write lock on certCache.mu first. func (certCache *Cache) unsyncedCacheCertificate(cert Certificate) { - // no-op if this certificate already exists in the cache - if _, ok := certCache.cache[cert.hash]; ok { - certCache.logger.Debug("certificate already cached", + // if this certificate already exists in the cache, this is basically + // a no-op so we reuse existing cert (prevent duplication), but we do + // modify the cert to add tags it may be missing (see issue #211) + if existingCert, ok := certCache.cache[cert.hash]; ok { + logMsg := "certificate already cached" + + if len(cert.Tags) > 0 { + for _, tag := range cert.Tags { + if !existingCert.HasTag(tag) { + existingCert.Tags = append(existingCert.Tags, tag) + } + } + certCache.cache[cert.hash] = existingCert + logMsg += "; appended any missing tags to cert" + } + + certCache.logger.Debug(logMsg, zap.Strings("subjects", cert.Names), zap.Time("expiration", expiresAt(cert.Leaf)), zap.Bool("managed", cert.managed), zap.String("issuer_key", cert.issuerKey), - zap.String("hash", cert.hash)) + zap.String("hash", cert.hash), + zap.Strings("tags", cert.Tags)) return } @@ -327,7 +343,11 @@ func (certCache *Cache) getConfig(cert Certificate) (*Config, error) { if err != nil { return nil, err } - if cfg.certCache != nil && cfg.certCache != certCache { + if cfg.certCache == nil { + return nil, fmt.Errorf("config returned for certificate %v has nil cache; expected %p (this one)", + cert.Names, certCache) + } + if cfg.certCache != certCache { return nil, fmt.Errorf("config returned for certificate %v is not nil and points to different cache; got %p, expected %p (this one)", cert.Names, cfg.certCache, certCache) } diff --git a/vendor/github.com/caddyserver/certmagic/certificates.go b/vendor/github.com/caddyserver/certmagic/certificates.go index 5f9d0c89..9e983406 100644 --- a/vendor/github.com/caddyserver/certmagic/certificates.go +++ b/vendor/github.com/caddyserver/certmagic/certificates.go @@ -113,6 +113,9 @@ func (cert Certificate) HasTag(tag string) bool { // resolution of ASN.1 UTCTime/GeneralizedTime by including the extra fraction // of a second of certificate validity beyond the NotAfter value. func expiresAt(cert *x509.Certificate) time.Time { + if cert == nil { + return time.Time{} + } return cert.NotAfter.Truncate(time.Second).Add(1 * time.Second) } diff --git a/vendor/github.com/caddyserver/certmagic/certmagic.go b/vendor/github.com/caddyserver/certmagic/certmagic.go index 9ee121dc..8200431f 100644 --- a/vendor/github.com/caddyserver/certmagic/certmagic.go +++ b/vendor/github.com/caddyserver/certmagic/certmagic.go @@ -270,7 +270,16 @@ type OnDemandConfig struct { // request will be denied. DecisionFunc func(name string) error - // List of whitelisted hostnames (SNI values) for + // Sources for getting new, unmanaged certificates. + // They will be invoked only during TLS handshakes + // before on-demand certificate management occurs, + // for certificates that are not already loaded into + // the in-memory cache. + // + // TODO: EXPERIMENTAL: subject to change and/or removal. + Managers []Manager + + // List of allowed hostnames (SNI values) for // deferred (on-demand) obtaining of certificates. // Used only by higher-level functions in this // package to persist the list of hostnames that @@ -282,15 +291,15 @@ type OnDemandConfig struct { // for higher-level convenience functions to be // able to retain their convenience (alternative // is: the user manually creates a DecisionFunc - // that whitelists the same names it already - // passed into Manage) and without letting clients - // have their run of any domain names they want. + // that allows the same names it already passed + // into Manage) and without letting clients have + // their run of any domain names they want. // Only enforced if len > 0. - hostWhitelist []string + hostAllowlist []string } -func (o *OnDemandConfig) whitelistContains(name string) bool { - for _, n := range o.hostWhitelist { +func (o *OnDemandConfig) allowlistContains(name string) bool { + for _, n := range o.hostAllowlist { if strings.EqualFold(n, name) { return true } @@ -433,7 +442,7 @@ type CertificateResource struct { // The unique string identifying the issuer of the // certificate; internally useful for storage access. - issuerKey string `json:"-"` + issuerKey string } // NamesKey returns the list of SANs as a single string, diff --git a/vendor/github.com/caddyserver/certmagic/config.go b/vendor/github.com/caddyserver/certmagic/config.go index 3cb11bb8..ddafa87e 100644 --- a/vendor/github.com/caddyserver/certmagic/config.go +++ b/vendor/github.com/caddyserver/certmagic/config.go @@ -72,6 +72,13 @@ type Config struct { // ClientHello's ServerName field is empty. DefaultServerName string + // FallbackServerName specifies a server name + // to use when choosing a certificate if the + // ClientHello's ServerName field doesn't match + // any available certificate. + // EXPERIMENTAL: Subject to change or removal. + FallbackServerName string + // The state needed to operate on-demand TLS; // if non-nil, on-demand TLS is enabled and // certificate operations are deferred to @@ -88,15 +95,6 @@ type Config struct { // turn until one succeeds. Issuers []Issuer - // Sources for getting new, unmanaged certificates. - // They will be invoked only during TLS handshakes - // before on-demand certificate management occurs, - // for certificates that are not already loaded into - // the in-memory cache. - // - // TODO: EXPERIMENTAL: subject to change and/or removal. - Managers []Manager - // The source of new private keys for certificates; // the default KeySource is StandardKeyGenerator. KeySource KeyGenerator @@ -119,6 +117,16 @@ type Config struct { // TLS assets. Default is the local file system. Storage Storage + // CertMagic will verify the storage configuration + // is acceptable before obtaining a certificate + // to avoid information loss after an expensive + // operation. If you are absolutely 100% sure your + // storage is properly configured and has sufficient + // space, you can disable this check to reduce I/O + // if that is expensive for you. + // EXPERIMENTAL: Option subject to change or removal. + DisableStorageCheck bool + // Set a logger to enable logging. If not set, // a default logger will be created. Logger *zap.Logger @@ -162,6 +170,7 @@ func NewDefault() *Config { GetConfigForCert: func(Certificate) (*Config, error) { return NewDefault(), nil }, + Logger: Default.Logger, }) } certCache := defaultCache @@ -209,10 +218,10 @@ func newWithCache(certCache *Cache, cfg Config) *Config { if !cfg.MustStaple { cfg.MustStaple = Default.MustStaple } - if len(cfg.Issuers) == 0 { + if cfg.Issuers == nil { cfg.Issuers = Default.Issuers - if len(cfg.Issuers) == 0 { - // at least one issuer is absolutely required + if cfg.Issuers == nil { + // at least one issuer is absolutely required if not nil cfg.Issuers = []Issuer{NewACMEIssuer(&cfg, DefaultACME)} } } @@ -228,6 +237,9 @@ func newWithCache(certCache *Cache, cfg Config) *Config { if cfg.DefaultServerName == "" { cfg.DefaultServerName = Default.DefaultServerName } + if cfg.FallbackServerName == "" { + cfg.FallbackServerName = Default.FallbackServerName + } if cfg.Storage == nil { cfg.Storage = Default.Storage } @@ -329,12 +341,13 @@ func (cfg *Config) manageAll(ctx context.Context, domainNames []string, async bo for _, domainName := range domainNames { // if on-demand is configured, defer obtain and renew operations if cfg.OnDemand != nil { - if !cfg.OnDemand.whitelistContains(domainName) { - cfg.OnDemand.hostWhitelist = append(cfg.OnDemand.hostWhitelist, domainName) + if !cfg.OnDemand.allowlistContains(domainName) { + cfg.OnDemand.hostAllowlist = append(cfg.OnDemand.hostAllowlist, domainName) } continue } + // TODO: consider doing this in a goroutine if async, to utilize multiple cores while loading certs // otherwise, begin management immediately err := cfg.manageOne(ctx, domainName, async) if err != nil { @@ -587,6 +600,7 @@ func (cfg *Config) obtainCert(ctx context.Context, name string, interactive bool CertificatePEM: issuedCert.Certificate, PrivateKeyPEM: privKeyPEM, IssuerData: issuedCert.Metadata, + issuerKey: issuerUsed.IssuerKey(), } err = cfg.saveCertResource(ctx, issuerUsed, certRes) if err != nil { @@ -812,6 +826,7 @@ func (cfg *Config) renewCert(ctx context.Context, name string, force, interactiv CertificatePEM: issuedCert.Certificate, PrivateKeyPEM: certRes.PrivateKeyPEM, IssuerData: issuedCert.Metadata, + issuerKey: issuerUsed.IssuerKey(), } err = cfg.saveCertResource(ctx, issuerUsed, newCertRes) if err != nil { @@ -1000,6 +1015,9 @@ func (cfg *Config) getChallengeInfo(ctx context.Context, identifier string) (Cha // comparing the loaded value. If this fails, the provided // cfg.Storage mechanism should not be used. func (cfg *Config) checkStorage(ctx context.Context) error { + if cfg.DisableStorageCheck { + return nil + } key := fmt.Sprintf("rw_test_%d", weakrand.Int()) contents := make([]byte, 1024*10) // size sufficient for one or two ACME resources _, err := weakrand.Read(contents) diff --git a/vendor/github.com/caddyserver/certmagic/dnsutil.go b/vendor/github.com/caddyserver/certmagic/dnsutil.go index a2b7866d..fc93dc2a 100644 --- a/vendor/github.com/caddyserver/certmagic/dnsutil.go +++ b/vendor/github.com/caddyserver/certmagic/dnsutil.go @@ -237,7 +237,7 @@ func checkDNSPropagation(fqdn, value string, resolvers []string) (bool, error) { // checkAuthoritativeNss queries each of the given nameservers for the expected TXT record. func checkAuthoritativeNss(fqdn, value string, nameservers []string) (bool, error) { for _, ns := range nameservers { - r, err := dnsQuery(fqdn, dns.TypeTXT, []string{net.JoinHostPort(ns, "53")}, false) + r, err := dnsQuery(fqdn, dns.TypeTXT, []string{net.JoinHostPort(ns, "53")}, true) if err != nil { return false, err } diff --git a/vendor/github.com/caddyserver/certmagic/handshake.go b/vendor/github.com/caddyserver/certmagic/handshake.go index d1697d54..6d28ddfc 100644 --- a/vendor/github.com/caddyserver/certmagic/handshake.go +++ b/vendor/github.com/caddyserver/certmagic/handshake.go @@ -42,9 +42,15 @@ import ( // 5. Issuers (if on-demand is enabled) // // This method is safe for use as a tls.Config.GetCertificate callback. +// +// GetCertificate will run in a new context, use GetCertificateWithContext to provide +// a context. func (cfg *Config) GetCertificate(clientHello *tls.ClientHelloInfo) (*tls.Certificate, error) { ctx := context.TODO() // TODO: get a proper context? from somewhere... + return cfg.GetCertificateWithContext(ctx, clientHello) +} +func (cfg *Config) GetCertificateWithContext(ctx context.Context, clientHello *tls.ClientHelloInfo) (*tls.Certificate, error) { if err := cfg.emit(ctx, "tls_get_certificate", map[string]any{"client_hello": clientHello}); err != nil { cfg.Logger.Error("TLS handshake aborted by event handler", zap.String("server_name", clientHello.ServerName), @@ -60,6 +66,7 @@ func (cfg *Config) GetCertificate(clientHello *tls.ClientHelloInfo) (*tls.Certif challengeCert, distributed, err := cfg.getTLSALPNChallengeCert(clientHello) if err != nil { cfg.Logger.Error("tls-alpn challenge", + zap.String("remote_addr", clientHello.Conn.RemoteAddr().String()), zap.String("server_name", clientHello.ServerName), zap.Error(err)) return nil, err @@ -74,7 +81,7 @@ func (cfg *Config) GetCertificate(clientHello *tls.ClientHelloInfo) (*tls.Certif } // get the certificate and serve it up - cert, err := cfg.getCertDuringHandshake(ctx, clientHello, true, true) + cert, err := cfg.getCertDuringHandshake(ctx, clientHello, true) return &cert.Certificate, err } @@ -136,6 +143,20 @@ func (cfg *Config) getCertificateFromCache(hello *tls.ClientHelloInfo) (cert Cer } } + // a fallback server name can be tried in the very niche + // case where a client sends one SNI value but expects or + // accepts a different one in return (this is sometimes + // the case with CDNs like Cloudflare that send the + // downstream ServerName in the handshake but accept + // the backend origin's true hostname in a cert). + if cfg.FallbackServerName != "" { + normFallback := normalizedName(cfg.FallbackServerName) + cert, defaulted = cfg.selectCert(hello, normFallback) + if defaulted { + return + } + } + // otherwise, we're bingo on ammo; see issues // caddyserver/caddy#2035 and caddyserver/caddy#1303 (any // change to certificate matching behavior must @@ -232,18 +253,19 @@ func DefaultCertificateSelector(hello *tls.ClientHelloInfo, choices []Certificat // An error will be returned if and only if no certificate is available. // // This function is safe for concurrent use. -func (cfg *Config) getCertDuringHandshake(ctx context.Context, hello *tls.ClientHelloInfo, loadIfNecessary, obtainIfNecessary bool) (Certificate, error) { - log := logWithRemote(cfg.Logger.Named("handshake"), hello) +func (cfg *Config) getCertDuringHandshake(ctx context.Context, hello *tls.ClientHelloInfo, loadOrObtainIfNecessary bool) (Certificate, error) { + logger := logWithRemote(cfg.Logger.Named("handshake"), hello) + name := cfg.getNameFromClientHello(hello) // First check our in-memory cache to see if we've already loaded it cert, matched, defaulted := cfg.getCertificateFromCache(hello) if matched { - log.Debug("matched certificate in cache", + logger.Debug("matched certificate in cache", zap.Strings("subjects", cert.Names), zap.Bool("managed", cert.managed), zap.Time("expiration", expiresAt(cert.Leaf)), zap.String("hash", cert.hash)) - if cert.managed && cfg.OnDemand != nil && obtainIfNecessary { + if cert.managed && cfg.OnDemand != nil && loadOrObtainIfNecessary { // On-demand certificates are maintained in the background, but // maintenance is triggered by handshakes instead of by a timer // as in maintain.go. @@ -252,9 +274,52 @@ func (cfg *Config) getCertDuringHandshake(ctx context.Context, hello *tls.Client return cert, nil } + // By this point, we need to load or obtain a certificate. If a swarm of requests comes in for the same + // domain, avoid pounding manager or storage thousands of times simultaneously. We do a similar sync + // strategy for obtaining certificate during handshake. + certLoadWaitChansMu.Lock() + wait, ok := certLoadWaitChans[name] + if ok { + // another goroutine is already loading the cert; just wait and we'll get it from the in-memory cache + certLoadWaitChansMu.Unlock() + + timeout := time.NewTimer(2 * time.Minute) // TODO: have Caddy use the context param to establish a timeout + select { + case <-timeout.C: + return Certificate{}, fmt.Errorf("timed out waiting to load certificate for %s", name) + case <-ctx.Done(): + timeout.Stop() + return Certificate{}, ctx.Err() + case <-wait: + timeout.Stop() + } + + return cfg.getCertDuringHandshake(ctx, hello, false) + } else { + // no other goroutine is currently trying to load this cert + wait = make(chan struct{}) + certLoadWaitChans[name] = wait + certLoadWaitChansMu.Unlock() + + // unblock others and clean up when we're done + defer func() { + certLoadWaitChansMu.Lock() + close(wait) + delete(certLoadWaitChans, name) + certLoadWaitChansMu.Unlock() + }() + } + + // Make sure a certificate is allowed for the given name. If not, it doesn't + // make sense to try loading one from storage (issue #185), getting it from a + // certificate manager, or obtaining one from an issuer. + if err := cfg.checkIfCertShouldBeObtained(name, false); err != nil { + return Certificate{}, fmt.Errorf("certificate is not allowed for server name %s: %v", name, err) + } + // If an external Manager is configured, try to get it from them. // Only continue to use our own logic if it returns empty+nil. - externalCert, err := cfg.getCertFromAnyCertManager(ctx, hello, log) + externalCert, err := cfg.getCertFromAnyCertManager(ctx, hello, logger) if err != nil { return Certificate{}, err } @@ -262,8 +327,6 @@ func (cfg *Config) getCertDuringHandshake(ctx context.Context, hello *tls.Client return externalCert, nil } - name := cfg.getNameFromClientHello(hello) - // We might be able to load or obtain a needed certificate. Load from // storage if OnDemand is enabled, or if there is the possibility that // a statically-managed cert was evicted from a full cache. @@ -282,42 +345,25 @@ func (cfg *Config) getCertDuringHandshake(ctx context.Context, hello *tls.Client cacheAlmostFull := cacheCapacity > 0 && float64(cacheSize) >= cacheCapacity*.9 loadDynamically := cfg.OnDemand != nil || cacheAlmostFull - if loadDynamically && loadIfNecessary { - // Then check to see if we have one on disk - // TODO: As suggested here, https://caddy.community/t/error-tls-alert-internal-error-592-again/13272/30?u=matt, - // it might be a good idea to check with the DecisionFunc or allowlist first before even loading the certificate - // from storage, since if we can't renew it, why should we even try serving it (it will just get evicted after - // we get a return value of false anyway)? See issue #174 - loadedCert, err := cfg.CacheManagedCertificate(ctx, name) - if errors.Is(err, fs.ErrNotExist) { - // If no exact match, try a wildcard variant, which is something we can still use - labels := strings.Split(name, ".") - labels[0] = "*" - loadedCert, err = cfg.CacheManagedCertificate(ctx, strings.Join(labels, ".")) - } + if loadDynamically && loadOrObtainIfNecessary { + // Check to see if we have one on disk + loadedCert, err := cfg.loadCertFromStorage(ctx, logger, hello) if err == nil { - log.Debug("loaded certificate from storage", - zap.Strings("subjects", loadedCert.Names), - zap.Bool("managed", loadedCert.managed), - zap.Time("expiration", expiresAt(loadedCert.Leaf)), - zap.String("hash", loadedCert.hash)) - loadedCert, err = cfg.handshakeMaintenance(ctx, hello, loadedCert) - if err != nil { - log.Error("maintaining newly-loaded certificate", - zap.String("server_name", name), - zap.Error(err)) - } return loadedCert, nil } - if cfg.OnDemand != nil && obtainIfNecessary { + logger.Debug("did not load cert from storage", + zap.String("server_name", hello.ServerName), + zap.Error(err)) + if cfg.OnDemand != nil { // By this point, we need to ask the CA for a certificate return cfg.obtainOnDemandCertificate(ctx, hello) } + return loadedCert, nil } - // Fall back to the default certificate if there is one + // Fall back to another certificate if there is one (either DefaultServerName or FallbackServerName) if defaulted { - log.Debug("fell back to default certificate", + logger.Debug("fell back to default certificate", zap.Strings("subjects", cert.Names), zap.Bool("managed", cert.managed), zap.Time("expiration", expiresAt(cert.Leaf)), @@ -325,19 +371,44 @@ func (cfg *Config) getCertDuringHandshake(ctx context.Context, hello *tls.Client return cert, nil } - log.Debug("no certificate matching TLS ClientHello", + logger.Debug("no certificate matching TLS ClientHello", zap.String("server_name", hello.ServerName), zap.String("remote", hello.Conn.RemoteAddr().String()), zap.String("identifier", name), zap.Uint16s("cipher_suites", hello.CipherSuites), zap.Float64("cert_cache_fill", float64(cacheSize)/cacheCapacity), // may be approximate! because we are not within the lock - zap.Bool("load_if_necessary", loadIfNecessary), - zap.Bool("obtain_if_necessary", obtainIfNecessary), + zap.Bool("load_or_obtain_if_necessary", loadOrObtainIfNecessary), zap.Bool("on_demand", cfg.OnDemand != nil)) return Certificate{}, fmt.Errorf("no certificate available for '%s'", name) } +func (cfg *Config) loadCertFromStorage(ctx context.Context, logger *zap.Logger, hello *tls.ClientHelloInfo) (Certificate, error) { + name := normalizedName(hello.ServerName) + loadedCert, err := cfg.CacheManagedCertificate(ctx, name) + if errors.Is(err, fs.ErrNotExist) { + // If no exact match, try a wildcard variant, which is something we can still use + labels := strings.Split(name, ".") + labels[0] = "*" + loadedCert, err = cfg.CacheManagedCertificate(ctx, strings.Join(labels, ".")) + } + if err != nil { + return Certificate{}, fmt.Errorf("no matching certificate to load for %s: %w", name, err) + } + logger.Debug("loaded certificate from storage", + zap.Strings("subjects", loadedCert.Names), + zap.Bool("managed", loadedCert.managed), + zap.Time("expiration", expiresAt(loadedCert.Leaf)), + zap.String("hash", loadedCert.hash)) + loadedCert, err = cfg.handshakeMaintenance(ctx, hello, loadedCert) + if err != nil { + logger.Error("maintaining newly-loaded certificate", + zap.String("server_name", name), + zap.Error(err)) + } + return loadedCert, nil +} + // optionalMaintenance will perform maintenance on the certificate (if necessary) and // will return the resulting certificate. This should only be done if the certificate // is managed, OnDemand is enabled, and the scope is allowed to obtain certificates. @@ -363,19 +434,23 @@ func (cfg *Config) optionalMaintenance(ctx context.Context, log *zap.Logger, cer // checkIfCertShouldBeObtained checks to see if an on-demand TLS certificate // should be obtained for a given domain based upon the config settings. If // a non-nil error is returned, do not issue a new certificate for name. -func (cfg *Config) checkIfCertShouldBeObtained(name string) error { - if cfg.OnDemand == nil { +func (cfg *Config) checkIfCertShouldBeObtained(name string, requireOnDemand bool) error { + if requireOnDemand && cfg.OnDemand == nil { return fmt.Errorf("not configured for on-demand certificate issuance") } if !SubjectQualifiesForCert(name) { return fmt.Errorf("subject name does not qualify for certificate: %s", name) } - if cfg.OnDemand.DecisionFunc != nil { - return cfg.OnDemand.DecisionFunc(name) - } - if len(cfg.OnDemand.hostWhitelist) > 0 && - !cfg.OnDemand.whitelistContains(name) { - return fmt.Errorf("certificate for '%s' is not managed", name) + if cfg.OnDemand != nil { + if cfg.OnDemand.DecisionFunc != nil { + if err := cfg.OnDemand.DecisionFunc(name); err != nil { + return fmt.Errorf("decision func: %w", err) + } + return nil + } + if len(cfg.OnDemand.hostAllowlist) > 0 && !cfg.OnDemand.allowlistContains(name) { + return fmt.Errorf("certificate for '%s' is not managed", name) + } } return nil } @@ -390,11 +465,6 @@ func (cfg *Config) obtainOnDemandCertificate(ctx context.Context, hello *tls.Cli name := cfg.getNameFromClientHello(hello) - getCertWithoutReobtaining := func() (Certificate, error) { - // very important to set the obtainIfNecessary argument to false, so we don't repeat this infinitely - return cfg.getCertDuringHandshake(ctx, hello, true, false) - } - // We must protect this process from happening concurrently, so synchronize. obtainCertWaitChansMu.Lock() wait, ok := obtainCertWaitChans[name] @@ -412,7 +482,7 @@ func (cfg *Config) obtainOnDemandCertificate(ctx context.Context, hello *tls.Cli timeout.Stop() } - return getCertWithoutReobtaining() + return cfg.loadCertFromStorage(ctx, log, hello) } // looks like it's up to us to do all the work and obtain the cert. @@ -428,13 +498,6 @@ func (cfg *Config) obtainOnDemandCertificate(ctx context.Context, hello *tls.Cli obtainCertWaitChansMu.Unlock() } - // Make sure the certificate should be obtained based on config - err := cfg.checkIfCertShouldBeObtained(name) - if err != nil { - unblockWaiters() - return Certificate{}, err - } - log.Info("obtaining new certificate", zap.String("server_name", name)) // TODO: we are only adding a timeout because we don't know if the context passed in is actually cancelable... @@ -444,7 +507,7 @@ func (cfg *Config) obtainOnDemandCertificate(ctx context.Context, hello *tls.Cli defer cancel() // Obtain the certificate - err = cfg.ObtainCertAsync(ctx, name) + err := cfg.ObtainCertAsync(ctx, name) // immediately unblock anyone waiting for it; doing this in // a defer would risk deadlock because of the recursive call @@ -458,7 +521,7 @@ func (cfg *Config) obtainOnDemandCertificate(ctx context.Context, hello *tls.Cli // success; certificate was just placed on disk, so // we need only restart serving the certificate - return getCertWithoutReobtaining() + return cfg.loadCertFromStorage(ctx, log, hello) } // handshakeMaintenance performs a check on cert for expiration and OCSP validity. @@ -512,6 +575,16 @@ func (cfg *Config) handshakeMaintenance(ctx context.Context, hello *tls.ClientHe // Check cert expiration if currentlyInRenewalWindow(cert.Leaf.NotBefore, expiresAt(cert.Leaf), cfg.RenewalWindowRatio) { + // Check if the certificate still exists on disk. If not, we need to obtain a new one. + // This can happen if the certificate was cleaned up by the storage cleaner, but still + // remains in the in-memory cache. + if !cfg.storageHasCertResourcesAnyIssuer(ctx, cert.Names[0]) { + log.Debug("certificate not found on disk; obtaining new certificate", + zap.Strings("identifiers", cert.Names)) + + return cfg.obtainOnDemandCertificate(ctx, hello) + } + // Otherwise, renew the certificate. return cfg.renewDynamicCertificate(ctx, hello, cert) } @@ -536,11 +609,6 @@ func (cfg *Config) renewDynamicCertificate(ctx context.Context, hello *tls.Clien timeLeft := time.Until(expiresAt(currentCert.Leaf)) revoked := currentCert.ocsp != nil && currentCert.ocsp.Status == ocsp.Revoked - getCertWithoutReobtaining := func() (Certificate, error) { - // very important to set the obtainIfNecessary argument to false, so we don't repeat this infinitely - return cfg.getCertDuringHandshake(ctx, hello, true, false) - } - // see if another goroutine is already working on this certificate obtainCertWaitChansMu.Lock() wait, ok := obtainCertWaitChans[name] @@ -575,7 +643,7 @@ func (cfg *Config) renewDynamicCertificate(ctx context.Context, hello *tls.Clien timeout.Stop() } - return getCertWithoutReobtaining() + return cfg.loadCertFromStorage(ctx, log, hello) } // looks like it's up to us to do all the work and renew the cert @@ -602,10 +670,8 @@ func (cfg *Config) renewDynamicCertificate(ctx context.Context, hello *tls.Clien renewAndReload := func(ctx context.Context, cancel context.CancelFunc) (Certificate, error) { defer cancel() - log.Info("attempting certificate renewal") - - // Make sure a certificate for this name should be obtained on-demand - err := cfg.checkIfCertShouldBeObtained(name) + // Make sure a certificate for this name should be renewed on-demand + err := cfg.checkIfCertShouldBeObtained(name, true) if err != nil { // if not, remove from cache (it will be deleted from storage later) cfg.certCache.mu.Lock() @@ -620,6 +686,8 @@ func (cfg *Config) renewDynamicCertificate(ctx context.Context, hello *tls.Clien return Certificate{}, err } + log.Info("attempting certificate renewal") + // otherwise, renew with issuer, etc. var newCert Certificate if revoked { @@ -650,7 +718,7 @@ func (cfg *Config) renewDynamicCertificate(ctx context.Context, hello *tls.Clien return newCert, err } - return getCertWithoutReobtaining() + return cfg.loadCertFromStorage(ctx, log, hello) } // if the certificate hasn't expired, we can serve what we have and renew in the background @@ -668,20 +736,20 @@ func (cfg *Config) renewDynamicCertificate(ctx context.Context, hello *tls.Clien // getCertFromAnyCertManager gets a certificate from cfg's Managers. If there are no Managers defined, this is // a no-op that returns empty values. Otherwise, it gets a certificate for hello from the first Manager that // returns a certificate and no error. -func (cfg *Config) getCertFromAnyCertManager(ctx context.Context, hello *tls.ClientHelloInfo, log *zap.Logger) (Certificate, error) { +func (cfg *Config) getCertFromAnyCertManager(ctx context.Context, hello *tls.ClientHelloInfo, logger *zap.Logger) (Certificate, error) { // fast path if nothing to do - if len(cfg.Managers) == 0 { + if cfg.OnDemand == nil || len(cfg.OnDemand.Managers) == 0 { return Certificate{}, nil } var upstreamCert *tls.Certificate // try all the GetCertificate methods on external managers; use first one that returns a certificate - for i, certManager := range cfg.Managers { + for i, certManager := range cfg.OnDemand.Managers { var err error upstreamCert, err = certManager.GetCertificate(ctx, hello) if err != nil { - log.Error("getting certificate from external certificate manager", + logger.Error("getting certificate from external certificate manager", zap.String("sni", hello.ServerName), zap.Int("cert_manager", i), zap.Error(err)) @@ -692,7 +760,7 @@ func (cfg *Config) getCertFromAnyCertManager(ctx context.Context, hello *tls.Cli } } if upstreamCert == nil { - log.Debug("all external certificate managers yielded no certificates and no errors", zap.String("sni", hello.ServerName)) + logger.Debug("all external certificate managers yielded no certificates and no errors", zap.String("sni", hello.ServerName)) return Certificate{}, nil } @@ -702,7 +770,7 @@ func (cfg *Config) getCertFromAnyCertManager(ctx context.Context, hello *tls.Cli return Certificate{}, fmt.Errorf("external certificate manager: %s: filling cert from leaf: %v", hello.ServerName, err) } - log.Debug("using externally-managed certificate", + logger.Debug("using externally-managed certificate", zap.String("sni", hello.ServerName), zap.Strings("names", cert.Names), zap.Time("expiration", expiresAt(cert.Leaf))) @@ -792,5 +860,11 @@ func normalizedName(serverName string) string { } // obtainCertWaitChans is used to coordinate obtaining certs for each hostname. -var obtainCertWaitChans = make(map[string]chan struct{}) -var obtainCertWaitChansMu sync.Mutex +var ( + obtainCertWaitChans = make(map[string]chan struct{}) + obtainCertWaitChansMu sync.Mutex +) +var ( + certLoadWaitChans = make(map[string]chan struct{}) + certLoadWaitChansMu sync.Mutex +) diff --git a/vendor/github.com/caddyserver/certmagic/httphandler.go b/vendor/github.com/caddyserver/certmagic/httphandler.go index 0736c344..fc2a8804 100644 --- a/vendor/github.com/caddyserver/certmagic/httphandler.go +++ b/vendor/github.com/caddyserver/certmagic/httphandler.go @@ -75,6 +75,8 @@ func (am *ACMEIssuer) distributedHTTPChallengeSolver(w http.ResponseWriter, r *h if err != nil { am.Logger.Error("looking up info for HTTP challenge", zap.String("host", host), + zap.String("remote_addr", r.RemoteAddr), + zap.String("user_agent", r.Header.Get("User-Agent")), zap.Error(err)) return false } diff --git a/vendor/github.com/caddyserver/certmagic/ratelimiter.go b/vendor/github.com/caddyserver/certmagic/ratelimiter.go index 6a3b7b18..eda98b61 100644 --- a/vendor/github.com/caddyserver/certmagic/ratelimiter.go +++ b/vendor/github.com/caddyserver/certmagic/ratelimiter.go @@ -33,7 +33,7 @@ func NewRateLimiter(maxEvents int, window time.Duration) *RingBufferRateLimiter panic("maxEvents cannot be less than zero") } if maxEvents == 0 && window != 0 { - panic("invalid configuration: maxEvents = 0 and window != 0 would not allow any events") + panic("NewRateLimiter: invalid configuration: maxEvents = 0 and window != 0 would not allow any events") } rbrl := &RingBufferRateLimiter{ window: window, @@ -144,14 +144,15 @@ func (r *RingBufferRateLimiter) MaxEvents() int { // the oldest events will be forgotten. If the new limit is // higher, the window will suddenly have capacity for new // reservations. It panics if maxEvents is 0 and window size -// is not zero. +// is not zero; if setting both the events limit and the +// window size to 0, call SetWindow() first. func (r *RingBufferRateLimiter) SetMaxEvents(maxEvents int) { newRing := make([]time.Time, maxEvents) r.mu.Lock() defer r.mu.Unlock() if r.window != 0 && maxEvents == 0 { - panic("invalid configuration: maxEvents = 0 and window != 0 would not allow any events") + panic("SetMaxEvents: invalid configuration: maxEvents = 0 and window != 0 would not allow any events") } // only make the change if the new limit is different @@ -203,7 +204,7 @@ func (r *RingBufferRateLimiter) SetWindow(window time.Duration) { r.mu.Lock() defer r.mu.Unlock() if window != 0 && len(r.ring) == 0 { - panic("invalid configuration: maxEvents = 0 and window != 0 would not allow any events") + panic("SetWindow: invalid configuration: maxEvents = 0 and window != 0 would not allow any events") } r.window = window } diff --git a/vendor/github.com/casbin/casbin/v2/CONTRIBUTING.md b/vendor/github.com/casbin/casbin/v2/CONTRIBUTING.md index c5f0ddb5..702b2d92 100644 --- a/vendor/github.com/casbin/casbin/v2/CONTRIBUTING.md +++ b/vendor/github.com/casbin/casbin/v2/CONTRIBUTING.md @@ -12,7 +12,7 @@ This project adheres to the [Contributor Covenant 1.2.](https://www.contributor- ## Reporting issues -Reporting issues are a great way to contribute to the project. We are perpetually grateful about a well-written, thorough bug report. +Reporting issues are a great way to contribute to the project. We are perpetually grateful about a well-written, through bug report. Before raising a new issue, check our [issue list](https://github.com/casbin/casbin/issues) to determine if it already contains the problem that you are facing. diff --git a/vendor/github.com/casbin/casbin/v2/rbac/default-role-manager/role_manager.go b/vendor/github.com/casbin/casbin/v2/rbac/default-role-manager/role_manager.go index 9a42781c..a0f01048 100644 --- a/vendor/github.com/casbin/casbin/v2/rbac/default-role-manager/role_manager.go +++ b/vendor/github.com/casbin/casbin/v2/rbac/default-role-manager/role_manager.go @@ -56,12 +56,12 @@ func (r *Role) removeRole(role *Role) { role.removeUser(r) } -//should only be called inside addRole +// should only be called inside addRole func (r *Role) addUser(user *Role) { r.users.Store(user.name, user) } -//should only be called inside removeRole +// should only be called inside removeRole func (r *Role) removeUser(user *Role) { r.users.Delete(user.name) } @@ -201,18 +201,14 @@ func (rm *RoleManagerImpl) rebuild() { } func (rm *RoleManagerImpl) Match(str string, pattern string) bool { - cacheKey := strings.Join([]string{str, pattern}, "$$") - if v, has := rm.matchingFuncCache.Get(cacheKey); has { - return v.(bool) + if str == pattern { + return true + } + + if rm.matchingFunc != nil { + return rm.matchingFunc(str, pattern) } else { - var matched bool - if rm.matchingFunc != nil { - matched = rm.matchingFunc(str, pattern) - } else { - matched = str == pattern - } - rm.matchingFuncCache.Put(cacheKey, matched) - return matched + return false } } @@ -493,7 +489,7 @@ func (dm *DomainManager) rebuild() { }) } -//Clear clears all stored data and resets the role manager to the initial state. +// Clear clears all stored data and resets the role manager to the initial state. func (dm *DomainManager) Clear() error { dm.rmMap = &sync.Map{} dm.matchingFuncCache = util.NewSyncLRUCache(100) @@ -512,18 +508,14 @@ func (dm *DomainManager) getDomain(domains ...string) (domain string, err error) } func (dm *DomainManager) Match(str string, pattern string) bool { - cacheKey := strings.Join([]string{str, pattern}, "$$") - if v, has := dm.matchingFuncCache.Get(cacheKey); has { - return v.(bool) + if str == pattern { + return true + } + + if dm.domainMatchingFunc != nil { + return dm.domainMatchingFunc(str, pattern) } else { - var matched bool - if dm.domainMatchingFunc != nil { - matched = dm.domainMatchingFunc(str, pattern) - } else { - matched = str == pattern - } - dm.matchingFuncCache.Put(cacheKey, matched) - return matched + return false } } diff --git a/vendor/github.com/datarhei/gosrt/README.md b/vendor/github.com/datarhei/gosrt/README.md index f18a4e51..2c39d900 100644 --- a/vendor/github.com/datarhei/gosrt/README.md +++ b/vendor/github.com/datarhei/gosrt/README.md @@ -42,7 +42,7 @@ The parts that are implemented are based on what has been published in the SRT R ## Requirements -A Go version of 1.16+ is required. +A Go version of 1.18+ is required. ## Installation diff --git a/vendor/github.com/datarhei/gosrt/config.go b/vendor/github.com/datarhei/gosrt/config.go index 21a7a991..9ceb6eb2 100644 --- a/vendor/github.com/datarhei/gosrt/config.go +++ b/vendor/github.com/datarhei/gosrt/config.go @@ -218,17 +218,17 @@ func DefaultConfig() Config { // UnmarshalURL takes a SRT URL and parses out the configuration. A SRT URL is // srt://[host]:[port]?[key1]=[value1]&[key2]=[value2]... -func (c *Config) UnmarshalURL(addr string) (string, error) { +func (c *Config) UnmarshalURL(addr string) (string, string, error) { u, err := url.Parse(addr) if err != nil { - return "", err + return "", "", err } if u.Scheme != "srt" { - return "", fmt.Errorf("the URL doesn't seem to be an srt:// URL") + return "", "", fmt.Errorf("the URL doesn't seem to be an srt:// URL") } - return u.Host, c.UnmarshalQuery(u.RawQuery) + return u.Hostname(), u.Port(), c.UnmarshalQuery(u.RawQuery) } // UnmarshalQuery parses a query string and interprets it as a configuration diff --git a/vendor/github.com/datarhei/gosrt/connection.go b/vendor/github.com/datarhei/gosrt/connection.go index 10b47a29..1c9a517e 100644 --- a/vendor/github.com/datarhei/gosrt/connection.go +++ b/vendor/github.com/datarhei/gosrt/connection.go @@ -633,69 +633,71 @@ func (c *srtConn) handlePacket(p packet.Packet) { c.handleKMResponse(p) } } + + return + } + + if header.PacketSequenceNumber.Gt(c.debug.expectedRcvPacketSequenceNumber) { + c.log("connection:error", func() string { + return fmt.Sprintf("recv lost packets. got: %d, expected: %d (%d)\n", header.PacketSequenceNumber.Val(), c.debug.expectedRcvPacketSequenceNumber.Val(), c.debug.expectedRcvPacketSequenceNumber.Distance(header.PacketSequenceNumber)) + }) + } + + c.debug.expectedRcvPacketSequenceNumber = header.PacketSequenceNumber.Inc() + + //fmt.Printf("%s\n", p.String()) + + // Ignore FEC filter control packets + // https://github.com/Haivision/srt/blob/master/docs/features/packet-filtering-and-fec.md + // "An FEC control packet is distinguished from a regular data packet by having + // its message number equal to 0. This value isn't normally used in SRT (message + // numbers start from 1, increment to a maximum, and then roll back to 1)." + if header.MessageNumber == 0 { + c.log("connection:filter", func() string { return "dropped FEC filter control packet" }) + return + } + + // 4.5.1.1. TSBPD Time Base Calculation + if !c.tsbpdWrapPeriod { + if header.Timestamp > packet.MAX_TIMESTAMP-(30*1000000) { + c.tsbpdWrapPeriod = true + c.log("connection:tsbpd", func() string { return "TSBPD wrapping period started" }) + } } else { - if header.PacketSequenceNumber.Gt(c.debug.expectedRcvPacketSequenceNumber) { - c.log("connection:error", func() string { - return fmt.Sprintf("recv lost packets. got: %d, expected: %d (%d)\n", header.PacketSequenceNumber.Val(), c.debug.expectedRcvPacketSequenceNumber.Val(), c.debug.expectedRcvPacketSequenceNumber.Distance(header.PacketSequenceNumber)) - }) + if header.Timestamp >= (30*1000000) && header.Timestamp <= (60*1000000) { + c.tsbpdWrapPeriod = false + c.tsbpdTimeBaseOffset += uint64(packet.MAX_TIMESTAMP) + 1 + c.log("connection:tsbpd", func() string { return "TSBPD wrapping period finished" }) } + } - c.debug.expectedRcvPacketSequenceNumber = header.PacketSequenceNumber.Inc() - - //fmt.Printf("%s\n", p.String()) - - // Ignore FEC filter control packets - // https://github.com/Haivision/srt/blob/master/docs/features/packet-filtering-and-fec.md - // "An FEC control packet is distinguished from a regular data packet by having - // its message number equal to 0. This value isn't normally used in SRT (message - // numbers start from 1, increment to a maximum, and then roll back to 1)." - if header.MessageNumber == 0 { - c.log("connection:filter", func() string { return "dropped FEC filter control packet" }) - return + tsbpdTimeBaseOffset := c.tsbpdTimeBaseOffset + if c.tsbpdWrapPeriod { + if header.Timestamp < (30 * 1000000) { + tsbpdTimeBaseOffset += uint64(packet.MAX_TIMESTAMP) + 1 } + } - // 4.5.1.1. TSBPD Time Base Calculation - if !c.tsbpdWrapPeriod { - if header.Timestamp > packet.MAX_TIMESTAMP-(30*1000000) { - c.tsbpdWrapPeriod = true - c.log("connection:tsbpd", func() string { return "TSBPD wrapping period started" }) - } - } else { - if header.Timestamp >= (30*1000000) && header.Timestamp <= (60*1000000) { - c.tsbpdWrapPeriod = false - c.tsbpdTimeBaseOffset += uint64(packet.MAX_TIMESTAMP) + 1 - c.log("connection:tsbpd", func() string { return "TSBPD wrapping period finished" }) - } - } + header.PktTsbpdTime = c.tsbpdTimeBase + tsbpdTimeBaseOffset + uint64(header.Timestamp) + c.tsbpdDelay + c.tsbpdDrift - tsbpdTimeBaseOffset := c.tsbpdTimeBaseOffset - if c.tsbpdWrapPeriod { - if header.Timestamp < (30 * 1000000) { - tsbpdTimeBaseOffset += uint64(packet.MAX_TIMESTAMP) + 1 - } - } + c.log("data:recv:dump", func() string { return p.Dump() }) - header.PktTsbpdTime = c.tsbpdTimeBase + tsbpdTimeBaseOffset + uint64(header.Timestamp) + c.tsbpdDelay + c.tsbpdDrift - - c.log("data:recv:dump", func() string { return p.Dump() }) - - c.cryptoLock.Lock() - if c.crypto != nil { - if header.KeyBaseEncryptionFlag != 0 { - if err := c.crypto.EncryptOrDecryptPayload(p.Data(), header.KeyBaseEncryptionFlag, header.PacketSequenceNumber.Val()); err != nil { - c.statistics.pktRecvUndecrypt++ - c.statistics.byteRecvUndecrypt += p.Len() - } - } else { + c.cryptoLock.Lock() + if c.crypto != nil { + if header.KeyBaseEncryptionFlag != 0 { + if err := c.crypto.EncryptOrDecryptPayload(p.Data(), header.KeyBaseEncryptionFlag, header.PacketSequenceNumber.Val()); err != nil { c.statistics.pktRecvUndecrypt++ c.statistics.byteRecvUndecrypt += p.Len() } + } else { + c.statistics.pktRecvUndecrypt++ + c.statistics.byteRecvUndecrypt += p.Len() } - c.cryptoLock.Unlock() - - // Put the packet into receive congestion control - c.recv.Push(p) } + c.cryptoLock.Unlock() + + // Put the packet into receive congestion control + c.recv.Push(p) } // handleKeepAlive resets the idle timeout and sends a keepalive to the peer. diff --git a/vendor/github.com/datarhei/gosrt/internal/congestion/live.go b/vendor/github.com/datarhei/gosrt/internal/congestion/live.go index 68c0e0fb..0f1ff5fa 100644 --- a/vendor/github.com/datarhei/gosrt/internal/congestion/live.go +++ b/vendor/github.com/datarhei/gosrt/internal/congestion/live.go @@ -115,7 +115,7 @@ func (s *liveSend) Push(p packet.Packet) { return } - // give to the packet a sequence number + // Give to the packet a sequence number p.Header().PacketSequenceNumber = s.nextSequenceNumber p.Header().PacketPositionFlag = packet.SinglePacket p.Header().OrderFlag = false @@ -128,7 +128,7 @@ func (s *liveSend) Push(p packet.Packet) { s.statistics.PktBuf++ s.statistics.ByteBuf += pktLen - // input bandwidth calculation + // Input bandwidth calculation s.rate.bytes += pktLen p.Header().Timestamp = uint32(p.Header().PktTsbpdTime & uint64(packet.MAX_TIMESTAMP)) @@ -152,7 +152,7 @@ func (s *liveSend) Push(p packet.Packet) { } func (s *liveSend) Tick(now uint64) { - // deliver packets whose PktTsbpdTime is ripe + // Deliver packets whose PktTsbpdTime is ripe s.lock.Lock() removeList := make([]*list.Element, 0, s.packetList.Len()) for e := s.packetList.Front(); e != nil; e = e.Next() { @@ -192,7 +192,7 @@ func (s *liveSend) Tick(now uint64) { p := e.Value.(packet.Packet) if p.Header().PktTsbpdTime+s.dropThreshold <= now { - // dropped packet because too old + // Dropped packet because too old s.statistics.PktDrop++ s.statistics.PktLoss++ s.statistics.ByteDrop += p.Len() @@ -245,7 +245,7 @@ func (s *liveSend) ACK(sequenceNumber circular.Number) { for e := s.lossList.Front(); e != nil; e = e.Next() { p := e.Value.(packet.Packet) if p.Header().PacketSequenceNumber.Lt(sequenceNumber) { - // remove packet from buffer because it has been successfully transmitted + // Remove packet from buffer because it has been successfully transmitted removeList = append(removeList, e) } else { break @@ -470,7 +470,7 @@ func (r *liveReceive) Push(pkt packet.Packet) { r.avgPayloadSize = 0.875*r.avgPayloadSize + 0.125*float64(pktLen) if pkt.Header().PacketSequenceNumber.Lte(r.lastDeliveredSequenceNumber) { - // too old, because up until r.lastDeliveredSequenceNumber, we already delivered + // Too old, because up until r.lastDeliveredSequenceNumber, we already delivered r.statistics.PktBelated++ r.statistics.ByteBelated += pktLen @@ -481,7 +481,7 @@ func (r *liveReceive) Push(pkt packet.Packet) { } if pkt.Header().PacketSequenceNumber.Lt(r.lastACKSequenceNumber) { - // already acknowledged, ignoring + // Already acknowledged, ignoring r.statistics.PktDrop++ r.statistics.ByteDrop += pktLen @@ -489,21 +489,21 @@ func (r *liveReceive) Push(pkt packet.Packet) { } if pkt.Header().PacketSequenceNumber.Equals(r.maxSeenSequenceNumber.Inc()) { - // in order, the packet we expected + // In order, the packet we expected r.maxSeenSequenceNumber = pkt.Header().PacketSequenceNumber } else if pkt.Header().PacketSequenceNumber.Lte(r.maxSeenSequenceNumber) { - // out of order, is it a missing piece? put it in the correct position + // Out of order, is it a missing piece? put it in the correct position for e := r.packetList.Front(); e != nil; e = e.Next() { p := e.Value.(packet.Packet) if p.Header().PacketSequenceNumber == pkt.Header().PacketSequenceNumber { - // already received (has been sent more than once), ignoring + // Already received (has been sent more than once), ignoring r.statistics.PktDrop++ r.statistics.ByteDrop += pktLen break } else if p.Header().PacketSequenceNumber.Gt(pkt.Header().PacketSequenceNumber) { - // late arrival, this fills a gap + // Late arrival, this fills a gap r.statistics.PktBuf++ r.statistics.PktUnique++ @@ -518,7 +518,7 @@ func (r *liveReceive) Push(pkt packet.Packet) { return } else { - // too far ahead, there are some missing sequence numbers, immediate NAK report + // Too far ahead, there are some missing sequence numbers, immediate NAK report // here we can prevent a possibly unnecessary NAK with SRTO_LOXXMAXTTL r.sendNAK(r.maxSeenSequenceNumber.Inc(), pkt.Header().PacketSequenceNumber.Dec()) @@ -545,7 +545,7 @@ func (r *liveReceive) periodicACK(now uint64) (ok bool, sequenceNumber circular. // 4.8.1. Packet Acknowledgement (ACKs, ACKACKs) if now-r.lastPeriodicACK < r.periodicACKInterval { if r.nPackets >= 64 { - lite = true // send light ACK + lite = true // Send light ACK } else { return } @@ -555,8 +555,9 @@ func (r *liveReceive) periodicACK(now uint64) (ok bool, sequenceNumber circular. ackSequenceNumber := r.lastDeliveredSequenceNumber - // find the sequence number up until we have all in a row. - // where the first gap is (or at the end of the list) is where we can ACK to. + // Find the sequence number up until we have all in a row. + // Where the first gap is (or at the end of the list) is where we can ACK to. + e := r.packetList.Front() if e != nil { p := e.Value.(packet.Packet) @@ -564,6 +565,25 @@ func (r *liveReceive) periodicACK(now uint64) (ok bool, sequenceNumber circular. minPktTsbpdTime = p.Header().PktTsbpdTime maxPktTsbpdTime = p.Header().PktTsbpdTime + // If there are packets that should be delivered by now, move foward. + if p.Header().PktTsbpdTime <= now { + for e = e.Next(); e != nil; e = e.Next() { + p = e.Value.(packet.Packet) + + if p.Header().PktTsbpdTime > now { + break + } + } + + ackSequenceNumber = p.Header().PacketSequenceNumber + maxPktTsbpdTime = p.Header().PktTsbpdTime + + if e != nil { + e = e.Next() + p = e.Value.(packet.Packet) + } + } + if p.Header().PacketSequenceNumber.Equals(ackSequenceNumber.Inc()) { ackSequenceNumber = p.Header().PacketSequenceNumber @@ -581,7 +601,7 @@ func (r *liveReceive) periodicACK(now uint64) (ok bool, sequenceNumber circular. ok = true sequenceNumber = ackSequenceNumber.Inc() - // keep track of the last ACK's sequence. with this we can faster ignore + // Keep track of the last ACK's sequence. with this we can faster ignore // packets that come in that have a lower sequence number. r.lastACKSequenceNumber = ackSequenceNumber } @@ -602,12 +622,12 @@ func (r *liveReceive) periodicNAK(now uint64) (ok bool, from, to circular.Number return } - // send a periodic NAK + // Send a periodic NAK ackSequenceNumber := r.lastDeliveredSequenceNumber - // send a NAK only for the first gap. - // alternatively send a NAK for max. X gaps because the size of the NAK packet is limited + // Send a NAK only for the first gap. + // Alternatively send a NAK for max. X gaps because the size of the NAK packet is limited. for e := r.packetList.Front(); e != nil; e = e.Next() { p := e.Value.(packet.Packet) @@ -638,7 +658,7 @@ func (r *liveReceive) Tick(now uint64) { r.sendNAK(from, to) } - // deliver packets whose PktTsbpdTime is ripe + // Deliver packets whose PktTsbpdTime is ripe r.lock.Lock() removeList := make([]*list.Element, 0, r.packetList.Len()) for e := r.packetList.Front(); e != nil; e = e.Next() { @@ -819,12 +839,12 @@ func (r *fakeLiveReceive) Push(pkt packet.Packet) { r.avgPayloadSize = 0.875*r.avgPayloadSize + 0.125*float64(pktLen) if pkt.Header().PacketSequenceNumber.Lte(r.lastDeliveredSequenceNumber) { - // too old, because up until r.lastDeliveredSequenceNumber, we already delivered + // Too old, because up until r.lastDeliveredSequenceNumber, we already delivered return } if pkt.Header().PacketSequenceNumber.Lt(r.lastACKSequenceNumber) { - // already acknowledged, ignoring + // Already acknowledged, ignoring return } @@ -842,7 +862,7 @@ func (r *fakeLiveReceive) periodicACK(now uint64) (ok bool, sequenceNumber circu // 4.8.1. Packet Acknowledgement (ACKs, ACKACKs) if now-r.lastPeriodicACK < r.periodicACKInterval { if r.nPackets >= 64 { - lite = true // send light ACK + lite = true // Send light ACK } else { return } @@ -864,7 +884,7 @@ func (r *fakeLiveReceive) Tick(now uint64) { r.sendACK(sequenceNumber, lite) } - // deliver packets whose PktTsbpdTime is ripe + // Deliver packets whose PktTsbpdTime is ripe r.lock.Lock() defer r.lock.Unlock() diff --git a/vendor/github.com/go-openapi/swag/util.go b/vendor/github.com/go-openapi/swag/util.go index f78ab684..d971fbe3 100644 --- a/vendor/github.com/go-openapi/swag/util.go +++ b/vendor/github.com/go-openapi/swag/util.go @@ -341,12 +341,21 @@ type zeroable interface { // IsZero returns true when the value passed into the function is a zero value. // This allows for safer checking of interface values. func IsZero(data interface{}) bool { + v := reflect.ValueOf(data) + // check for nil data + switch v.Kind() { + case reflect.Interface, reflect.Map, reflect.Ptr, reflect.Slice: + if v.IsNil() { + return true + } + } + // check for things that have an IsZero method instead if vv, ok := data.(zeroable); ok { return vv.IsZero() } + // continue with slightly more complex reflection - v := reflect.ValueOf(data) switch v.Kind() { case reflect.String: return v.Len() == 0 @@ -358,14 +367,13 @@ func IsZero(data interface{}) bool { return v.Uint() == 0 case reflect.Float32, reflect.Float64: return v.Float() == 0 - case reflect.Interface, reflect.Map, reflect.Ptr, reflect.Slice: - return v.IsNil() case reflect.Struct, reflect.Array: return reflect.DeepEqual(data, reflect.Zero(v.Type()).Interface()) case reflect.Invalid: return true + default: + return false } - return false } // AddInitialisms add additional initialisms diff --git a/vendor/github.com/go-playground/validator/v10/README.md b/vendor/github.com/go-playground/validator/v10/README.md index 931b3414..520661db 100644 --- a/vendor/github.com/go-playground/validator/v10/README.md +++ b/vendor/github.com/go-playground/validator/v10/README.md @@ -1,7 +1,7 @@ Package validator ================= <img align="right" src="https://raw.githubusercontent.com/go-playground/validator/v10/logo.png">[![Join the chat at https://gitter.im/go-playground/validator](https://badges.gitter.im/Join%20Chat.svg)](https://gitter.im/go-playground/validator?utm_source=badge&utm_medium=badge&utm_campaign=pr-badge&utm_content=badge) -![Project status](https://img.shields.io/badge/version-10.14.0-green.svg) +![Project status](https://img.shields.io/badge/version-10.14.1-green.svg) [![Build Status](https://travis-ci.org/go-playground/validator.svg?branch=master)](https://travis-ci.org/go-playground/validator) [![Coverage Status](https://coveralls.io/repos/go-playground/validator/badge.svg?branch=master&service=github)](https://coveralls.io/github/go-playground/validator?branch=master) [![Go Report Card](https://goreportcard.com/badge/github.com/go-playground/validator)](https://goreportcard.com/report/github.com/go-playground/validator) diff --git a/vendor/github.com/go-playground/validator/v10/baked_in.go b/vendor/github.com/go-playground/validator/v10/baked_in.go index 8e6b169c..e676f1d1 100644 --- a/vendor/github.com/go-playground/validator/v10/baked_in.go +++ b/vendor/github.com/go-playground/validator/v10/baked_in.go @@ -1414,25 +1414,21 @@ func isURL(fl FieldLevel) bool { switch field.Kind() { case reflect.String: - var i int s := field.String() - // checks needed as of Go 1.6 because of change https://github.com/golang/go/commit/617c93ce740c3c3cc28cdd1a0d712be183d0b328#diff-6c2d018290e298803c0c9419d8739885L195 - // emulate browser and strip the '#' suffix prior to validation. see issue-#237 - if i = strings.Index(s, "#"); i > -1 { - s = s[:i] - } - if len(s) == 0 { return false } - url, err := url.ParseRequestURI(s) - + url, err := url.Parse(s) if err != nil || url.Scheme == "" { return false } + if url.Host == "" && url.Fragment == "" && url.Opaque == "" { + return false + } + return true } @@ -1450,7 +1446,13 @@ func isHttpURL(fl FieldLevel) bool { case reflect.String: s := strings.ToLower(field.String()) - return strings.HasPrefix(s, "http://") || strings.HasPrefix(s, "https://") + + url, err := url.Parse(s) + if err != nil || url.Host == "" { + return false + } + + return url.Scheme == "http" || url.Scheme == "https" } panic(fmt.Sprintf("Bad field type %T", field.Interface())) @@ -2568,9 +2570,17 @@ func isDirPath(fl FieldLevel) bool { func isJSON(fl FieldLevel) bool { field := fl.Field() - if field.Kind() == reflect.String { + switch field.Kind() { + case reflect.String: val := field.String() return json.Valid([]byte(val)) + case reflect.Slice: + fieldType := field.Type() + + if fieldType.ConvertibleTo(byteSliceType) { + b := field.Convert(byteSliceType).Interface().([]byte) + return json.Valid(b) + } } panic(fmt.Sprintf("Bad field type %T", field.Interface())) diff --git a/vendor/github.com/go-playground/validator/v10/validator_instance.go b/vendor/github.com/go-playground/validator/v10/validator_instance.go index d2ee8fe3..d9dbf0ce 100644 --- a/vendor/github.com/go-playground/validator/v10/validator_instance.go +++ b/vendor/github.com/go-playground/validator/v10/validator_instance.go @@ -53,6 +53,8 @@ var ( timeDurationType = reflect.TypeOf(time.Duration(0)) timeType = reflect.TypeOf(time.Time{}) + byteSliceType = reflect.TypeOf([]byte{}) + defaultCField = &cField{namesEqual: true} ) diff --git a/vendor/github.com/hashicorp/golang-lru/v2/2q.go b/vendor/github.com/hashicorp/golang-lru/v2/2q.go index 1f0055b7..5e00d9a7 100644 --- a/vendor/github.com/hashicorp/golang-lru/v2/2q.go +++ b/vendor/github.com/hashicorp/golang-lru/v2/2q.go @@ -181,6 +181,16 @@ func (c *TwoQueueCache[K, V]) Keys() []K { return append(k1, k2...) } +// Values returns a slice of the values in the cache. +// The frequently used values are first in the returned slice. +func (c *TwoQueueCache[K, V]) Values() []V { + c.lock.RLock() + defer c.lock.RUnlock() + v1 := c.frequent.Values() + v2 := c.recent.Values() + return append(v1, v2...) +} + // Remove removes the provided key from the cache. func (c *TwoQueueCache[K, V]) Remove(key K) { c.lock.Lock() diff --git a/vendor/github.com/hashicorp/golang-lru/v2/README.md b/vendor/github.com/hashicorp/golang-lru/v2/README.md index 4c08cc46..b60785fc 100644 --- a/vendor/github.com/hashicorp/golang-lru/v2/README.md +++ b/vendor/github.com/hashicorp/golang-lru/v2/README.md @@ -15,11 +15,20 @@ Example Using the LRU is very simple: ```go -l, _ := New[int, interface{}](128) -for i := 0; i < 256; i++ { - l.Add(i, nil) -} -if l.Len() != 128 { - panic(fmt.Sprintf("bad len: %v", l.Len())) +package main + +import ( + "fmt" + "github.com/hashicorp/golang-lru/v2" +) + +func main() { + l, _ := lru.New[int, any](128) + for i := 0; i < 256; i++ { + l.Add(i, nil) + } + if l.Len() != 128 { + panic(fmt.Sprintf("bad len: %v", l.Len())) + } } ``` diff --git a/vendor/github.com/hashicorp/golang-lru/v2/arc.go b/vendor/github.com/hashicorp/golang-lru/v2/arc.go deleted file mode 100644 index a255aae2..00000000 --- a/vendor/github.com/hashicorp/golang-lru/v2/arc.go +++ /dev/null @@ -1,259 +0,0 @@ -// Copyright (c) HashiCorp, Inc. -// SPDX-License-Identifier: MPL-2.0 - -package lru - -import ( - "sync" - - "github.com/hashicorp/golang-lru/v2/simplelru" -) - -// ARCCache is a thread-safe fixed size Adaptive Replacement Cache (ARC). -// ARC is an enhancement over the standard LRU cache in that tracks both -// frequency and recency of use. This avoids a burst in access to new -// entries from evicting the frequently used older entries. It adds some -// additional tracking overhead to a standard LRU cache, computationally -// it is roughly 2x the cost, and the extra memory overhead is linear -// with the size of the cache. ARC has been patented by IBM, but is -// similar to the TwoQueueCache (2Q) which requires setting parameters. -type ARCCache[K comparable, V any] struct { - size int // Size is the total capacity of the cache - p int // P is the dynamic preference towards T1 or T2 - - t1 simplelru.LRUCache[K, V] // T1 is the LRU for recently accessed items - b1 simplelru.LRUCache[K, struct{}] // B1 is the LRU for evictions from t1 - - t2 simplelru.LRUCache[K, V] // T2 is the LRU for frequently accessed items - b2 simplelru.LRUCache[K, struct{}] // B2 is the LRU for evictions from t2 - - lock sync.RWMutex -} - -// NewARC creates an ARC of the given size -func NewARC[K comparable, V any](size int) (*ARCCache[K, V], error) { - // Create the sub LRUs - b1, err := simplelru.NewLRU[K, struct{}](size, nil) - if err != nil { - return nil, err - } - b2, err := simplelru.NewLRU[K, struct{}](size, nil) - if err != nil { - return nil, err - } - t1, err := simplelru.NewLRU[K, V](size, nil) - if err != nil { - return nil, err - } - t2, err := simplelru.NewLRU[K, V](size, nil) - if err != nil { - return nil, err - } - - // Initialize the ARC - c := &ARCCache[K, V]{ - size: size, - p: 0, - t1: t1, - b1: b1, - t2: t2, - b2: b2, - } - return c, nil -} - -// Get looks up a key's value from the cache. -func (c *ARCCache[K, V]) Get(key K) (value V, ok bool) { - c.lock.Lock() - defer c.lock.Unlock() - - // If the value is contained in T1 (recent), then - // promote it to T2 (frequent) - if val, ok := c.t1.Peek(key); ok { - c.t1.Remove(key) - c.t2.Add(key, val) - return val, ok - } - - // Check if the value is contained in T2 (frequent) - if val, ok := c.t2.Get(key); ok { - return val, ok - } - - // No hit - return -} - -// Add adds a value to the cache. -func (c *ARCCache[K, V]) Add(key K, value V) { - c.lock.Lock() - defer c.lock.Unlock() - - // Check if the value is contained in T1 (recent), and potentially - // promote it to frequent T2 - if c.t1.Contains(key) { - c.t1.Remove(key) - c.t2.Add(key, value) - return - } - - // Check if the value is already in T2 (frequent) and update it - if c.t2.Contains(key) { - c.t2.Add(key, value) - return - } - - // Check if this value was recently evicted as part of the - // recently used list - if c.b1.Contains(key) { - // T1 set is too small, increase P appropriately - delta := 1 - b1Len := c.b1.Len() - b2Len := c.b2.Len() - if b2Len > b1Len { - delta = b2Len / b1Len - } - if c.p+delta >= c.size { - c.p = c.size - } else { - c.p += delta - } - - // Potentially need to make room in the cache - if c.t1.Len()+c.t2.Len() >= c.size { - c.replace(false) - } - - // Remove from B1 - c.b1.Remove(key) - - // Add the key to the frequently used list - c.t2.Add(key, value) - return - } - - // Check if this value was recently evicted as part of the - // frequently used list - if c.b2.Contains(key) { - // T2 set is too small, decrease P appropriately - delta := 1 - b1Len := c.b1.Len() - b2Len := c.b2.Len() - if b1Len > b2Len { - delta = b1Len / b2Len - } - if delta >= c.p { - c.p = 0 - } else { - c.p -= delta - } - - // Potentially need to make room in the cache - if c.t1.Len()+c.t2.Len() >= c.size { - c.replace(true) - } - - // Remove from B2 - c.b2.Remove(key) - - // Add the key to the frequently used list - c.t2.Add(key, value) - return - } - - // Potentially need to make room in the cache - if c.t1.Len()+c.t2.Len() >= c.size { - c.replace(false) - } - - // Keep the size of the ghost buffers trim - if c.b1.Len() > c.size-c.p { - c.b1.RemoveOldest() - } - if c.b2.Len() > c.p { - c.b2.RemoveOldest() - } - - // Add to the recently seen list - c.t1.Add(key, value) -} - -// replace is used to adaptively evict from either T1 or T2 -// based on the current learned value of P -func (c *ARCCache[K, V]) replace(b2ContainsKey bool) { - t1Len := c.t1.Len() - if t1Len > 0 && (t1Len > c.p || (t1Len == c.p && b2ContainsKey)) { - k, _, ok := c.t1.RemoveOldest() - if ok { - c.b1.Add(k, struct{}{}) - } - } else { - k, _, ok := c.t2.RemoveOldest() - if ok { - c.b2.Add(k, struct{}{}) - } - } -} - -// Len returns the number of cached entries -func (c *ARCCache[K, V]) Len() int { - c.lock.RLock() - defer c.lock.RUnlock() - return c.t1.Len() + c.t2.Len() -} - -// Keys returns all the cached keys -func (c *ARCCache[K, V]) Keys() []K { - c.lock.RLock() - defer c.lock.RUnlock() - k1 := c.t1.Keys() - k2 := c.t2.Keys() - return append(k1, k2...) -} - -// Remove is used to purge a key from the cache -func (c *ARCCache[K, V]) Remove(key K) { - c.lock.Lock() - defer c.lock.Unlock() - if c.t1.Remove(key) { - return - } - if c.t2.Remove(key) { - return - } - if c.b1.Remove(key) { - return - } - if c.b2.Remove(key) { - return - } -} - -// Purge is used to clear the cache -func (c *ARCCache[K, V]) Purge() { - c.lock.Lock() - defer c.lock.Unlock() - c.t1.Purge() - c.t2.Purge() - c.b1.Purge() - c.b2.Purge() -} - -// Contains is used to check if the cache contains a key -// without updating recency or frequency. -func (c *ARCCache[K, V]) Contains(key K) bool { - c.lock.RLock() - defer c.lock.RUnlock() - return c.t1.Contains(key) || c.t2.Contains(key) -} - -// Peek is used to inspect the cache value of a key -// without updating recency or frequency. -func (c *ARCCache[K, V]) Peek(key K) (value V, ok bool) { - c.lock.RLock() - defer c.lock.RUnlock() - if val, ok := c.t1.Peek(key); ok { - return val, ok - } - return c.t2.Peek(key) -} diff --git a/vendor/github.com/hashicorp/golang-lru/v2/doc.go b/vendor/github.com/hashicorp/golang-lru/v2/doc.go index 2474929f..24107ee0 100644 --- a/vendor/github.com/hashicorp/golang-lru/v2/doc.go +++ b/vendor/github.com/hashicorp/golang-lru/v2/doc.go @@ -3,21 +3,21 @@ // Package lru provides three different LRU caches of varying sophistication. // -// Cache is a simple LRU cache. It is based on the -// LRU implementation in groupcache: -// https://github.com/golang/groupcache/tree/master/lru +// Cache is a simple LRU cache. It is based on the LRU implementation in +// groupcache: https://github.com/golang/groupcache/tree/master/lru // // TwoQueueCache tracks frequently used and recently used entries separately. -// This avoids a burst of accesses from taking out frequently used entries, -// at the cost of about 2x computational overhead and some extra bookkeeping. +// This avoids a burst of accesses from taking out frequently used entries, at +// the cost of about 2x computational overhead and some extra bookkeeping. // -// ARCCache is an adaptive replacement cache. It tracks recent evictions as -// well as recent usage in both the frequent and recent caches. Its -// computational overhead is comparable to TwoQueueCache, but the memory -// overhead is linear with the size of the cache. +// ARCCache is an adaptive replacement cache. It tracks recent evictions as well +// as recent usage in both the frequent and recent caches. Its computational +// overhead is comparable to TwoQueueCache, but the memory overhead is linear +// with the size of the cache. // // ARC has been patented by IBM, so do not use it if that is problematic for -// your program. +// your program. For this reason, it is in a separate go module contained within +// this repository. // // All caches in this package take locks while operating, and are therefore // thread-safe for consumers. diff --git a/vendor/github.com/hashicorp/golang-lru/v2/lru.go b/vendor/github.com/hashicorp/golang-lru/v2/lru.go index 32d04170..a2655f1f 100644 --- a/vendor/github.com/hashicorp/golang-lru/v2/lru.go +++ b/vendor/github.com/hashicorp/golang-lru/v2/lru.go @@ -233,6 +233,14 @@ func (c *Cache[K, V]) Keys() []K { return keys } +// Values returns a slice of the values in the cache, from oldest to newest. +func (c *Cache[K, V]) Values() []V { + c.lock.RLock() + values := c.lru.Values() + c.lock.RUnlock() + return values +} + // Len returns the number of items in the cache. func (c *Cache[K, V]) Len() int { c.lock.RLock() diff --git a/vendor/github.com/hashicorp/golang-lru/v2/simplelru/lru.go b/vendor/github.com/hashicorp/golang-lru/v2/simplelru/lru.go index b6731afd..ac256645 100644 --- a/vendor/github.com/hashicorp/golang-lru/v2/simplelru/lru.go +++ b/vendor/github.com/hashicorp/golang-lru/v2/simplelru/lru.go @@ -129,6 +129,17 @@ func (c *LRU[K, V]) Keys() []K { return keys } +// Values returns a slice of the values in the cache, from oldest to newest. +func (c *LRU[K, V]) Values() []V { + values := make([]V, len(c.items)) + i := 0 + for ent := c.evictList.back(); ent != nil; ent = ent.prevEntry() { + values[i] = ent.value + i++ + } + return values +} + // Len returns the number of items in the cache. func (c *LRU[K, V]) Len() int { return c.evictList.length() diff --git a/vendor/github.com/hashicorp/golang-lru/v2/simplelru/lru_interface.go b/vendor/github.com/hashicorp/golang-lru/v2/simplelru/lru_interface.go index 3cbf02bc..043b8bcc 100644 --- a/vendor/github.com/hashicorp/golang-lru/v2/simplelru/lru_interface.go +++ b/vendor/github.com/hashicorp/golang-lru/v2/simplelru/lru_interface.go @@ -32,6 +32,9 @@ type LRUCache[K comparable, V any] interface { // Returns a slice of the keys in the cache, from oldest to newest. Keys() []K + // Values returns a slice of the values in the cache, from oldest to newest. + Values() []V + // Returns the number of items in the cache. Len() int diff --git a/vendor/github.com/hashicorp/golang-lru/v2/testing.go b/vendor/github.com/hashicorp/golang-lru/v2/testing.go deleted file mode 100644 index 3277c218..00000000 --- a/vendor/github.com/hashicorp/golang-lru/v2/testing.go +++ /dev/null @@ -1,19 +0,0 @@ -// Copyright (c) HashiCorp, Inc. -// SPDX-License-Identifier: MPL-2.0 - -package lru - -import ( - "crypto/rand" - "math" - "math/big" - "testing" -) - -func getRand(tb testing.TB) int64 { - out, err := rand.Int(rand.Reader, big.NewInt(math.MaxInt64)) - if err != nil { - tb.Fatal(err) - } - return out.Int64() -} diff --git a/vendor/github.com/klauspost/compress/s2/encode_all.go b/vendor/github.com/klauspost/compress/s2/encode_all.go index 11657f09..5e57995d 100644 --- a/vendor/github.com/klauspost/compress/s2/encode_all.go +++ b/vendor/github.com/klauspost/compress/s2/encode_all.go @@ -742,7 +742,6 @@ searchDict: x := load64(src, s-2) m2Hash := hash6(x, tableBits) currHash := hash6(x>>8, tableBits) - candidate = int(table[currHash]) table[m2Hash] = uint32(s - 2) table[currHash] = uint32(s - 1) cv = load64(src, s) diff --git a/vendor/github.com/klauspost/compress/s2/encode_better.go b/vendor/github.com/klauspost/compress/s2/encode_better.go index f46adb41..544cb1e1 100644 --- a/vendor/github.com/klauspost/compress/s2/encode_better.go +++ b/vendor/github.com/klauspost/compress/s2/encode_better.go @@ -157,7 +157,6 @@ func encodeBlockBetterGo(dst, src []byte) (d int) { index0 := base + 1 index1 := s - 2 - cv = load64(src, s) for index0 < index1 { cv0 := load64(src, index0) cv1 := load64(src, index1) @@ -269,18 +268,21 @@ func encodeBlockBetterGo(dst, src []byte) (d int) { lTable[hash7(cv0, lTableBits)] = uint32(index0) sTable[hash4(cv0>>8, sTableBits)] = uint32(index0 + 1) + // lTable could be postponed, but very minor difference. lTable[hash7(cv1, lTableBits)] = uint32(index1) sTable[hash4(cv1>>8, sTableBits)] = uint32(index1 + 1) index0 += 1 index1 -= 1 cv = load64(src, s) - // index every second long in between. - for index0 < index1 { + // Index large values sparsely in between. + // We do two starting from different offsets for speed. + index2 := (index0 + index1 + 1) >> 1 + for index2 < index1 { lTable[hash7(load64(src, index0), lTableBits)] = uint32(index0) - lTable[hash7(load64(src, index1), lTableBits)] = uint32(index1) + lTable[hash7(load64(src, index2), lTableBits)] = uint32(index2) index0 += 2 - index1 -= 2 + index2 += 2 } } @@ -459,12 +461,14 @@ func encodeBlockBetterSnappyGo(dst, src []byte) (d int) { index1 -= 1 cv = load64(src, s) - // index every second long in between. - for index0 < index1 { + // Index large values sparsely in between. + // We do two starting from different offsets for speed. + index2 := (index0 + index1 + 1) >> 1 + for index2 < index1 { lTable[hash7(load64(src, index0), lTableBits)] = uint32(index0) - lTable[hash7(load64(src, index1), lTableBits)] = uint32(index1) + lTable[hash7(load64(src, index2), lTableBits)] = uint32(index2) index0 += 2 - index1 -= 2 + index2 += 2 } } @@ -599,7 +603,6 @@ searchDict: if s >= sLimit { break searchDict } - cv = load64(src, s) // Index in-between index0 := base + 1 index1 := s - 2 @@ -865,12 +868,14 @@ searchDict: index1 -= 1 cv = load64(src, s) - // index every second long in between. - for index0 < index1 { + // Index large values sparsely in between. + // We do two starting from different offsets for speed. + index2 := (index0 + index1 + 1) >> 1 + for index2 < index1 { lTable[hash7(load64(src, index0), lTableBits)] = uint32(index0) - lTable[hash7(load64(src, index1), lTableBits)] = uint32(index1) + lTable[hash7(load64(src, index2), lTableBits)] = uint32(index2) index0 += 2 - index1 -= 2 + index2 += 2 } } @@ -961,7 +966,6 @@ searchDict: index0 := base + 1 index1 := s - 2 - cv = load64(src, s) for index0 < index1 { cv0 := load64(src, index0) cv1 := load64(src, index1) @@ -1079,12 +1083,14 @@ searchDict: index1 -= 1 cv = load64(src, s) - // index every second long in between. - for index0 < index1 { + // Index large values sparsely in between. + // We do two starting from different offsets for speed. + index2 := (index0 + index1 + 1) >> 1 + for index2 < index1 { lTable[hash7(load64(src, index0), lTableBits)] = uint32(index0) - lTable[hash7(load64(src, index1), lTableBits)] = uint32(index1) + lTable[hash7(load64(src, index2), lTableBits)] = uint32(index2) index0 += 2 - index1 -= 2 + index2 += 2 } } diff --git a/vendor/github.com/klauspost/compress/s2/encodeblock_amd64.s b/vendor/github.com/klauspost/compress/s2/encodeblock_amd64.s index 9222d179..54031aa3 100644 --- a/vendor/github.com/klauspost/compress/s2/encodeblock_amd64.s +++ b/vendor/github.com/klauspost/compress/s2/encodeblock_amd64.s @@ -274,7 +274,6 @@ matchlen_loop_repeat_extend_encodeBlockAsm: LEAL 8(R11), R11 CMPL R8, $0x08 JAE matchlen_loopback_repeat_extend_encodeBlockAsm - JZ repeat_extend_forward_end_encodeBlockAsm matchlen_match4_repeat_extend_encodeBlockAsm: CMPL R8, $0x04 @@ -282,21 +281,21 @@ matchlen_match4_repeat_extend_encodeBlockAsm: MOVL (R9)(R11*1), R10 CMPL (BX)(R11*1), R10 JNE matchlen_match2_repeat_extend_encodeBlockAsm - SUBL $0x04, R8 + LEAL -4(R8), R8 LEAL 4(R11), R11 matchlen_match2_repeat_extend_encodeBlockAsm: - CMPL R8, $0x02 - JB matchlen_match1_repeat_extend_encodeBlockAsm + CMPL R8, $0x01 + JE matchlen_match1_repeat_extend_encodeBlockAsm + JB repeat_extend_forward_end_encodeBlockAsm MOVW (R9)(R11*1), R10 CMPW (BX)(R11*1), R10 JNE matchlen_match1_repeat_extend_encodeBlockAsm - SUBL $0x02, R8 LEAL 2(R11), R11 + SUBL $0x02, R8 + JZ repeat_extend_forward_end_encodeBlockAsm matchlen_match1_repeat_extend_encodeBlockAsm: - CMPL R8, $0x01 - JB repeat_extend_forward_end_encodeBlockAsm MOVB (R9)(R11*1), R10 CMPB (BX)(R11*1), R10 JNE repeat_extend_forward_end_encodeBlockAsm @@ -877,7 +876,6 @@ matchlen_loop_match_nolit_encodeBlockAsm: LEAL 8(R9), R9 CMPL SI, $0x08 JAE matchlen_loopback_match_nolit_encodeBlockAsm - JZ match_nolit_end_encodeBlockAsm matchlen_match4_match_nolit_encodeBlockAsm: CMPL SI, $0x04 @@ -885,21 +883,21 @@ matchlen_match4_match_nolit_encodeBlockAsm: MOVL (DI)(R9*1), R8 CMPL (BX)(R9*1), R8 JNE matchlen_match2_match_nolit_encodeBlockAsm - SUBL $0x04, SI + LEAL -4(SI), SI LEAL 4(R9), R9 matchlen_match2_match_nolit_encodeBlockAsm: - CMPL SI, $0x02 - JB matchlen_match1_match_nolit_encodeBlockAsm + CMPL SI, $0x01 + JE matchlen_match1_match_nolit_encodeBlockAsm + JB match_nolit_end_encodeBlockAsm MOVW (DI)(R9*1), R8 CMPW (BX)(R9*1), R8 JNE matchlen_match1_match_nolit_encodeBlockAsm - SUBL $0x02, SI LEAL 2(R9), R9 + SUBL $0x02, SI + JZ match_nolit_end_encodeBlockAsm matchlen_match1_match_nolit_encodeBlockAsm: - CMPL SI, $0x01 - JB match_nolit_end_encodeBlockAsm MOVB (DI)(R9*1), R8 CMPB (BX)(R9*1), R8 JNE match_nolit_end_encodeBlockAsm @@ -1637,7 +1635,6 @@ matchlen_loop_repeat_extend_encodeBlockAsm4MB: LEAL 8(R11), R11 CMPL R8, $0x08 JAE matchlen_loopback_repeat_extend_encodeBlockAsm4MB - JZ repeat_extend_forward_end_encodeBlockAsm4MB matchlen_match4_repeat_extend_encodeBlockAsm4MB: CMPL R8, $0x04 @@ -1645,21 +1642,21 @@ matchlen_match4_repeat_extend_encodeBlockAsm4MB: MOVL (R9)(R11*1), R10 CMPL (BX)(R11*1), R10 JNE matchlen_match2_repeat_extend_encodeBlockAsm4MB - SUBL $0x04, R8 + LEAL -4(R8), R8 LEAL 4(R11), R11 matchlen_match2_repeat_extend_encodeBlockAsm4MB: - CMPL R8, $0x02 - JB matchlen_match1_repeat_extend_encodeBlockAsm4MB + CMPL R8, $0x01 + JE matchlen_match1_repeat_extend_encodeBlockAsm4MB + JB repeat_extend_forward_end_encodeBlockAsm4MB MOVW (R9)(R11*1), R10 CMPW (BX)(R11*1), R10 JNE matchlen_match1_repeat_extend_encodeBlockAsm4MB - SUBL $0x02, R8 LEAL 2(R11), R11 + SUBL $0x02, R8 + JZ repeat_extend_forward_end_encodeBlockAsm4MB matchlen_match1_repeat_extend_encodeBlockAsm4MB: - CMPL R8, $0x01 - JB repeat_extend_forward_end_encodeBlockAsm4MB MOVB (R9)(R11*1), R10 CMPB (BX)(R11*1), R10 JNE repeat_extend_forward_end_encodeBlockAsm4MB @@ -2190,7 +2187,6 @@ matchlen_loop_match_nolit_encodeBlockAsm4MB: LEAL 8(R9), R9 CMPL SI, $0x08 JAE matchlen_loopback_match_nolit_encodeBlockAsm4MB - JZ match_nolit_end_encodeBlockAsm4MB matchlen_match4_match_nolit_encodeBlockAsm4MB: CMPL SI, $0x04 @@ -2198,21 +2194,21 @@ matchlen_match4_match_nolit_encodeBlockAsm4MB: MOVL (DI)(R9*1), R8 CMPL (BX)(R9*1), R8 JNE matchlen_match2_match_nolit_encodeBlockAsm4MB - SUBL $0x04, SI + LEAL -4(SI), SI LEAL 4(R9), R9 matchlen_match2_match_nolit_encodeBlockAsm4MB: - CMPL SI, $0x02 - JB matchlen_match1_match_nolit_encodeBlockAsm4MB + CMPL SI, $0x01 + JE matchlen_match1_match_nolit_encodeBlockAsm4MB + JB match_nolit_end_encodeBlockAsm4MB MOVW (DI)(R9*1), R8 CMPW (BX)(R9*1), R8 JNE matchlen_match1_match_nolit_encodeBlockAsm4MB - SUBL $0x02, SI LEAL 2(R9), R9 + SUBL $0x02, SI + JZ match_nolit_end_encodeBlockAsm4MB matchlen_match1_match_nolit_encodeBlockAsm4MB: - CMPL SI, $0x01 - JB match_nolit_end_encodeBlockAsm4MB MOVB (DI)(R9*1), R8 CMPB (BX)(R9*1), R8 JNE match_nolit_end_encodeBlockAsm4MB @@ -2902,7 +2898,6 @@ matchlen_loop_repeat_extend_encodeBlockAsm12B: LEAL 8(R11), R11 CMPL R8, $0x08 JAE matchlen_loopback_repeat_extend_encodeBlockAsm12B - JZ repeat_extend_forward_end_encodeBlockAsm12B matchlen_match4_repeat_extend_encodeBlockAsm12B: CMPL R8, $0x04 @@ -2910,21 +2905,21 @@ matchlen_match4_repeat_extend_encodeBlockAsm12B: MOVL (R9)(R11*1), R10 CMPL (BX)(R11*1), R10 JNE matchlen_match2_repeat_extend_encodeBlockAsm12B - SUBL $0x04, R8 + LEAL -4(R8), R8 LEAL 4(R11), R11 matchlen_match2_repeat_extend_encodeBlockAsm12B: - CMPL R8, $0x02 - JB matchlen_match1_repeat_extend_encodeBlockAsm12B + CMPL R8, $0x01 + JE matchlen_match1_repeat_extend_encodeBlockAsm12B + JB repeat_extend_forward_end_encodeBlockAsm12B MOVW (R9)(R11*1), R10 CMPW (BX)(R11*1), R10 JNE matchlen_match1_repeat_extend_encodeBlockAsm12B - SUBL $0x02, R8 LEAL 2(R11), R11 + SUBL $0x02, R8 + JZ repeat_extend_forward_end_encodeBlockAsm12B matchlen_match1_repeat_extend_encodeBlockAsm12B: - CMPL R8, $0x01 - JB repeat_extend_forward_end_encodeBlockAsm12B MOVB (R9)(R11*1), R10 CMPB (BX)(R11*1), R10 JNE repeat_extend_forward_end_encodeBlockAsm12B @@ -3333,7 +3328,6 @@ matchlen_loop_match_nolit_encodeBlockAsm12B: LEAL 8(R9), R9 CMPL SI, $0x08 JAE matchlen_loopback_match_nolit_encodeBlockAsm12B - JZ match_nolit_end_encodeBlockAsm12B matchlen_match4_match_nolit_encodeBlockAsm12B: CMPL SI, $0x04 @@ -3341,21 +3335,21 @@ matchlen_match4_match_nolit_encodeBlockAsm12B: MOVL (DI)(R9*1), R8 CMPL (BX)(R9*1), R8 JNE matchlen_match2_match_nolit_encodeBlockAsm12B - SUBL $0x04, SI + LEAL -4(SI), SI LEAL 4(R9), R9 matchlen_match2_match_nolit_encodeBlockAsm12B: - CMPL SI, $0x02 - JB matchlen_match1_match_nolit_encodeBlockAsm12B + CMPL SI, $0x01 + JE matchlen_match1_match_nolit_encodeBlockAsm12B + JB match_nolit_end_encodeBlockAsm12B MOVW (DI)(R9*1), R8 CMPW (BX)(R9*1), R8 JNE matchlen_match1_match_nolit_encodeBlockAsm12B - SUBL $0x02, SI LEAL 2(R9), R9 + SUBL $0x02, SI + JZ match_nolit_end_encodeBlockAsm12B matchlen_match1_match_nolit_encodeBlockAsm12B: - CMPL SI, $0x01 - JB match_nolit_end_encodeBlockAsm12B MOVB (DI)(R9*1), R8 CMPB (BX)(R9*1), R8 JNE match_nolit_end_encodeBlockAsm12B @@ -3935,7 +3929,6 @@ matchlen_loop_repeat_extend_encodeBlockAsm10B: LEAL 8(R11), R11 CMPL R8, $0x08 JAE matchlen_loopback_repeat_extend_encodeBlockAsm10B - JZ repeat_extend_forward_end_encodeBlockAsm10B matchlen_match4_repeat_extend_encodeBlockAsm10B: CMPL R8, $0x04 @@ -3943,21 +3936,21 @@ matchlen_match4_repeat_extend_encodeBlockAsm10B: MOVL (R9)(R11*1), R10 CMPL (BX)(R11*1), R10 JNE matchlen_match2_repeat_extend_encodeBlockAsm10B - SUBL $0x04, R8 + LEAL -4(R8), R8 LEAL 4(R11), R11 matchlen_match2_repeat_extend_encodeBlockAsm10B: - CMPL R8, $0x02 - JB matchlen_match1_repeat_extend_encodeBlockAsm10B + CMPL R8, $0x01 + JE matchlen_match1_repeat_extend_encodeBlockAsm10B + JB repeat_extend_forward_end_encodeBlockAsm10B MOVW (R9)(R11*1), R10 CMPW (BX)(R11*1), R10 JNE matchlen_match1_repeat_extend_encodeBlockAsm10B - SUBL $0x02, R8 LEAL 2(R11), R11 + SUBL $0x02, R8 + JZ repeat_extend_forward_end_encodeBlockAsm10B matchlen_match1_repeat_extend_encodeBlockAsm10B: - CMPL R8, $0x01 - JB repeat_extend_forward_end_encodeBlockAsm10B MOVB (R9)(R11*1), R10 CMPB (BX)(R11*1), R10 JNE repeat_extend_forward_end_encodeBlockAsm10B @@ -4366,7 +4359,6 @@ matchlen_loop_match_nolit_encodeBlockAsm10B: LEAL 8(R9), R9 CMPL SI, $0x08 JAE matchlen_loopback_match_nolit_encodeBlockAsm10B - JZ match_nolit_end_encodeBlockAsm10B matchlen_match4_match_nolit_encodeBlockAsm10B: CMPL SI, $0x04 @@ -4374,21 +4366,21 @@ matchlen_match4_match_nolit_encodeBlockAsm10B: MOVL (DI)(R9*1), R8 CMPL (BX)(R9*1), R8 JNE matchlen_match2_match_nolit_encodeBlockAsm10B - SUBL $0x04, SI + LEAL -4(SI), SI LEAL 4(R9), R9 matchlen_match2_match_nolit_encodeBlockAsm10B: - CMPL SI, $0x02 - JB matchlen_match1_match_nolit_encodeBlockAsm10B + CMPL SI, $0x01 + JE matchlen_match1_match_nolit_encodeBlockAsm10B + JB match_nolit_end_encodeBlockAsm10B MOVW (DI)(R9*1), R8 CMPW (BX)(R9*1), R8 JNE matchlen_match1_match_nolit_encodeBlockAsm10B - SUBL $0x02, SI LEAL 2(R9), R9 + SUBL $0x02, SI + JZ match_nolit_end_encodeBlockAsm10B matchlen_match1_match_nolit_encodeBlockAsm10B: - CMPL SI, $0x01 - JB match_nolit_end_encodeBlockAsm10B MOVB (DI)(R9*1), R8 CMPB (BX)(R9*1), R8 JNE match_nolit_end_encodeBlockAsm10B @@ -4968,7 +4960,6 @@ matchlen_loop_repeat_extend_encodeBlockAsm8B: LEAL 8(R11), R11 CMPL R8, $0x08 JAE matchlen_loopback_repeat_extend_encodeBlockAsm8B - JZ repeat_extend_forward_end_encodeBlockAsm8B matchlen_match4_repeat_extend_encodeBlockAsm8B: CMPL R8, $0x04 @@ -4976,21 +4967,21 @@ matchlen_match4_repeat_extend_encodeBlockAsm8B: MOVL (R9)(R11*1), R10 CMPL (BX)(R11*1), R10 JNE matchlen_match2_repeat_extend_encodeBlockAsm8B - SUBL $0x04, R8 + LEAL -4(R8), R8 LEAL 4(R11), R11 matchlen_match2_repeat_extend_encodeBlockAsm8B: - CMPL R8, $0x02 - JB matchlen_match1_repeat_extend_encodeBlockAsm8B + CMPL R8, $0x01 + JE matchlen_match1_repeat_extend_encodeBlockAsm8B + JB repeat_extend_forward_end_encodeBlockAsm8B MOVW (R9)(R11*1), R10 CMPW (BX)(R11*1), R10 JNE matchlen_match1_repeat_extend_encodeBlockAsm8B - SUBL $0x02, R8 LEAL 2(R11), R11 + SUBL $0x02, R8 + JZ repeat_extend_forward_end_encodeBlockAsm8B matchlen_match1_repeat_extend_encodeBlockAsm8B: - CMPL R8, $0x01 - JB repeat_extend_forward_end_encodeBlockAsm8B MOVB (R9)(R11*1), R10 CMPB (BX)(R11*1), R10 JNE repeat_extend_forward_end_encodeBlockAsm8B @@ -5385,7 +5376,6 @@ matchlen_loop_match_nolit_encodeBlockAsm8B: LEAL 8(R9), R9 CMPL SI, $0x08 JAE matchlen_loopback_match_nolit_encodeBlockAsm8B - JZ match_nolit_end_encodeBlockAsm8B matchlen_match4_match_nolit_encodeBlockAsm8B: CMPL SI, $0x04 @@ -5393,21 +5383,21 @@ matchlen_match4_match_nolit_encodeBlockAsm8B: MOVL (DI)(R9*1), R8 CMPL (BX)(R9*1), R8 JNE matchlen_match2_match_nolit_encodeBlockAsm8B - SUBL $0x04, SI + LEAL -4(SI), SI LEAL 4(R9), R9 matchlen_match2_match_nolit_encodeBlockAsm8B: - CMPL SI, $0x02 - JB matchlen_match1_match_nolit_encodeBlockAsm8B + CMPL SI, $0x01 + JE matchlen_match1_match_nolit_encodeBlockAsm8B + JB match_nolit_end_encodeBlockAsm8B MOVW (DI)(R9*1), R8 CMPW (BX)(R9*1), R8 JNE matchlen_match1_match_nolit_encodeBlockAsm8B - SUBL $0x02, SI LEAL 2(R9), R9 + SUBL $0x02, SI + JZ match_nolit_end_encodeBlockAsm8B matchlen_match1_match_nolit_encodeBlockAsm8B: - CMPL SI, $0x01 - JB match_nolit_end_encodeBlockAsm8B MOVB (DI)(R9*1), R8 CMPB (BX)(R9*1), R8 JNE match_nolit_end_encodeBlockAsm8B @@ -5889,7 +5879,6 @@ matchlen_loop_match_nolit_encodeBetterBlockAsm: LEAL 8(R11), R11 CMPL DI, $0x08 JAE matchlen_loopback_match_nolit_encodeBetterBlockAsm - JZ match_nolit_end_encodeBetterBlockAsm matchlen_match4_match_nolit_encodeBetterBlockAsm: CMPL DI, $0x04 @@ -5897,21 +5886,21 @@ matchlen_match4_match_nolit_encodeBetterBlockAsm: MOVL (R8)(R11*1), R10 CMPL (R9)(R11*1), R10 JNE matchlen_match2_match_nolit_encodeBetterBlockAsm - SUBL $0x04, DI + LEAL -4(DI), DI LEAL 4(R11), R11 matchlen_match2_match_nolit_encodeBetterBlockAsm: - CMPL DI, $0x02 - JB matchlen_match1_match_nolit_encodeBetterBlockAsm + CMPL DI, $0x01 + JE matchlen_match1_match_nolit_encodeBetterBlockAsm + JB match_nolit_end_encodeBetterBlockAsm MOVW (R8)(R11*1), R10 CMPW (R9)(R11*1), R10 JNE matchlen_match1_match_nolit_encodeBetterBlockAsm - SUBL $0x02, DI LEAL 2(R11), R11 + SUBL $0x02, DI + JZ match_nolit_end_encodeBetterBlockAsm matchlen_match1_match_nolit_encodeBetterBlockAsm: - CMPL DI, $0x01 - JB match_nolit_end_encodeBetterBlockAsm MOVB (R8)(R11*1), R10 CMPB (R9)(R11*1), R10 JNE match_nolit_end_encodeBetterBlockAsm @@ -6607,24 +6596,26 @@ match_nolit_dst_ok_encodeBetterBlockAsm: MOVL R8, 24(SP)(R11*4) MOVL DI, 524312(SP)(R10*4) MOVL R13, 524312(SP)(R12*4) + LEAQ 1(R8)(SI*1), DI + SHRQ $0x01, DI ADDQ $0x01, SI SUBQ $0x01, R8 index_loop_encodeBetterBlockAsm: - CMPQ SI, R8 + CMPQ DI, R8 JAE search_loop_encodeBetterBlockAsm - MOVQ (DX)(SI*1), DI - MOVQ (DX)(R8*1), R9 - SHLQ $0x08, DI - IMULQ BX, DI - SHRQ $0x2f, DI + MOVQ (DX)(SI*1), R9 + MOVQ (DX)(DI*1), R10 SHLQ $0x08, R9 IMULQ BX, R9 SHRQ $0x2f, R9 - MOVL SI, 24(SP)(DI*4) - MOVL R8, 24(SP)(R9*4) + SHLQ $0x08, R10 + IMULQ BX, R10 + SHRQ $0x2f, R10 + MOVL SI, 24(SP)(R9*4) + MOVL DI, 24(SP)(R10*4) ADDQ $0x02, SI - SUBQ $0x02, R8 + ADDQ $0x02, DI JMP index_loop_encodeBetterBlockAsm emit_remainder_encodeBetterBlockAsm: @@ -6960,7 +6951,6 @@ matchlen_loop_match_nolit_encodeBetterBlockAsm4MB: LEAL 8(R11), R11 CMPL DI, $0x08 JAE matchlen_loopback_match_nolit_encodeBetterBlockAsm4MB - JZ match_nolit_end_encodeBetterBlockAsm4MB matchlen_match4_match_nolit_encodeBetterBlockAsm4MB: CMPL DI, $0x04 @@ -6968,21 +6958,21 @@ matchlen_match4_match_nolit_encodeBetterBlockAsm4MB: MOVL (R8)(R11*1), R10 CMPL (R9)(R11*1), R10 JNE matchlen_match2_match_nolit_encodeBetterBlockAsm4MB - SUBL $0x04, DI + LEAL -4(DI), DI LEAL 4(R11), R11 matchlen_match2_match_nolit_encodeBetterBlockAsm4MB: - CMPL DI, $0x02 - JB matchlen_match1_match_nolit_encodeBetterBlockAsm4MB + CMPL DI, $0x01 + JE matchlen_match1_match_nolit_encodeBetterBlockAsm4MB + JB match_nolit_end_encodeBetterBlockAsm4MB MOVW (R8)(R11*1), R10 CMPW (R9)(R11*1), R10 JNE matchlen_match1_match_nolit_encodeBetterBlockAsm4MB - SUBL $0x02, DI LEAL 2(R11), R11 + SUBL $0x02, DI + JZ match_nolit_end_encodeBetterBlockAsm4MB matchlen_match1_match_nolit_encodeBetterBlockAsm4MB: - CMPL DI, $0x01 - JB match_nolit_end_encodeBetterBlockAsm4MB MOVB (R8)(R11*1), R10 CMPB (R9)(R11*1), R10 JNE match_nolit_end_encodeBetterBlockAsm4MB @@ -7620,24 +7610,26 @@ match_nolit_dst_ok_encodeBetterBlockAsm4MB: MOVL R8, 24(SP)(R11*4) MOVL DI, 524312(SP)(R10*4) MOVL R13, 524312(SP)(R12*4) + LEAQ 1(R8)(SI*1), DI + SHRQ $0x01, DI ADDQ $0x01, SI SUBQ $0x01, R8 index_loop_encodeBetterBlockAsm4MB: - CMPQ SI, R8 + CMPQ DI, R8 JAE search_loop_encodeBetterBlockAsm4MB - MOVQ (DX)(SI*1), DI - MOVQ (DX)(R8*1), R9 - SHLQ $0x08, DI - IMULQ BX, DI - SHRQ $0x2f, DI + MOVQ (DX)(SI*1), R9 + MOVQ (DX)(DI*1), R10 SHLQ $0x08, R9 IMULQ BX, R9 SHRQ $0x2f, R9 - MOVL SI, 24(SP)(DI*4) - MOVL R8, 24(SP)(R9*4) + SHLQ $0x08, R10 + IMULQ BX, R10 + SHRQ $0x2f, R10 + MOVL SI, 24(SP)(R9*4) + MOVL DI, 24(SP)(R10*4) ADDQ $0x02, SI - SUBQ $0x02, R8 + ADDQ $0x02, DI JMP index_loop_encodeBetterBlockAsm4MB emit_remainder_encodeBetterBlockAsm4MB: @@ -7957,7 +7949,6 @@ matchlen_loop_match_nolit_encodeBetterBlockAsm12B: LEAL 8(R11), R11 CMPL DI, $0x08 JAE matchlen_loopback_match_nolit_encodeBetterBlockAsm12B - JZ match_nolit_end_encodeBetterBlockAsm12B matchlen_match4_match_nolit_encodeBetterBlockAsm12B: CMPL DI, $0x04 @@ -7965,21 +7956,21 @@ matchlen_match4_match_nolit_encodeBetterBlockAsm12B: MOVL (R8)(R11*1), R10 CMPL (R9)(R11*1), R10 JNE matchlen_match2_match_nolit_encodeBetterBlockAsm12B - SUBL $0x04, DI + LEAL -4(DI), DI LEAL 4(R11), R11 matchlen_match2_match_nolit_encodeBetterBlockAsm12B: - CMPL DI, $0x02 - JB matchlen_match1_match_nolit_encodeBetterBlockAsm12B + CMPL DI, $0x01 + JE matchlen_match1_match_nolit_encodeBetterBlockAsm12B + JB match_nolit_end_encodeBetterBlockAsm12B MOVW (R8)(R11*1), R10 CMPW (R9)(R11*1), R10 JNE matchlen_match1_match_nolit_encodeBetterBlockAsm12B - SUBL $0x02, DI LEAL 2(R11), R11 + SUBL $0x02, DI + JZ match_nolit_end_encodeBetterBlockAsm12B matchlen_match1_match_nolit_encodeBetterBlockAsm12B: - CMPL DI, $0x01 - JB match_nolit_end_encodeBetterBlockAsm12B MOVB (R8)(R11*1), R10 CMPB (R9)(R11*1), R10 JNE match_nolit_end_encodeBetterBlockAsm12B @@ -8478,24 +8469,26 @@ match_nolit_dst_ok_encodeBetterBlockAsm12B: MOVL R8, 24(SP)(R11*4) MOVL DI, 65560(SP)(R10*4) MOVL R13, 65560(SP)(R12*4) + LEAQ 1(R8)(SI*1), DI + SHRQ $0x01, DI ADDQ $0x01, SI SUBQ $0x01, R8 index_loop_encodeBetterBlockAsm12B: - CMPQ SI, R8 + CMPQ DI, R8 JAE search_loop_encodeBetterBlockAsm12B - MOVQ (DX)(SI*1), DI - MOVQ (DX)(R8*1), R9 - SHLQ $0x10, DI - IMULQ BX, DI - SHRQ $0x32, DI + MOVQ (DX)(SI*1), R9 + MOVQ (DX)(DI*1), R10 SHLQ $0x10, R9 IMULQ BX, R9 SHRQ $0x32, R9 - MOVL SI, 24(SP)(DI*4) - MOVL R8, 24(SP)(R9*4) + SHLQ $0x10, R10 + IMULQ BX, R10 + SHRQ $0x32, R10 + MOVL SI, 24(SP)(R9*4) + MOVL DI, 24(SP)(R10*4) ADDQ $0x02, SI - SUBQ $0x02, R8 + ADDQ $0x02, DI JMP index_loop_encodeBetterBlockAsm12B emit_remainder_encodeBetterBlockAsm12B: @@ -8807,7 +8800,6 @@ matchlen_loop_match_nolit_encodeBetterBlockAsm10B: LEAL 8(R11), R11 CMPL DI, $0x08 JAE matchlen_loopback_match_nolit_encodeBetterBlockAsm10B - JZ match_nolit_end_encodeBetterBlockAsm10B matchlen_match4_match_nolit_encodeBetterBlockAsm10B: CMPL DI, $0x04 @@ -8815,21 +8807,21 @@ matchlen_match4_match_nolit_encodeBetterBlockAsm10B: MOVL (R8)(R11*1), R10 CMPL (R9)(R11*1), R10 JNE matchlen_match2_match_nolit_encodeBetterBlockAsm10B - SUBL $0x04, DI + LEAL -4(DI), DI LEAL 4(R11), R11 matchlen_match2_match_nolit_encodeBetterBlockAsm10B: - CMPL DI, $0x02 - JB matchlen_match1_match_nolit_encodeBetterBlockAsm10B + CMPL DI, $0x01 + JE matchlen_match1_match_nolit_encodeBetterBlockAsm10B + JB match_nolit_end_encodeBetterBlockAsm10B MOVW (R8)(R11*1), R10 CMPW (R9)(R11*1), R10 JNE matchlen_match1_match_nolit_encodeBetterBlockAsm10B - SUBL $0x02, DI LEAL 2(R11), R11 + SUBL $0x02, DI + JZ match_nolit_end_encodeBetterBlockAsm10B matchlen_match1_match_nolit_encodeBetterBlockAsm10B: - CMPL DI, $0x01 - JB match_nolit_end_encodeBetterBlockAsm10B MOVB (R8)(R11*1), R10 CMPB (R9)(R11*1), R10 JNE match_nolit_end_encodeBetterBlockAsm10B @@ -9328,24 +9320,26 @@ match_nolit_dst_ok_encodeBetterBlockAsm10B: MOVL R8, 24(SP)(R11*4) MOVL DI, 16408(SP)(R10*4) MOVL R13, 16408(SP)(R12*4) + LEAQ 1(R8)(SI*1), DI + SHRQ $0x01, DI ADDQ $0x01, SI SUBQ $0x01, R8 index_loop_encodeBetterBlockAsm10B: - CMPQ SI, R8 + CMPQ DI, R8 JAE search_loop_encodeBetterBlockAsm10B - MOVQ (DX)(SI*1), DI - MOVQ (DX)(R8*1), R9 - SHLQ $0x10, DI - IMULQ BX, DI - SHRQ $0x34, DI + MOVQ (DX)(SI*1), R9 + MOVQ (DX)(DI*1), R10 SHLQ $0x10, R9 IMULQ BX, R9 SHRQ $0x34, R9 - MOVL SI, 24(SP)(DI*4) - MOVL R8, 24(SP)(R9*4) + SHLQ $0x10, R10 + IMULQ BX, R10 + SHRQ $0x34, R10 + MOVL SI, 24(SP)(R9*4) + MOVL DI, 24(SP)(R10*4) ADDQ $0x02, SI - SUBQ $0x02, R8 + ADDQ $0x02, DI JMP index_loop_encodeBetterBlockAsm10B emit_remainder_encodeBetterBlockAsm10B: @@ -9657,7 +9651,6 @@ matchlen_loop_match_nolit_encodeBetterBlockAsm8B: LEAL 8(R11), R11 CMPL DI, $0x08 JAE matchlen_loopback_match_nolit_encodeBetterBlockAsm8B - JZ match_nolit_end_encodeBetterBlockAsm8B matchlen_match4_match_nolit_encodeBetterBlockAsm8B: CMPL DI, $0x04 @@ -9665,21 +9658,21 @@ matchlen_match4_match_nolit_encodeBetterBlockAsm8B: MOVL (R8)(R11*1), R10 CMPL (R9)(R11*1), R10 JNE matchlen_match2_match_nolit_encodeBetterBlockAsm8B - SUBL $0x04, DI + LEAL -4(DI), DI LEAL 4(R11), R11 matchlen_match2_match_nolit_encodeBetterBlockAsm8B: - CMPL DI, $0x02 - JB matchlen_match1_match_nolit_encodeBetterBlockAsm8B + CMPL DI, $0x01 + JE matchlen_match1_match_nolit_encodeBetterBlockAsm8B + JB match_nolit_end_encodeBetterBlockAsm8B MOVW (R8)(R11*1), R10 CMPW (R9)(R11*1), R10 JNE matchlen_match1_match_nolit_encodeBetterBlockAsm8B - SUBL $0x02, DI LEAL 2(R11), R11 + SUBL $0x02, DI + JZ match_nolit_end_encodeBetterBlockAsm8B matchlen_match1_match_nolit_encodeBetterBlockAsm8B: - CMPL DI, $0x01 - JB match_nolit_end_encodeBetterBlockAsm8B MOVB (R8)(R11*1), R10 CMPB (R9)(R11*1), R10 JNE match_nolit_end_encodeBetterBlockAsm8B @@ -10164,24 +10157,26 @@ match_nolit_dst_ok_encodeBetterBlockAsm8B: MOVL R8, 24(SP)(R11*4) MOVL DI, 4120(SP)(R10*4) MOVL R13, 4120(SP)(R12*4) + LEAQ 1(R8)(SI*1), DI + SHRQ $0x01, DI ADDQ $0x01, SI SUBQ $0x01, R8 index_loop_encodeBetterBlockAsm8B: - CMPQ SI, R8 + CMPQ DI, R8 JAE search_loop_encodeBetterBlockAsm8B - MOVQ (DX)(SI*1), DI - MOVQ (DX)(R8*1), R9 - SHLQ $0x10, DI - IMULQ BX, DI - SHRQ $0x36, DI + MOVQ (DX)(SI*1), R9 + MOVQ (DX)(DI*1), R10 SHLQ $0x10, R9 IMULQ BX, R9 SHRQ $0x36, R9 - MOVL SI, 24(SP)(DI*4) - MOVL R8, 24(SP)(R9*4) + SHLQ $0x10, R10 + IMULQ BX, R10 + SHRQ $0x36, R10 + MOVL SI, 24(SP)(R9*4) + MOVL DI, 24(SP)(R10*4) ADDQ $0x02, SI - SUBQ $0x02, R8 + ADDQ $0x02, DI JMP index_loop_encodeBetterBlockAsm8B emit_remainder_encodeBetterBlockAsm8B: @@ -10605,7 +10600,6 @@ matchlen_loop_repeat_extend_encodeSnappyBlockAsm: LEAL 8(R10), R10 CMPL DI, $0x08 JAE matchlen_loopback_repeat_extend_encodeSnappyBlockAsm - JZ repeat_extend_forward_end_encodeSnappyBlockAsm matchlen_match4_repeat_extend_encodeSnappyBlockAsm: CMPL DI, $0x04 @@ -10613,21 +10607,21 @@ matchlen_match4_repeat_extend_encodeSnappyBlockAsm: MOVL (R8)(R10*1), R9 CMPL (BX)(R10*1), R9 JNE matchlen_match2_repeat_extend_encodeSnappyBlockAsm - SUBL $0x04, DI + LEAL -4(DI), DI LEAL 4(R10), R10 matchlen_match2_repeat_extend_encodeSnappyBlockAsm: - CMPL DI, $0x02 - JB matchlen_match1_repeat_extend_encodeSnappyBlockAsm + CMPL DI, $0x01 + JE matchlen_match1_repeat_extend_encodeSnappyBlockAsm + JB repeat_extend_forward_end_encodeSnappyBlockAsm MOVW (R8)(R10*1), R9 CMPW (BX)(R10*1), R9 JNE matchlen_match1_repeat_extend_encodeSnappyBlockAsm - SUBL $0x02, DI LEAL 2(R10), R10 + SUBL $0x02, DI + JZ repeat_extend_forward_end_encodeSnappyBlockAsm matchlen_match1_repeat_extend_encodeSnappyBlockAsm: - CMPL DI, $0x01 - JB repeat_extend_forward_end_encodeSnappyBlockAsm MOVB (R8)(R10*1), R9 CMPB (BX)(R10*1), R9 JNE repeat_extend_forward_end_encodeSnappyBlockAsm @@ -10928,7 +10922,6 @@ matchlen_loop_match_nolit_encodeSnappyBlockAsm: LEAL 8(R9), R9 CMPL SI, $0x08 JAE matchlen_loopback_match_nolit_encodeSnappyBlockAsm - JZ match_nolit_end_encodeSnappyBlockAsm matchlen_match4_match_nolit_encodeSnappyBlockAsm: CMPL SI, $0x04 @@ -10936,21 +10929,21 @@ matchlen_match4_match_nolit_encodeSnappyBlockAsm: MOVL (DI)(R9*1), R8 CMPL (BX)(R9*1), R8 JNE matchlen_match2_match_nolit_encodeSnappyBlockAsm - SUBL $0x04, SI + LEAL -4(SI), SI LEAL 4(R9), R9 matchlen_match2_match_nolit_encodeSnappyBlockAsm: - CMPL SI, $0x02 - JB matchlen_match1_match_nolit_encodeSnappyBlockAsm + CMPL SI, $0x01 + JE matchlen_match1_match_nolit_encodeSnappyBlockAsm + JB match_nolit_end_encodeSnappyBlockAsm MOVW (DI)(R9*1), R8 CMPW (BX)(R9*1), R8 JNE matchlen_match1_match_nolit_encodeSnappyBlockAsm - SUBL $0x02, SI LEAL 2(R9), R9 + SUBL $0x02, SI + JZ match_nolit_end_encodeSnappyBlockAsm matchlen_match1_match_nolit_encodeSnappyBlockAsm: - CMPL SI, $0x01 - JB match_nolit_end_encodeSnappyBlockAsm MOVB (DI)(R9*1), R8 CMPB (BX)(R9*1), R8 JNE match_nolit_end_encodeSnappyBlockAsm @@ -11469,7 +11462,6 @@ matchlen_loop_repeat_extend_encodeSnappyBlockAsm64K: LEAL 8(R10), R10 CMPL DI, $0x08 JAE matchlen_loopback_repeat_extend_encodeSnappyBlockAsm64K - JZ repeat_extend_forward_end_encodeSnappyBlockAsm64K matchlen_match4_repeat_extend_encodeSnappyBlockAsm64K: CMPL DI, $0x04 @@ -11477,21 +11469,21 @@ matchlen_match4_repeat_extend_encodeSnappyBlockAsm64K: MOVL (R8)(R10*1), R9 CMPL (BX)(R10*1), R9 JNE matchlen_match2_repeat_extend_encodeSnappyBlockAsm64K - SUBL $0x04, DI + LEAL -4(DI), DI LEAL 4(R10), R10 matchlen_match2_repeat_extend_encodeSnappyBlockAsm64K: - CMPL DI, $0x02 - JB matchlen_match1_repeat_extend_encodeSnappyBlockAsm64K + CMPL DI, $0x01 + JE matchlen_match1_repeat_extend_encodeSnappyBlockAsm64K + JB repeat_extend_forward_end_encodeSnappyBlockAsm64K MOVW (R8)(R10*1), R9 CMPW (BX)(R10*1), R9 JNE matchlen_match1_repeat_extend_encodeSnappyBlockAsm64K - SUBL $0x02, DI LEAL 2(R10), R10 + SUBL $0x02, DI + JZ repeat_extend_forward_end_encodeSnappyBlockAsm64K matchlen_match1_repeat_extend_encodeSnappyBlockAsm64K: - CMPL DI, $0x01 - JB repeat_extend_forward_end_encodeSnappyBlockAsm64K MOVB (R8)(R10*1), R9 CMPB (BX)(R10*1), R9 JNE repeat_extend_forward_end_encodeSnappyBlockAsm64K @@ -11752,7 +11744,6 @@ matchlen_loop_match_nolit_encodeSnappyBlockAsm64K: LEAL 8(R9), R9 CMPL SI, $0x08 JAE matchlen_loopback_match_nolit_encodeSnappyBlockAsm64K - JZ match_nolit_end_encodeSnappyBlockAsm64K matchlen_match4_match_nolit_encodeSnappyBlockAsm64K: CMPL SI, $0x04 @@ -11760,21 +11751,21 @@ matchlen_match4_match_nolit_encodeSnappyBlockAsm64K: MOVL (DI)(R9*1), R8 CMPL (BX)(R9*1), R8 JNE matchlen_match2_match_nolit_encodeSnappyBlockAsm64K - SUBL $0x04, SI + LEAL -4(SI), SI LEAL 4(R9), R9 matchlen_match2_match_nolit_encodeSnappyBlockAsm64K: - CMPL SI, $0x02 - JB matchlen_match1_match_nolit_encodeSnappyBlockAsm64K + CMPL SI, $0x01 + JE matchlen_match1_match_nolit_encodeSnappyBlockAsm64K + JB match_nolit_end_encodeSnappyBlockAsm64K MOVW (DI)(R9*1), R8 CMPW (BX)(R9*1), R8 JNE matchlen_match1_match_nolit_encodeSnappyBlockAsm64K - SUBL $0x02, SI LEAL 2(R9), R9 + SUBL $0x02, SI + JZ match_nolit_end_encodeSnappyBlockAsm64K matchlen_match1_match_nolit_encodeSnappyBlockAsm64K: - CMPL SI, $0x01 - JB match_nolit_end_encodeSnappyBlockAsm64K MOVB (DI)(R9*1), R8 CMPB (BX)(R9*1), R8 JNE match_nolit_end_encodeSnappyBlockAsm64K @@ -12253,7 +12244,6 @@ matchlen_loop_repeat_extend_encodeSnappyBlockAsm12B: LEAL 8(R10), R10 CMPL DI, $0x08 JAE matchlen_loopback_repeat_extend_encodeSnappyBlockAsm12B - JZ repeat_extend_forward_end_encodeSnappyBlockAsm12B matchlen_match4_repeat_extend_encodeSnappyBlockAsm12B: CMPL DI, $0x04 @@ -12261,21 +12251,21 @@ matchlen_match4_repeat_extend_encodeSnappyBlockAsm12B: MOVL (R8)(R10*1), R9 CMPL (BX)(R10*1), R9 JNE matchlen_match2_repeat_extend_encodeSnappyBlockAsm12B - SUBL $0x04, DI + LEAL -4(DI), DI LEAL 4(R10), R10 matchlen_match2_repeat_extend_encodeSnappyBlockAsm12B: - CMPL DI, $0x02 - JB matchlen_match1_repeat_extend_encodeSnappyBlockAsm12B + CMPL DI, $0x01 + JE matchlen_match1_repeat_extend_encodeSnappyBlockAsm12B + JB repeat_extend_forward_end_encodeSnappyBlockAsm12B MOVW (R8)(R10*1), R9 CMPW (BX)(R10*1), R9 JNE matchlen_match1_repeat_extend_encodeSnappyBlockAsm12B - SUBL $0x02, DI LEAL 2(R10), R10 + SUBL $0x02, DI + JZ repeat_extend_forward_end_encodeSnappyBlockAsm12B matchlen_match1_repeat_extend_encodeSnappyBlockAsm12B: - CMPL DI, $0x01 - JB repeat_extend_forward_end_encodeSnappyBlockAsm12B MOVB (R8)(R10*1), R9 CMPB (BX)(R10*1), R9 JNE repeat_extend_forward_end_encodeSnappyBlockAsm12B @@ -12536,7 +12526,6 @@ matchlen_loop_match_nolit_encodeSnappyBlockAsm12B: LEAL 8(R9), R9 CMPL SI, $0x08 JAE matchlen_loopback_match_nolit_encodeSnappyBlockAsm12B - JZ match_nolit_end_encodeSnappyBlockAsm12B matchlen_match4_match_nolit_encodeSnappyBlockAsm12B: CMPL SI, $0x04 @@ -12544,21 +12533,21 @@ matchlen_match4_match_nolit_encodeSnappyBlockAsm12B: MOVL (DI)(R9*1), R8 CMPL (BX)(R9*1), R8 JNE matchlen_match2_match_nolit_encodeSnappyBlockAsm12B - SUBL $0x04, SI + LEAL -4(SI), SI LEAL 4(R9), R9 matchlen_match2_match_nolit_encodeSnappyBlockAsm12B: - CMPL SI, $0x02 - JB matchlen_match1_match_nolit_encodeSnappyBlockAsm12B + CMPL SI, $0x01 + JE matchlen_match1_match_nolit_encodeSnappyBlockAsm12B + JB match_nolit_end_encodeSnappyBlockAsm12B MOVW (DI)(R9*1), R8 CMPW (BX)(R9*1), R8 JNE matchlen_match1_match_nolit_encodeSnappyBlockAsm12B - SUBL $0x02, SI LEAL 2(R9), R9 + SUBL $0x02, SI + JZ match_nolit_end_encodeSnappyBlockAsm12B matchlen_match1_match_nolit_encodeSnappyBlockAsm12B: - CMPL SI, $0x01 - JB match_nolit_end_encodeSnappyBlockAsm12B MOVB (DI)(R9*1), R8 CMPB (BX)(R9*1), R8 JNE match_nolit_end_encodeSnappyBlockAsm12B @@ -13037,7 +13026,6 @@ matchlen_loop_repeat_extend_encodeSnappyBlockAsm10B: LEAL 8(R10), R10 CMPL DI, $0x08 JAE matchlen_loopback_repeat_extend_encodeSnappyBlockAsm10B - JZ repeat_extend_forward_end_encodeSnappyBlockAsm10B matchlen_match4_repeat_extend_encodeSnappyBlockAsm10B: CMPL DI, $0x04 @@ -13045,21 +13033,21 @@ matchlen_match4_repeat_extend_encodeSnappyBlockAsm10B: MOVL (R8)(R10*1), R9 CMPL (BX)(R10*1), R9 JNE matchlen_match2_repeat_extend_encodeSnappyBlockAsm10B - SUBL $0x04, DI + LEAL -4(DI), DI LEAL 4(R10), R10 matchlen_match2_repeat_extend_encodeSnappyBlockAsm10B: - CMPL DI, $0x02 - JB matchlen_match1_repeat_extend_encodeSnappyBlockAsm10B + CMPL DI, $0x01 + JE matchlen_match1_repeat_extend_encodeSnappyBlockAsm10B + JB repeat_extend_forward_end_encodeSnappyBlockAsm10B MOVW (R8)(R10*1), R9 CMPW (BX)(R10*1), R9 JNE matchlen_match1_repeat_extend_encodeSnappyBlockAsm10B - SUBL $0x02, DI LEAL 2(R10), R10 + SUBL $0x02, DI + JZ repeat_extend_forward_end_encodeSnappyBlockAsm10B matchlen_match1_repeat_extend_encodeSnappyBlockAsm10B: - CMPL DI, $0x01 - JB repeat_extend_forward_end_encodeSnappyBlockAsm10B MOVB (R8)(R10*1), R9 CMPB (BX)(R10*1), R9 JNE repeat_extend_forward_end_encodeSnappyBlockAsm10B @@ -13320,7 +13308,6 @@ matchlen_loop_match_nolit_encodeSnappyBlockAsm10B: LEAL 8(R9), R9 CMPL SI, $0x08 JAE matchlen_loopback_match_nolit_encodeSnappyBlockAsm10B - JZ match_nolit_end_encodeSnappyBlockAsm10B matchlen_match4_match_nolit_encodeSnappyBlockAsm10B: CMPL SI, $0x04 @@ -13328,21 +13315,21 @@ matchlen_match4_match_nolit_encodeSnappyBlockAsm10B: MOVL (DI)(R9*1), R8 CMPL (BX)(R9*1), R8 JNE matchlen_match2_match_nolit_encodeSnappyBlockAsm10B - SUBL $0x04, SI + LEAL -4(SI), SI LEAL 4(R9), R9 matchlen_match2_match_nolit_encodeSnappyBlockAsm10B: - CMPL SI, $0x02 - JB matchlen_match1_match_nolit_encodeSnappyBlockAsm10B + CMPL SI, $0x01 + JE matchlen_match1_match_nolit_encodeSnappyBlockAsm10B + JB match_nolit_end_encodeSnappyBlockAsm10B MOVW (DI)(R9*1), R8 CMPW (BX)(R9*1), R8 JNE matchlen_match1_match_nolit_encodeSnappyBlockAsm10B - SUBL $0x02, SI LEAL 2(R9), R9 + SUBL $0x02, SI + JZ match_nolit_end_encodeSnappyBlockAsm10B matchlen_match1_match_nolit_encodeSnappyBlockAsm10B: - CMPL SI, $0x01 - JB match_nolit_end_encodeSnappyBlockAsm10B MOVB (DI)(R9*1), R8 CMPB (BX)(R9*1), R8 JNE match_nolit_end_encodeSnappyBlockAsm10B @@ -13821,7 +13808,6 @@ matchlen_loop_repeat_extend_encodeSnappyBlockAsm8B: LEAL 8(R10), R10 CMPL DI, $0x08 JAE matchlen_loopback_repeat_extend_encodeSnappyBlockAsm8B - JZ repeat_extend_forward_end_encodeSnappyBlockAsm8B matchlen_match4_repeat_extend_encodeSnappyBlockAsm8B: CMPL DI, $0x04 @@ -13829,21 +13815,21 @@ matchlen_match4_repeat_extend_encodeSnappyBlockAsm8B: MOVL (R8)(R10*1), R9 CMPL (BX)(R10*1), R9 JNE matchlen_match2_repeat_extend_encodeSnappyBlockAsm8B - SUBL $0x04, DI + LEAL -4(DI), DI LEAL 4(R10), R10 matchlen_match2_repeat_extend_encodeSnappyBlockAsm8B: - CMPL DI, $0x02 - JB matchlen_match1_repeat_extend_encodeSnappyBlockAsm8B + CMPL DI, $0x01 + JE matchlen_match1_repeat_extend_encodeSnappyBlockAsm8B + JB repeat_extend_forward_end_encodeSnappyBlockAsm8B MOVW (R8)(R10*1), R9 CMPW (BX)(R10*1), R9 JNE matchlen_match1_repeat_extend_encodeSnappyBlockAsm8B - SUBL $0x02, DI LEAL 2(R10), R10 + SUBL $0x02, DI + JZ repeat_extend_forward_end_encodeSnappyBlockAsm8B matchlen_match1_repeat_extend_encodeSnappyBlockAsm8B: - CMPL DI, $0x01 - JB repeat_extend_forward_end_encodeSnappyBlockAsm8B MOVB (R8)(R10*1), R9 CMPB (BX)(R10*1), R9 JNE repeat_extend_forward_end_encodeSnappyBlockAsm8B @@ -14102,7 +14088,6 @@ matchlen_loop_match_nolit_encodeSnappyBlockAsm8B: LEAL 8(R9), R9 CMPL SI, $0x08 JAE matchlen_loopback_match_nolit_encodeSnappyBlockAsm8B - JZ match_nolit_end_encodeSnappyBlockAsm8B matchlen_match4_match_nolit_encodeSnappyBlockAsm8B: CMPL SI, $0x04 @@ -14110,21 +14095,21 @@ matchlen_match4_match_nolit_encodeSnappyBlockAsm8B: MOVL (DI)(R9*1), R8 CMPL (BX)(R9*1), R8 JNE matchlen_match2_match_nolit_encodeSnappyBlockAsm8B - SUBL $0x04, SI + LEAL -4(SI), SI LEAL 4(R9), R9 matchlen_match2_match_nolit_encodeSnappyBlockAsm8B: - CMPL SI, $0x02 - JB matchlen_match1_match_nolit_encodeSnappyBlockAsm8B + CMPL SI, $0x01 + JE matchlen_match1_match_nolit_encodeSnappyBlockAsm8B + JB match_nolit_end_encodeSnappyBlockAsm8B MOVW (DI)(R9*1), R8 CMPW (BX)(R9*1), R8 JNE matchlen_match1_match_nolit_encodeSnappyBlockAsm8B - SUBL $0x02, SI LEAL 2(R9), R9 + SUBL $0x02, SI + JZ match_nolit_end_encodeSnappyBlockAsm8B matchlen_match1_match_nolit_encodeSnappyBlockAsm8B: - CMPL SI, $0x01 - JB match_nolit_end_encodeSnappyBlockAsm8B MOVB (DI)(R9*1), R8 CMPB (BX)(R9*1), R8 JNE match_nolit_end_encodeSnappyBlockAsm8B @@ -14513,7 +14498,6 @@ matchlen_loop_match_nolit_encodeSnappyBetterBlockAsm: LEAL 8(R11), R11 CMPL DI, $0x08 JAE matchlen_loopback_match_nolit_encodeSnappyBetterBlockAsm - JZ match_nolit_end_encodeSnappyBetterBlockAsm matchlen_match4_match_nolit_encodeSnappyBetterBlockAsm: CMPL DI, $0x04 @@ -14521,21 +14505,21 @@ matchlen_match4_match_nolit_encodeSnappyBetterBlockAsm: MOVL (R8)(R11*1), R10 CMPL (R9)(R11*1), R10 JNE matchlen_match2_match_nolit_encodeSnappyBetterBlockAsm - SUBL $0x04, DI + LEAL -4(DI), DI LEAL 4(R11), R11 matchlen_match2_match_nolit_encodeSnappyBetterBlockAsm: - CMPL DI, $0x02 - JB matchlen_match1_match_nolit_encodeSnappyBetterBlockAsm + CMPL DI, $0x01 + JE matchlen_match1_match_nolit_encodeSnappyBetterBlockAsm + JB match_nolit_end_encodeSnappyBetterBlockAsm MOVW (R8)(R11*1), R10 CMPW (R9)(R11*1), R10 JNE matchlen_match1_match_nolit_encodeSnappyBetterBlockAsm - SUBL $0x02, DI LEAL 2(R11), R11 + SUBL $0x02, DI + JZ match_nolit_end_encodeSnappyBetterBlockAsm matchlen_match1_match_nolit_encodeSnappyBetterBlockAsm: - CMPL DI, $0x01 - JB match_nolit_end_encodeSnappyBetterBlockAsm MOVB (R8)(R11*1), R10 CMPB (R9)(R11*1), R10 JNE match_nolit_end_encodeSnappyBetterBlockAsm @@ -14790,24 +14774,26 @@ match_nolit_dst_ok_encodeSnappyBetterBlockAsm: MOVL R8, 24(SP)(R11*4) MOVL DI, 524312(SP)(R10*4) MOVL R13, 524312(SP)(R12*4) + LEAQ 1(R8)(SI*1), DI + SHRQ $0x01, DI ADDQ $0x01, SI SUBQ $0x01, R8 index_loop_encodeSnappyBetterBlockAsm: - CMPQ SI, R8 + CMPQ DI, R8 JAE search_loop_encodeSnappyBetterBlockAsm - MOVQ (DX)(SI*1), DI - MOVQ (DX)(R8*1), R9 - SHLQ $0x08, DI - IMULQ BX, DI - SHRQ $0x2f, DI + MOVQ (DX)(SI*1), R9 + MOVQ (DX)(DI*1), R10 SHLQ $0x08, R9 IMULQ BX, R9 SHRQ $0x2f, R9 - MOVL SI, 24(SP)(DI*4) - MOVL R8, 24(SP)(R9*4) + SHLQ $0x08, R10 + IMULQ BX, R10 + SHRQ $0x2f, R10 + MOVL SI, 24(SP)(R9*4) + MOVL DI, 24(SP)(R10*4) ADDQ $0x02, SI - SUBQ $0x02, R8 + ADDQ $0x02, DI JMP index_loop_encodeSnappyBetterBlockAsm emit_remainder_encodeSnappyBetterBlockAsm: @@ -15135,7 +15121,6 @@ matchlen_loop_match_nolit_encodeSnappyBetterBlockAsm64K: LEAL 8(R11), R11 CMPL DI, $0x08 JAE matchlen_loopback_match_nolit_encodeSnappyBetterBlockAsm64K - JZ match_nolit_end_encodeSnappyBetterBlockAsm64K matchlen_match4_match_nolit_encodeSnappyBetterBlockAsm64K: CMPL DI, $0x04 @@ -15143,21 +15128,21 @@ matchlen_match4_match_nolit_encodeSnappyBetterBlockAsm64K: MOVL (R8)(R11*1), R10 CMPL (R9)(R11*1), R10 JNE matchlen_match2_match_nolit_encodeSnappyBetterBlockAsm64K - SUBL $0x04, DI + LEAL -4(DI), DI LEAL 4(R11), R11 matchlen_match2_match_nolit_encodeSnappyBetterBlockAsm64K: - CMPL DI, $0x02 - JB matchlen_match1_match_nolit_encodeSnappyBetterBlockAsm64K + CMPL DI, $0x01 + JE matchlen_match1_match_nolit_encodeSnappyBetterBlockAsm64K + JB match_nolit_end_encodeSnappyBetterBlockAsm64K MOVW (R8)(R11*1), R10 CMPW (R9)(R11*1), R10 JNE matchlen_match1_match_nolit_encodeSnappyBetterBlockAsm64K - SUBL $0x02, DI LEAL 2(R11), R11 + SUBL $0x02, DI + JZ match_nolit_end_encodeSnappyBetterBlockAsm64K matchlen_match1_match_nolit_encodeSnappyBetterBlockAsm64K: - CMPL DI, $0x01 - JB match_nolit_end_encodeSnappyBetterBlockAsm64K MOVB (R8)(R11*1), R10 CMPB (R9)(R11*1), R10 JNE match_nolit_end_encodeSnappyBetterBlockAsm64K @@ -15363,24 +15348,26 @@ match_nolit_dst_ok_encodeSnappyBetterBlockAsm64K: MOVL R8, 24(SP)(R11*4) MOVL DI, 262168(SP)(R10*4) MOVL R13, 262168(SP)(R12*4) + LEAQ 1(R8)(SI*1), DI + SHRQ $0x01, DI ADDQ $0x01, SI SUBQ $0x01, R8 index_loop_encodeSnappyBetterBlockAsm64K: - CMPQ SI, R8 + CMPQ DI, R8 JAE search_loop_encodeSnappyBetterBlockAsm64K - MOVQ (DX)(SI*1), DI - MOVQ (DX)(R8*1), R9 - SHLQ $0x08, DI - IMULQ BX, DI - SHRQ $0x30, DI + MOVQ (DX)(SI*1), R9 + MOVQ (DX)(DI*1), R10 SHLQ $0x08, R9 IMULQ BX, R9 SHRQ $0x30, R9 - MOVL SI, 24(SP)(DI*4) - MOVL R8, 24(SP)(R9*4) + SHLQ $0x08, R10 + IMULQ BX, R10 + SHRQ $0x30, R10 + MOVL SI, 24(SP)(R9*4) + MOVL DI, 24(SP)(R10*4) ADDQ $0x02, SI - SUBQ $0x02, R8 + ADDQ $0x02, DI JMP index_loop_encodeSnappyBetterBlockAsm64K emit_remainder_encodeSnappyBetterBlockAsm64K: @@ -15692,7 +15679,6 @@ matchlen_loop_match_nolit_encodeSnappyBetterBlockAsm12B: LEAL 8(R11), R11 CMPL DI, $0x08 JAE matchlen_loopback_match_nolit_encodeSnappyBetterBlockAsm12B - JZ match_nolit_end_encodeSnappyBetterBlockAsm12B matchlen_match4_match_nolit_encodeSnappyBetterBlockAsm12B: CMPL DI, $0x04 @@ -15700,21 +15686,21 @@ matchlen_match4_match_nolit_encodeSnappyBetterBlockAsm12B: MOVL (R8)(R11*1), R10 CMPL (R9)(R11*1), R10 JNE matchlen_match2_match_nolit_encodeSnappyBetterBlockAsm12B - SUBL $0x04, DI + LEAL -4(DI), DI LEAL 4(R11), R11 matchlen_match2_match_nolit_encodeSnappyBetterBlockAsm12B: - CMPL DI, $0x02 - JB matchlen_match1_match_nolit_encodeSnappyBetterBlockAsm12B + CMPL DI, $0x01 + JE matchlen_match1_match_nolit_encodeSnappyBetterBlockAsm12B + JB match_nolit_end_encodeSnappyBetterBlockAsm12B MOVW (R8)(R11*1), R10 CMPW (R9)(R11*1), R10 JNE matchlen_match1_match_nolit_encodeSnappyBetterBlockAsm12B - SUBL $0x02, DI LEAL 2(R11), R11 + SUBL $0x02, DI + JZ match_nolit_end_encodeSnappyBetterBlockAsm12B matchlen_match1_match_nolit_encodeSnappyBetterBlockAsm12B: - CMPL DI, $0x01 - JB match_nolit_end_encodeSnappyBetterBlockAsm12B MOVB (R8)(R11*1), R10 CMPB (R9)(R11*1), R10 JNE match_nolit_end_encodeSnappyBetterBlockAsm12B @@ -15920,24 +15906,26 @@ match_nolit_dst_ok_encodeSnappyBetterBlockAsm12B: MOVL R8, 24(SP)(R11*4) MOVL DI, 65560(SP)(R10*4) MOVL R13, 65560(SP)(R12*4) + LEAQ 1(R8)(SI*1), DI + SHRQ $0x01, DI ADDQ $0x01, SI SUBQ $0x01, R8 index_loop_encodeSnappyBetterBlockAsm12B: - CMPQ SI, R8 + CMPQ DI, R8 JAE search_loop_encodeSnappyBetterBlockAsm12B - MOVQ (DX)(SI*1), DI - MOVQ (DX)(R8*1), R9 - SHLQ $0x10, DI - IMULQ BX, DI - SHRQ $0x32, DI + MOVQ (DX)(SI*1), R9 + MOVQ (DX)(DI*1), R10 SHLQ $0x10, R9 IMULQ BX, R9 SHRQ $0x32, R9 - MOVL SI, 24(SP)(DI*4) - MOVL R8, 24(SP)(R9*4) + SHLQ $0x10, R10 + IMULQ BX, R10 + SHRQ $0x32, R10 + MOVL SI, 24(SP)(R9*4) + MOVL DI, 24(SP)(R10*4) ADDQ $0x02, SI - SUBQ $0x02, R8 + ADDQ $0x02, DI JMP index_loop_encodeSnappyBetterBlockAsm12B emit_remainder_encodeSnappyBetterBlockAsm12B: @@ -16249,7 +16237,6 @@ matchlen_loop_match_nolit_encodeSnappyBetterBlockAsm10B: LEAL 8(R11), R11 CMPL DI, $0x08 JAE matchlen_loopback_match_nolit_encodeSnappyBetterBlockAsm10B - JZ match_nolit_end_encodeSnappyBetterBlockAsm10B matchlen_match4_match_nolit_encodeSnappyBetterBlockAsm10B: CMPL DI, $0x04 @@ -16257,21 +16244,21 @@ matchlen_match4_match_nolit_encodeSnappyBetterBlockAsm10B: MOVL (R8)(R11*1), R10 CMPL (R9)(R11*1), R10 JNE matchlen_match2_match_nolit_encodeSnappyBetterBlockAsm10B - SUBL $0x04, DI + LEAL -4(DI), DI LEAL 4(R11), R11 matchlen_match2_match_nolit_encodeSnappyBetterBlockAsm10B: - CMPL DI, $0x02 - JB matchlen_match1_match_nolit_encodeSnappyBetterBlockAsm10B + CMPL DI, $0x01 + JE matchlen_match1_match_nolit_encodeSnappyBetterBlockAsm10B + JB match_nolit_end_encodeSnappyBetterBlockAsm10B MOVW (R8)(R11*1), R10 CMPW (R9)(R11*1), R10 JNE matchlen_match1_match_nolit_encodeSnappyBetterBlockAsm10B - SUBL $0x02, DI LEAL 2(R11), R11 + SUBL $0x02, DI + JZ match_nolit_end_encodeSnappyBetterBlockAsm10B matchlen_match1_match_nolit_encodeSnappyBetterBlockAsm10B: - CMPL DI, $0x01 - JB match_nolit_end_encodeSnappyBetterBlockAsm10B MOVB (R8)(R11*1), R10 CMPB (R9)(R11*1), R10 JNE match_nolit_end_encodeSnappyBetterBlockAsm10B @@ -16477,24 +16464,26 @@ match_nolit_dst_ok_encodeSnappyBetterBlockAsm10B: MOVL R8, 24(SP)(R11*4) MOVL DI, 16408(SP)(R10*4) MOVL R13, 16408(SP)(R12*4) + LEAQ 1(R8)(SI*1), DI + SHRQ $0x01, DI ADDQ $0x01, SI SUBQ $0x01, R8 index_loop_encodeSnappyBetterBlockAsm10B: - CMPQ SI, R8 + CMPQ DI, R8 JAE search_loop_encodeSnappyBetterBlockAsm10B - MOVQ (DX)(SI*1), DI - MOVQ (DX)(R8*1), R9 - SHLQ $0x10, DI - IMULQ BX, DI - SHRQ $0x34, DI + MOVQ (DX)(SI*1), R9 + MOVQ (DX)(DI*1), R10 SHLQ $0x10, R9 IMULQ BX, R9 SHRQ $0x34, R9 - MOVL SI, 24(SP)(DI*4) - MOVL R8, 24(SP)(R9*4) + SHLQ $0x10, R10 + IMULQ BX, R10 + SHRQ $0x34, R10 + MOVL SI, 24(SP)(R9*4) + MOVL DI, 24(SP)(R10*4) ADDQ $0x02, SI - SUBQ $0x02, R8 + ADDQ $0x02, DI JMP index_loop_encodeSnappyBetterBlockAsm10B emit_remainder_encodeSnappyBetterBlockAsm10B: @@ -16806,7 +16795,6 @@ matchlen_loop_match_nolit_encodeSnappyBetterBlockAsm8B: LEAL 8(R11), R11 CMPL DI, $0x08 JAE matchlen_loopback_match_nolit_encodeSnappyBetterBlockAsm8B - JZ match_nolit_end_encodeSnappyBetterBlockAsm8B matchlen_match4_match_nolit_encodeSnappyBetterBlockAsm8B: CMPL DI, $0x04 @@ -16814,21 +16802,21 @@ matchlen_match4_match_nolit_encodeSnappyBetterBlockAsm8B: MOVL (R8)(R11*1), R10 CMPL (R9)(R11*1), R10 JNE matchlen_match2_match_nolit_encodeSnappyBetterBlockAsm8B - SUBL $0x04, DI + LEAL -4(DI), DI LEAL 4(R11), R11 matchlen_match2_match_nolit_encodeSnappyBetterBlockAsm8B: - CMPL DI, $0x02 - JB matchlen_match1_match_nolit_encodeSnappyBetterBlockAsm8B + CMPL DI, $0x01 + JE matchlen_match1_match_nolit_encodeSnappyBetterBlockAsm8B + JB match_nolit_end_encodeSnappyBetterBlockAsm8B MOVW (R8)(R11*1), R10 CMPW (R9)(R11*1), R10 JNE matchlen_match1_match_nolit_encodeSnappyBetterBlockAsm8B - SUBL $0x02, DI LEAL 2(R11), R11 + SUBL $0x02, DI + JZ match_nolit_end_encodeSnappyBetterBlockAsm8B matchlen_match1_match_nolit_encodeSnappyBetterBlockAsm8B: - CMPL DI, $0x01 - JB match_nolit_end_encodeSnappyBetterBlockAsm8B MOVB (R8)(R11*1), R10 CMPB (R9)(R11*1), R10 JNE match_nolit_end_encodeSnappyBetterBlockAsm8B @@ -17032,24 +17020,26 @@ match_nolit_dst_ok_encodeSnappyBetterBlockAsm8B: MOVL R8, 24(SP)(R11*4) MOVL DI, 4120(SP)(R10*4) MOVL R13, 4120(SP)(R12*4) + LEAQ 1(R8)(SI*1), DI + SHRQ $0x01, DI ADDQ $0x01, SI SUBQ $0x01, R8 index_loop_encodeSnappyBetterBlockAsm8B: - CMPQ SI, R8 + CMPQ DI, R8 JAE search_loop_encodeSnappyBetterBlockAsm8B - MOVQ (DX)(SI*1), DI - MOVQ (DX)(R8*1), R9 - SHLQ $0x10, DI - IMULQ BX, DI - SHRQ $0x36, DI + MOVQ (DX)(SI*1), R9 + MOVQ (DX)(DI*1), R10 SHLQ $0x10, R9 IMULQ BX, R9 SHRQ $0x36, R9 - MOVL SI, 24(SP)(DI*4) - MOVL R8, 24(SP)(R9*4) + SHLQ $0x10, R10 + IMULQ BX, R10 + SHRQ $0x36, R10 + MOVL SI, 24(SP)(R9*4) + MOVL DI, 24(SP)(R10*4) ADDQ $0x02, SI - SUBQ $0x02, R8 + ADDQ $0x02, DI JMP index_loop_encodeSnappyBetterBlockAsm8B emit_remainder_encodeSnappyBetterBlockAsm8B: @@ -17378,7 +17368,6 @@ matchlen_loop_repeat_extend_calcBlockSize: LEAL 8(R10), R10 CMPL DI, $0x08 JAE matchlen_loopback_repeat_extend_calcBlockSize - JZ repeat_extend_forward_end_calcBlockSize matchlen_match4_repeat_extend_calcBlockSize: CMPL DI, $0x04 @@ -17386,21 +17375,21 @@ matchlen_match4_repeat_extend_calcBlockSize: MOVL (R8)(R10*1), R9 CMPL (BX)(R10*1), R9 JNE matchlen_match2_repeat_extend_calcBlockSize - SUBL $0x04, DI + LEAL -4(DI), DI LEAL 4(R10), R10 matchlen_match2_repeat_extend_calcBlockSize: - CMPL DI, $0x02 - JB matchlen_match1_repeat_extend_calcBlockSize + CMPL DI, $0x01 + JE matchlen_match1_repeat_extend_calcBlockSize + JB repeat_extend_forward_end_calcBlockSize MOVW (R8)(R10*1), R9 CMPW (BX)(R10*1), R9 JNE matchlen_match1_repeat_extend_calcBlockSize - SUBL $0x02, DI LEAL 2(R10), R10 + SUBL $0x02, DI + JZ repeat_extend_forward_end_calcBlockSize matchlen_match1_repeat_extend_calcBlockSize: - CMPL DI, $0x01 - JB repeat_extend_forward_end_calcBlockSize MOVB (R8)(R10*1), R9 CMPB (BX)(R10*1), R9 JNE repeat_extend_forward_end_calcBlockSize @@ -17590,7 +17579,6 @@ matchlen_loop_match_nolit_calcBlockSize: LEAL 8(R9), R9 CMPL SI, $0x08 JAE matchlen_loopback_match_nolit_calcBlockSize - JZ match_nolit_end_calcBlockSize matchlen_match4_match_nolit_calcBlockSize: CMPL SI, $0x04 @@ -17598,21 +17586,21 @@ matchlen_match4_match_nolit_calcBlockSize: MOVL (DI)(R9*1), R8 CMPL (BX)(R9*1), R8 JNE matchlen_match2_match_nolit_calcBlockSize - SUBL $0x04, SI + LEAL -4(SI), SI LEAL 4(R9), R9 matchlen_match2_match_nolit_calcBlockSize: - CMPL SI, $0x02 - JB matchlen_match1_match_nolit_calcBlockSize + CMPL SI, $0x01 + JE matchlen_match1_match_nolit_calcBlockSize + JB match_nolit_end_calcBlockSize MOVW (DI)(R9*1), R8 CMPW (BX)(R9*1), R8 JNE matchlen_match1_match_nolit_calcBlockSize - SUBL $0x02, SI LEAL 2(R9), R9 + SUBL $0x02, SI + JZ match_nolit_end_calcBlockSize matchlen_match1_match_nolit_calcBlockSize: - CMPL SI, $0x01 - JB match_nolit_end_calcBlockSize MOVB (DI)(R9*1), R8 CMPB (BX)(R9*1), R8 JNE match_nolit_end_calcBlockSize @@ -17909,7 +17897,6 @@ matchlen_loop_repeat_extend_calcBlockSizeSmall: LEAL 8(R10), R10 CMPL DI, $0x08 JAE matchlen_loopback_repeat_extend_calcBlockSizeSmall - JZ repeat_extend_forward_end_calcBlockSizeSmall matchlen_match4_repeat_extend_calcBlockSizeSmall: CMPL DI, $0x04 @@ -17917,21 +17904,21 @@ matchlen_match4_repeat_extend_calcBlockSizeSmall: MOVL (R8)(R10*1), R9 CMPL (BX)(R10*1), R9 JNE matchlen_match2_repeat_extend_calcBlockSizeSmall - SUBL $0x04, DI + LEAL -4(DI), DI LEAL 4(R10), R10 matchlen_match2_repeat_extend_calcBlockSizeSmall: - CMPL DI, $0x02 - JB matchlen_match1_repeat_extend_calcBlockSizeSmall + CMPL DI, $0x01 + JE matchlen_match1_repeat_extend_calcBlockSizeSmall + JB repeat_extend_forward_end_calcBlockSizeSmall MOVW (R8)(R10*1), R9 CMPW (BX)(R10*1), R9 JNE matchlen_match1_repeat_extend_calcBlockSizeSmall - SUBL $0x02, DI LEAL 2(R10), R10 + SUBL $0x02, DI + JZ repeat_extend_forward_end_calcBlockSizeSmall matchlen_match1_repeat_extend_calcBlockSizeSmall: - CMPL DI, $0x01 - JB repeat_extend_forward_end_calcBlockSizeSmall MOVB (R8)(R10*1), R9 CMPB (BX)(R10*1), R9 JNE repeat_extend_forward_end_calcBlockSizeSmall @@ -18091,7 +18078,6 @@ matchlen_loop_match_nolit_calcBlockSizeSmall: LEAL 8(R9), R9 CMPL SI, $0x08 JAE matchlen_loopback_match_nolit_calcBlockSizeSmall - JZ match_nolit_end_calcBlockSizeSmall matchlen_match4_match_nolit_calcBlockSizeSmall: CMPL SI, $0x04 @@ -18099,21 +18085,21 @@ matchlen_match4_match_nolit_calcBlockSizeSmall: MOVL (DI)(R9*1), R8 CMPL (BX)(R9*1), R8 JNE matchlen_match2_match_nolit_calcBlockSizeSmall - SUBL $0x04, SI + LEAL -4(SI), SI LEAL 4(R9), R9 matchlen_match2_match_nolit_calcBlockSizeSmall: - CMPL SI, $0x02 - JB matchlen_match1_match_nolit_calcBlockSizeSmall + CMPL SI, $0x01 + JE matchlen_match1_match_nolit_calcBlockSizeSmall + JB match_nolit_end_calcBlockSizeSmall MOVW (DI)(R9*1), R8 CMPW (BX)(R9*1), R8 JNE matchlen_match1_match_nolit_calcBlockSizeSmall - SUBL $0x02, SI LEAL 2(R9), R9 + SUBL $0x02, SI + JZ match_nolit_end_calcBlockSizeSmall matchlen_match1_match_nolit_calcBlockSizeSmall: - CMPL SI, $0x01 - JB match_nolit_end_calcBlockSizeSmall MOVB (DI)(R9*1), R8 CMPB (BX)(R9*1), R8 JNE match_nolit_end_calcBlockSizeSmall @@ -18879,7 +18865,6 @@ matchlen_loop_standalone: LEAL 8(SI), SI CMPL DX, $0x08 JAE matchlen_loopback_standalone - JZ gen_match_len_end matchlen_match4_standalone: CMPL DX, $0x04 @@ -18887,21 +18872,21 @@ matchlen_match4_standalone: MOVL (AX)(SI*1), BX CMPL (CX)(SI*1), BX JNE matchlen_match2_standalone - SUBL $0x04, DX + LEAL -4(DX), DX LEAL 4(SI), SI matchlen_match2_standalone: - CMPL DX, $0x02 - JB matchlen_match1_standalone + CMPL DX, $0x01 + JE matchlen_match1_standalone + JB gen_match_len_end MOVW (AX)(SI*1), BX CMPW (CX)(SI*1), BX JNE matchlen_match1_standalone - SUBL $0x02, DX LEAL 2(SI), SI + SUBL $0x02, DX + JZ gen_match_len_end matchlen_match1_standalone: - CMPL DX, $0x01 - JB gen_match_len_end MOVB (AX)(SI*1), BL CMPB (CX)(SI*1), BL JNE gen_match_len_end diff --git a/vendor/github.com/klauspost/compress/s2/writer.go b/vendor/github.com/klauspost/compress/s2/writer.go index 5a944068..089cd36d 100644 --- a/vendor/github.com/klauspost/compress/s2/writer.go +++ b/vendor/github.com/klauspost/compress/s2/writer.go @@ -771,7 +771,7 @@ func (w *Writer) closeIndex(idx bool) ([]byte, error) { } var index []byte - if w.err(nil) == nil && w.writer != nil { + if w.err(err) == nil && w.writer != nil { // Create index. if idx { compSize := int64(-1) diff --git a/vendor/github.com/klauspost/cpuid/v2/README.md b/vendor/github.com/klauspost/cpuid/v2/README.md index 37b5167d..accd7aba 100644 --- a/vendor/github.com/klauspost/cpuid/v2/README.md +++ b/vendor/github.com/klauspost/cpuid/v2/README.md @@ -435,6 +435,7 @@ Exit Code 1 | SYSCALL | System-Call Extension (SCE): SYSCALL and SYSRET instructions. | | SYSEE | SYSENTER and SYSEXIT instructions | | TBM | AMD Trailing Bit Manipulation | +| TDX_GUEST | Intel Trust Domain Extensions Guest | | TLB_FLUSH_NESTED | AMD: Flushing includes all the nested translations for guest translations | | TME | Intel Total Memory Encryption. The following MSRs are supported: IA32_TME_CAPABILITY, IA32_TME_ACTIVATE, IA32_TME_EXCLUDE_MASK, and IA32_TME_EXCLUDE_BASE. | | TOPEXT | TopologyExtensions: topology extensions support. Indicates support for CPUID Fn8000_001D_EAX_x[N:0]-CPUID Fn8000_001E_EDX. | diff --git a/vendor/github.com/klauspost/cpuid/v2/cpuid.go b/vendor/github.com/klauspost/cpuid/v2/cpuid.go index 89a861d4..d015c744 100644 --- a/vendor/github.com/klauspost/cpuid/v2/cpuid.go +++ b/vendor/github.com/klauspost/cpuid/v2/cpuid.go @@ -226,6 +226,7 @@ const ( SYSCALL // System-Call Extension (SCE): SYSCALL and SYSRET instructions. SYSEE // SYSENTER and SYSEXIT instructions TBM // AMD Trailing Bit Manipulation + TDX_GUEST // Intel Trust Domain Extensions Guest TLB_FLUSH_NESTED // AMD: Flushing includes all the nested translations for guest translations TME // Intel Total Memory Encryption. The following MSRs are supported: IA32_TME_CAPABILITY, IA32_TME_ACTIVATE, IA32_TME_EXCLUDE_MASK, and IA32_TME_EXCLUDE_BASE. TOPEXT // TopologyExtensions: topology extensions support. Indicates support for CPUID Fn8000_001D_EAX_x[N:0]-CPUID Fn8000_001E_EDX. @@ -1186,13 +1187,8 @@ func support() flagSet { fs.setIf(edx&(1<<30) != 0, IA32_CORE_CAP) fs.setIf(edx&(1<<31) != 0, SPEC_CTRL_SSBD) - // CPUID.(EAX=7, ECX=1).EDX - fs.setIf(edx&(1<<4) != 0, AVXVNNIINT8) - fs.setIf(edx&(1<<5) != 0, AVXNECONVERT) - fs.setIf(edx&(1<<14) != 0, PREFETCHI) - // CPUID.(EAX=7, ECX=1).EAX - eax1, _, _, _ := cpuidex(7, 1) + eax1, _, _, edx1 := cpuidex(7, 1) fs.setIf(fs.inSet(AVX) && eax1&(1<<4) != 0, AVXVNNI) fs.setIf(eax1&(1<<7) != 0, CMPCCXADD) fs.setIf(eax1&(1<<10) != 0, MOVSB_ZL) @@ -1202,6 +1198,11 @@ func support() flagSet { fs.setIf(eax1&(1<<23) != 0, AVXIFMA) fs.setIf(eax1&(1<<26) != 0, LAM) + // CPUID.(EAX=7, ECX=1).EDX + fs.setIf(edx1&(1<<4) != 0, AVXVNNIINT8) + fs.setIf(edx1&(1<<5) != 0, AVXNECONVERT) + fs.setIf(edx1&(1<<14) != 0, PREFETCHI) + // Only detect AVX-512 features if XGETBV is supported if c&((1<<26)|(1<<27)) == (1<<26)|(1<<27) { // Check for OS support @@ -1393,6 +1394,13 @@ func support() flagSet { fs.setIf((a>>24)&1 == 1, VMSA_REGPROT) } + if mfi >= 0x21 { + // Intel Trusted Domain Extensions Guests have their own cpuid leaf (0x21). + _, ebx, ecx, edx := cpuid(0x21) + identity := string(valAsString(ebx, edx, ecx)) + fs.setIf(identity == "IntelTDX ", TDX_GUEST) + } + return fs } diff --git a/vendor/github.com/klauspost/cpuid/v2/featureid_string.go b/vendor/github.com/klauspost/cpuid/v2/featureid_string.go index 2a27f44d..024c706a 100644 --- a/vendor/github.com/klauspost/cpuid/v2/featureid_string.go +++ b/vendor/github.com/klauspost/cpuid/v2/featureid_string.go @@ -166,59 +166,60 @@ func _() { _ = x[SYSCALL-156] _ = x[SYSEE-157] _ = x[TBM-158] - _ = x[TLB_FLUSH_NESTED-159] - _ = x[TME-160] - _ = x[TOPEXT-161] - _ = x[TSCRATEMSR-162] - _ = x[TSXLDTRK-163] - _ = x[VAES-164] - _ = x[VMCBCLEAN-165] - _ = x[VMPL-166] - _ = x[VMSA_REGPROT-167] - _ = x[VMX-168] - _ = x[VPCLMULQDQ-169] - _ = x[VTE-170] - _ = x[WAITPKG-171] - _ = x[WBNOINVD-172] - _ = x[WRMSRNS-173] - _ = x[X87-174] - _ = x[XGETBV1-175] - _ = x[XOP-176] - _ = x[XSAVE-177] - _ = x[XSAVEC-178] - _ = x[XSAVEOPT-179] - _ = x[XSAVES-180] - _ = x[AESARM-181] - _ = x[ARMCPUID-182] - _ = x[ASIMD-183] - _ = x[ASIMDDP-184] - _ = x[ASIMDHP-185] - _ = x[ASIMDRDM-186] - _ = x[ATOMICS-187] - _ = x[CRC32-188] - _ = x[DCPOP-189] - _ = x[EVTSTRM-190] - _ = x[FCMA-191] - _ = x[FP-192] - _ = x[FPHP-193] - _ = x[GPA-194] - _ = x[JSCVT-195] - _ = x[LRCPC-196] - _ = x[PMULL-197] - _ = x[SHA1-198] - _ = x[SHA2-199] - _ = x[SHA3-200] - _ = x[SHA512-201] - _ = x[SM3-202] - _ = x[SM4-203] - _ = x[SVE-204] - _ = x[lastID-205] + _ = x[TDX_GUEST-159] + _ = x[TLB_FLUSH_NESTED-160] + _ = x[TME-161] + _ = x[TOPEXT-162] + _ = x[TSCRATEMSR-163] + _ = x[TSXLDTRK-164] + _ = x[VAES-165] + _ = x[VMCBCLEAN-166] + _ = x[VMPL-167] + _ = x[VMSA_REGPROT-168] + _ = x[VMX-169] + _ = x[VPCLMULQDQ-170] + _ = x[VTE-171] + _ = x[WAITPKG-172] + _ = x[WBNOINVD-173] + _ = x[WRMSRNS-174] + _ = x[X87-175] + _ = x[XGETBV1-176] + _ = x[XOP-177] + _ = x[XSAVE-178] + _ = x[XSAVEC-179] + _ = x[XSAVEOPT-180] + _ = x[XSAVES-181] + _ = x[AESARM-182] + _ = x[ARMCPUID-183] + _ = x[ASIMD-184] + _ = x[ASIMDDP-185] + _ = x[ASIMDHP-186] + _ = x[ASIMDRDM-187] + _ = x[ATOMICS-188] + _ = x[CRC32-189] + _ = x[DCPOP-190] + _ = x[EVTSTRM-191] + _ = x[FCMA-192] + _ = x[FP-193] + _ = x[FPHP-194] + _ = x[GPA-195] + _ = x[JSCVT-196] + _ = x[LRCPC-197] + _ = x[PMULL-198] + _ = x[SHA1-199] + _ = x[SHA2-200] + _ = x[SHA3-201] + _ = x[SHA512-202] + _ = x[SM3-203] + _ = x[SM4-204] + _ = x[SVE-205] + _ = x[lastID-206] _ = x[firstID-0] } -const _FeatureID_name = "firstIDADXAESNIAMD3DNOWAMD3DNOWEXTAMXBF16AMXFP16AMXINT8AMXTILEAVXAVX2AVX512BF16AVX512BITALGAVX512BWAVX512CDAVX512DQAVX512ERAVX512FAVX512FP16AVX512IFMAAVX512PFAVX512VBMIAVX512VBMI2AVX512VLAVX512VNNIAVX512VP2INTERSECTAVX512VPOPCNTDQAVXIFMAAVXNECONVERTAVXSLOWAVXVNNIAVXVNNIINT8BHI_CTRLBMI1BMI2CETIBTCETSSCLDEMOTECLMULCLZEROCMOVCMPCCXADDCMPSB_SCADBS_SHORTCMPXCHG8CPBOOSTCPPCCX16EFER_LMSLE_UNSENQCMDERMSF16CFLUSH_L1DFMA3FMA4FP128FP256FSRMFXSRFXSROPTGFNIHLEHRESETHTTHWAHYBRID_CPUHYPERVISORIA32_ARCH_CAPIA32_CORE_CAPIBPBIBRSIBRS_PREFERREDIBRS_PROVIDES_SMPIBSIBSBRNTRGTIBSFETCHSAMIBSFFVIBSOPCNTIBSOPCNTEXTIBSOPSAMIBSRDWROPCNTIBSRIPINVALIDCHKIBS_FETCH_CTLXIBS_OPDATA4IBS_OPFUSEIBS_PREVENTHOSTIBS_ZEN4IDPRED_CTRLINT_WBINVDINVLPGBLAHFLAMLBRVIRTLZCNTMCAOVERFLOWMCDT_NOMCOMMITMD_CLEARMMXMMXEXTMOVBEMOVDIR64BMOVDIRIMOVSB_ZLMOVUMPXMSRIRCMSRLISTMSR_PAGEFLUSHNRIPSNXOSXSAVEPCONFIGPOPCNTPPINPREFETCHIPSFDRDPRURDRANDRDSEEDRDTSCPRRSBA_CTRLRTMRTM_ALWAYS_ABORTSERIALIZESEVSEV_64BITSEV_ALTERNATIVESEV_DEBUGSWAPSEV_ESSEV_RESTRICTEDSEV_SNPSGXSGXLCSHASMESME_COHERENTSPEC_CTRL_SSBDSRBDS_CTRLSSESSE2SSE3SSE4SSE42SSE4ASSSE3STIBPSTIBP_ALWAYSONSTOSB_SHORTSUCCORSVMSVMDASVMFBASIDSVMLSVMNPSVMPFSVMPFTSYSCALLSYSEETBMTLB_FLUSH_NESTEDTMETOPEXTTSCRATEMSRTSXLDTRKVAESVMCBCLEANVMPLVMSA_REGPROTVMXVPCLMULQDQVTEWAITPKGWBNOINVDWRMSRNSX87XGETBV1XOPXSAVEXSAVECXSAVEOPTXSAVESAESARMARMCPUIDASIMDASIMDDPASIMDHPASIMDRDMATOMICSCRC32DCPOPEVTSTRMFCMAFPFPHPGPAJSCVTLRCPCPMULLSHA1SHA2SHA3SHA512SM3SM4SVElastID" +const _FeatureID_name = "firstIDADXAESNIAMD3DNOWAMD3DNOWEXTAMXBF16AMXFP16AMXINT8AMXTILEAVXAVX2AVX512BF16AVX512BITALGAVX512BWAVX512CDAVX512DQAVX512ERAVX512FAVX512FP16AVX512IFMAAVX512PFAVX512VBMIAVX512VBMI2AVX512VLAVX512VNNIAVX512VP2INTERSECTAVX512VPOPCNTDQAVXIFMAAVXNECONVERTAVXSLOWAVXVNNIAVXVNNIINT8BHI_CTRLBMI1BMI2CETIBTCETSSCLDEMOTECLMULCLZEROCMOVCMPCCXADDCMPSB_SCADBS_SHORTCMPXCHG8CPBOOSTCPPCCX16EFER_LMSLE_UNSENQCMDERMSF16CFLUSH_L1DFMA3FMA4FP128FP256FSRMFXSRFXSROPTGFNIHLEHRESETHTTHWAHYBRID_CPUHYPERVISORIA32_ARCH_CAPIA32_CORE_CAPIBPBIBRSIBRS_PREFERREDIBRS_PROVIDES_SMPIBSIBSBRNTRGTIBSFETCHSAMIBSFFVIBSOPCNTIBSOPCNTEXTIBSOPSAMIBSRDWROPCNTIBSRIPINVALIDCHKIBS_FETCH_CTLXIBS_OPDATA4IBS_OPFUSEIBS_PREVENTHOSTIBS_ZEN4IDPRED_CTRLINT_WBINVDINVLPGBLAHFLAMLBRVIRTLZCNTMCAOVERFLOWMCDT_NOMCOMMITMD_CLEARMMXMMXEXTMOVBEMOVDIR64BMOVDIRIMOVSB_ZLMOVUMPXMSRIRCMSRLISTMSR_PAGEFLUSHNRIPSNXOSXSAVEPCONFIGPOPCNTPPINPREFETCHIPSFDRDPRURDRANDRDSEEDRDTSCPRRSBA_CTRLRTMRTM_ALWAYS_ABORTSERIALIZESEVSEV_64BITSEV_ALTERNATIVESEV_DEBUGSWAPSEV_ESSEV_RESTRICTEDSEV_SNPSGXSGXLCSHASMESME_COHERENTSPEC_CTRL_SSBDSRBDS_CTRLSSESSE2SSE3SSE4SSE42SSE4ASSSE3STIBPSTIBP_ALWAYSONSTOSB_SHORTSUCCORSVMSVMDASVMFBASIDSVMLSVMNPSVMPFSVMPFTSYSCALLSYSEETBMTDX_GUESTTLB_FLUSH_NESTEDTMETOPEXTTSCRATEMSRTSXLDTRKVAESVMCBCLEANVMPLVMSA_REGPROTVMXVPCLMULQDQVTEWAITPKGWBNOINVDWRMSRNSX87XGETBV1XOPXSAVEXSAVECXSAVEOPTXSAVESAESARMARMCPUIDASIMDASIMDDPASIMDHPASIMDRDMATOMICSCRC32DCPOPEVTSTRMFCMAFPFPHPGPAJSCVTLRCPCPMULLSHA1SHA2SHA3SHA512SM3SM4SVElastID" -var _FeatureID_index = [...]uint16{0, 7, 10, 15, 23, 34, 41, 48, 55, 62, 65, 69, 79, 91, 99, 107, 115, 123, 130, 140, 150, 158, 168, 179, 187, 197, 215, 230, 237, 249, 256, 263, 274, 282, 286, 290, 296, 301, 309, 314, 320, 324, 333, 351, 359, 366, 370, 374, 388, 394, 398, 402, 411, 415, 419, 424, 429, 433, 437, 444, 448, 451, 457, 460, 463, 473, 483, 496, 509, 513, 517, 531, 548, 551, 561, 572, 578, 586, 597, 605, 617, 633, 647, 658, 668, 683, 691, 702, 712, 719, 723, 726, 733, 738, 749, 756, 763, 771, 774, 780, 785, 794, 801, 809, 813, 816, 822, 829, 842, 847, 849, 856, 863, 869, 873, 882, 886, 891, 897, 903, 909, 919, 922, 938, 947, 950, 959, 974, 987, 993, 1007, 1014, 1017, 1022, 1025, 1028, 1040, 1054, 1064, 1067, 1071, 1075, 1079, 1084, 1089, 1094, 1099, 1113, 1124, 1130, 1133, 1138, 1147, 1151, 1156, 1161, 1167, 1174, 1179, 1182, 1198, 1201, 1207, 1217, 1225, 1229, 1238, 1242, 1254, 1257, 1267, 1270, 1277, 1285, 1292, 1295, 1302, 1305, 1310, 1316, 1324, 1330, 1336, 1344, 1349, 1356, 1363, 1371, 1378, 1383, 1388, 1395, 1399, 1401, 1405, 1408, 1413, 1418, 1423, 1427, 1431, 1435, 1441, 1444, 1447, 1450, 1456} +var _FeatureID_index = [...]uint16{0, 7, 10, 15, 23, 34, 41, 48, 55, 62, 65, 69, 79, 91, 99, 107, 115, 123, 130, 140, 150, 158, 168, 179, 187, 197, 215, 230, 237, 249, 256, 263, 274, 282, 286, 290, 296, 301, 309, 314, 320, 324, 333, 351, 359, 366, 370, 374, 388, 394, 398, 402, 411, 415, 419, 424, 429, 433, 437, 444, 448, 451, 457, 460, 463, 473, 483, 496, 509, 513, 517, 531, 548, 551, 561, 572, 578, 586, 597, 605, 617, 633, 647, 658, 668, 683, 691, 702, 712, 719, 723, 726, 733, 738, 749, 756, 763, 771, 774, 780, 785, 794, 801, 809, 813, 816, 822, 829, 842, 847, 849, 856, 863, 869, 873, 882, 886, 891, 897, 903, 909, 919, 922, 938, 947, 950, 959, 974, 987, 993, 1007, 1014, 1017, 1022, 1025, 1028, 1040, 1054, 1064, 1067, 1071, 1075, 1079, 1084, 1089, 1094, 1099, 1113, 1124, 1130, 1133, 1138, 1147, 1151, 1156, 1161, 1167, 1174, 1179, 1182, 1191, 1207, 1210, 1216, 1226, 1234, 1238, 1247, 1251, 1263, 1266, 1276, 1279, 1286, 1294, 1301, 1304, 1311, 1314, 1319, 1325, 1333, 1339, 1345, 1353, 1358, 1365, 1372, 1380, 1387, 1392, 1397, 1404, 1408, 1410, 1414, 1417, 1422, 1427, 1432, 1436, 1440, 1444, 1450, 1453, 1456, 1459, 1465} func (i FeatureID) String() string { if i < 0 || i >= FeatureID(len(_FeatureID_index)-1) { diff --git a/vendor/github.com/minio/minio-go/v7/api-put-object-fan-out.go b/vendor/github.com/minio/minio-go/v7/api-put-object-fan-out.go index 9016ec4b..0ae9142e 100644 --- a/vendor/github.com/minio/minio-go/v7/api-put-object-fan-out.go +++ b/vendor/github.com/minio/minio-go/v7/api-put-object-fan-out.go @@ -62,7 +62,7 @@ type PutObjectFanOutResponse struct { ETag string `json:"etag,omitempty"` VersionID string `json:"versionId,omitempty"` LastModified *time.Time `json:"lastModified,omitempty"` - Error error `json:"error,omitempty"` + Error string `json:"error,omitempty"` } // PutObjectFanOut - is a variant of PutObject instead of writing a single object from a single diff --git a/vendor/github.com/minio/minio-go/v7/api-put-object-multipart.go b/vendor/github.com/minio/minio-go/v7/api-put-object-multipart.go index 85d6c70a..5f117afa 100644 --- a/vendor/github.com/minio/minio-go/v7/api-put-object-multipart.go +++ b/vendor/github.com/minio/minio-go/v7/api-put-object-multipart.go @@ -389,8 +389,9 @@ func (c *Client) completeMultipartUpload(ctx context.Context, bucketName, object headers := opts.Header() if s3utils.IsAmazonEndpoint(*c.endpointURL) { - headers.Del(encrypt.SseKmsKeyID) // Remove X-Amz-Server-Side-Encryption-Aws-Kms-Key-Id not supported in CompleteMultipartUpload - headers.Del(encrypt.SseGenericHeader) // Remove X-Amz-Server-Side-Encryption not supported in CompleteMultipartUpload + headers.Del(encrypt.SseKmsKeyID) // Remove X-Amz-Server-Side-Encryption-Aws-Kms-Key-Id not supported in CompleteMultipartUpload + headers.Del(encrypt.SseGenericHeader) // Remove X-Amz-Server-Side-Encryption not supported in CompleteMultipartUpload + headers.Del(encrypt.SseEncryptionContext) // Remove X-Amz-Server-Side-Encryption-Context not supported in CompleteMultipartUpload } // Instantiate all the complete multipart buffer. diff --git a/vendor/github.com/minio/minio-go/v7/api.go b/vendor/github.com/minio/minio-go/v7/api.go index 0546b1ac..712fe2fd 100644 --- a/vendor/github.com/minio/minio-go/v7/api.go +++ b/vendor/github.com/minio/minio-go/v7/api.go @@ -124,7 +124,7 @@ type Options struct { // Global constants. const ( libraryName = "minio-go" - libraryVersion = "v7.0.55" + libraryVersion = "v7.0.57" ) // User Agent should always following the below style. @@ -919,7 +919,7 @@ func (c *Client) makeTargetURL(bucketName, objectName, bucketLocation string, is if h, p, err := net.SplitHostPort(host); err == nil { if scheme == "http" && p == "80" || scheme == "https" && p == "443" { host = h - if ip := net.ParseIP(h); ip != nil && ip.To16() != nil { + if ip := net.ParseIP(h); ip != nil && ip.To4() == nil { host = "[" + h + "]" } } diff --git a/vendor/github.com/minio/minio-go/v7/functional_tests.go b/vendor/github.com/minio/minio-go/v7/functional_tests.go index ed1b7340..2bc6b864 100644 --- a/vendor/github.com/minio/minio-go/v7/functional_tests.go +++ b/vendor/github.com/minio/minio-go/v7/functional_tests.go @@ -2539,13 +2539,13 @@ func testTrailingChecksums() { test.ChecksumCRC32C = hashMultiPart(b, int(test.PO.PartSize), test.hasher) // Set correct CRC. - c.TraceOn(os.Stdout) + // c.TraceOn(os.Stderr) resp, err := c.PutObject(context.Background(), bucketName, objectName, bytes.NewReader(b), int64(bufSize), test.PO) if err != nil { logError(testName, function, args, startTime, "", "PutObject failed", err) return } - c.TraceOff() + // c.TraceOff() cmpChecksum(resp.ChecksumSHA256, test.ChecksumSHA256) cmpChecksum(resp.ChecksumSHA1, test.ChecksumSHA1) cmpChecksum(resp.ChecksumCRC32, test.ChecksumCRC32) @@ -2655,8 +2655,8 @@ func testPutObjectWithAutomaticChecksums() { } // Enable tracing, write to stderr. - c.TraceOn(os.Stderr) - defer c.TraceOff() + // c.TraceOn(os.Stderr) + // defer c.TraceOff() for i, test := range tests { bufSize := dataFileMap["datafile-10-kB"] @@ -4821,6 +4821,11 @@ func testPresignedPostPolicy() { policy.SetContentType("binary/octet-stream") policy.SetContentLengthRange(10, 1024*1024) policy.SetUserMetadata(metadataKey, metadataValue) + + // Add CRC32C + checksum := minio.ChecksumCRC32C.ChecksumBytes(buf) + policy.SetChecksum(checksum) + args["policy"] = policy.String() presignedPostPolicyURL, formData, err := c.PresignedPostPolicy(context.Background(), policy) @@ -4888,6 +4893,7 @@ func testPresignedPostPolicy() { Timeout: 30 * time.Second, Transport: transport, } + args["url"] = presignedPostPolicyURL.String() req, err := http.NewRequest(http.MethodPost, presignedPostPolicyURL.String(), bytes.NewReader(formBuf.Bytes())) if err != nil { @@ -4920,13 +4926,21 @@ func testPresignedPostPolicy() { expectedLocation := scheme + os.Getenv(serverEndpoint) + "/" + bucketName + "/" + objectName expectedLocationBucketDNS := scheme + bucketName + "." + os.Getenv(serverEndpoint) + "/" + objectName - if val, ok := res.Header["Location"]; ok { - if val[0] != expectedLocation && val[0] != expectedLocationBucketDNS { - logError(testName, function, args, startTime, "", "Location in header response is incorrect", err) + if !strings.Contains(expectedLocation, "s3.amazonaws.com/") { + // Test when not against AWS S3. + if val, ok := res.Header["Location"]; ok { + if val[0] != expectedLocation && val[0] != expectedLocationBucketDNS { + logError(testName, function, args, startTime, "", fmt.Sprintf("Location in header response is incorrect. Want %q or %q, got %q", expectedLocation, expectedLocationBucketDNS, val[0]), err) + return + } + } else { + logError(testName, function, args, startTime, "", "Location not found in header response", err) return } - } else { - logError(testName, function, args, startTime, "", "Location not found in header response", err) + } + want := checksum.Encoded() + if got := res.Header.Get("X-Amz-Checksum-Crc32c"); got != want { + logError(testName, function, args, startTime, "", fmt.Sprintf("Want checksum %q, got %q", want, got), nil) return } diff --git a/vendor/github.com/prometheus/client_golang/prometheus/desc.go b/vendor/github.com/prometheus/client_golang/prometheus/desc.go index 12331542..deedc2df 100644 --- a/vendor/github.com/prometheus/client_golang/prometheus/desc.go +++ b/vendor/github.com/prometheus/client_golang/prometheus/desc.go @@ -18,12 +18,12 @@ import ( "sort" "strings" - "github.com/prometheus/client_golang/prometheus/internal" - "github.com/cespare/xxhash/v2" dto "github.com/prometheus/client_model/go" "github.com/prometheus/common/model" "google.golang.org/protobuf/proto" + + "github.com/prometheus/client_golang/prometheus/internal" ) // Desc is the descriptor used by every Prometheus Metric. It is essentially diff --git a/vendor/github.com/prometheus/client_golang/prometheus/histogram.go b/vendor/github.com/prometheus/client_golang/prometheus/histogram.go index 5b69965b..8d818afe 100644 --- a/vendor/github.com/prometheus/client_golang/prometheus/histogram.go +++ b/vendor/github.com/prometheus/client_golang/prometheus/histogram.go @@ -401,7 +401,7 @@ type HistogramOpts struct { // Histogram by a Prometheus server with that feature enabled (requires // Prometheus v2.40+). Sparse buckets are exponential buckets covering // the whole float64 range (with the exception of the “zero” bucket, see - // SparseBucketsZeroThreshold below). From any one bucket to the next, + // NativeHistogramZeroThreshold below). From any one bucket to the next, // the width of the bucket grows by a constant // factor. NativeHistogramBucketFactor provides an upper bound for this // factor (exception see below). The smaller @@ -432,7 +432,7 @@ type HistogramOpts struct { // bucket. For best results, this should be close to a bucket // boundary. This is usually the case if picking a power of two. If // NativeHistogramZeroThreshold is left at zero, - // DefSparseBucketsZeroThreshold is used as the threshold. To configure + // DefNativeHistogramZeroThreshold is used as the threshold. To configure // a zero bucket with an actual threshold of zero (i.e. only // observations of precisely zero will go into the zero bucket), set // NativeHistogramZeroThreshold to the NativeHistogramZeroThresholdZero @@ -639,8 +639,8 @@ func (hc *histogramCounts) observe(v float64, bucket int, doSparse bool) { if frac == 0.5 { key-- } - div := 1 << -schema - key = (key + div - 1) / div + offset := (1 << -schema) - 1 + key = (key + offset) >> -schema } if isInf { key++ @@ -817,7 +817,7 @@ func (h *histogram) observe(v float64, bucket int) { } } -// limitSparsebuckets applies a strategy to limit the number of populated sparse +// limitBuckets applies a strategy to limit the number of populated sparse // buckets. It's generally best effort, and there are situations where the // number can go higher (if even the lowest resolution isn't enough to reduce // the number sufficiently, or if the provided counts aren't fully updated yet diff --git a/vendor/github.com/prometheus/client_golang/prometheus/promhttp/http.go b/vendor/github.com/prometheus/client_golang/prometheus/promhttp/http.go index a4cc9810..09b8d2fb 100644 --- a/vendor/github.com/prometheus/client_golang/prometheus/promhttp/http.go +++ b/vendor/github.com/prometheus/client_golang/prometheus/promhttp/http.go @@ -37,6 +37,7 @@ import ( "fmt" "io" "net/http" + "strconv" "strings" "sync" "time" @@ -47,9 +48,10 @@ import ( ) const ( - contentTypeHeader = "Content-Type" - contentEncodingHeader = "Content-Encoding" - acceptEncodingHeader = "Accept-Encoding" + contentTypeHeader = "Content-Type" + contentEncodingHeader = "Content-Encoding" + acceptEncodingHeader = "Accept-Encoding" + processStartTimeHeader = "Process-Start-Time-Unix" ) var gzipPool = sync.Pool{ @@ -121,6 +123,9 @@ func HandlerForTransactional(reg prometheus.TransactionalGatherer, opts HandlerO } h := http.HandlerFunc(func(rsp http.ResponseWriter, req *http.Request) { + if !opts.ProcessStartTime.IsZero() { + rsp.Header().Set(processStartTimeHeader, strconv.FormatInt(opts.ProcessStartTime.Unix(), 10)) + } if inFlightSem != nil { select { case inFlightSem <- struct{}{}: // All good, carry on. @@ -366,6 +371,14 @@ type HandlerOpts struct { // (which changes the identity of the resulting series on the Prometheus // server). EnableOpenMetrics bool + // ProcessStartTime allows setting process start timevalue that will be exposed + // with "Process-Start-Time-Unix" response header along with the metrics + // payload. This allow callers to have efficient transformations to cumulative + // counters (e.g. OpenTelemetry) or generally _created timestamp estimation per + // scrape target. + // NOTE: This feature is experimental and not covered by OpenMetrics or Prometheus + // exposition format. + ProcessStartTime time.Time } // gzipAccepted returns whether the client will accept gzip-encoded content. diff --git a/vendor/github.com/prometheus/client_golang/prometheus/vec.go b/vendor/github.com/prometheus/client_golang/prometheus/vec.go index 386fb2d2..f0d0015a 100644 --- a/vendor/github.com/prometheus/client_golang/prometheus/vec.go +++ b/vendor/github.com/prometheus/client_golang/prometheus/vec.go @@ -20,6 +20,24 @@ import ( "github.com/prometheus/common/model" ) +var labelsPool = &sync.Pool{ + New: func() interface{} { + return make(Labels) + }, +} + +func getLabelsFromPool() Labels { + return labelsPool.Get().(Labels) +} + +func putLabelsToPool(labels Labels) { + for k := range labels { + delete(labels, k) + } + + labelsPool.Put(labels) +} + // MetricVec is a Collector to bundle metrics of the same name that differ in // their label values. MetricVec is not used directly but as a building block // for implementations of vectors of a given metric type, like GaugeVec, @@ -93,6 +111,8 @@ func (m *MetricVec) DeleteLabelValues(lvs ...string) bool { // there for pros and cons of the two methods. func (m *MetricVec) Delete(labels Labels) bool { labels = constrainLabels(m.desc, labels) + defer putLabelsToPool(labels) + h, err := m.hashLabels(labels) if err != nil { return false @@ -109,6 +129,8 @@ func (m *MetricVec) Delete(labels Labels) bool { // To match curried labels with DeletePartialMatch, it must be called on the base vector. func (m *MetricVec) DeletePartialMatch(labels Labels) int { labels = constrainLabels(m.desc, labels) + defer putLabelsToPool(labels) + return m.metricMap.deleteByLabels(labels, m.curry) } @@ -229,6 +251,8 @@ func (m *MetricVec) GetMetricWithLabelValues(lvs ...string) (Metric, error) { // for example GaugeVec. func (m *MetricVec) GetMetricWith(labels Labels) (Metric, error) { labels = constrainLabels(m.desc, labels) + defer putLabelsToPool(labels) + h, err := m.hashLabels(labels) if err != nil { return nil, err @@ -647,15 +671,16 @@ func inlineLabelValues(lvs []string, curry []curriedLabelValue) []string { } func constrainLabels(desc *Desc, labels Labels) Labels { - constrainedValues := make(Labels, len(labels)) + constrainedLabels := getLabelsFromPool() for l, v := range labels { if i, ok := indexOf(l, desc.variableLabels.labelNames()); ok { - constrainedValues[l] = desc.variableLabels[i].Constrain(v) - continue + v = desc.variableLabels[i].Constrain(v) } - constrainedValues[l] = v + + constrainedLabels[l] = v } - return constrainedValues + + return constrainedLabels } func constrainLabelValues(desc *Desc, lvs []string, curry []curriedLabelValue) []string { diff --git a/vendor/github.com/shirou/gopsutil/v3/internal/common/sleep.go b/vendor/github.com/shirou/gopsutil/v3/internal/common/sleep.go index 8c35b172..9bed2419 100644 --- a/vendor/github.com/shirou/gopsutil/v3/internal/common/sleep.go +++ b/vendor/github.com/shirou/gopsutil/v3/internal/common/sleep.go @@ -11,6 +11,9 @@ func Sleep(ctx context.Context, interval time.Duration) error { timer := time.NewTimer(interval) select { case <-ctx.Done(): + if !timer.Stop() { + <-timer.C + } return ctx.Err() case <-timer.C: return nil diff --git a/vendor/github.com/shirou/gopsutil/v3/mem/mem_linux.go b/vendor/github.com/shirou/gopsutil/v3/mem/mem_linux.go index 56fb1cc6..059518dc 100644 --- a/vendor/github.com/shirou/gopsutil/v3/mem/mem_linux.go +++ b/vendor/github.com/shirou/gopsutil/v3/mem/mem_linux.go @@ -154,13 +154,13 @@ func fillFromMeminfoWithContext() (*VirtualMemoryStat, *VirtualMemoryExStat, err return ret, retEx, err } retEx.Unevictable = t * 1024 - case "WriteBack": + case "Writeback": t, err := strconv.ParseUint(value, 10, 64) if err != nil { return ret, retEx, err } ret.WriteBack = t * 1024 - case "WriteBackTmp": + case "WritebackTmp": t, err := strconv.ParseUint(value, 10, 64) if err != nil { return ret, retEx, err diff --git a/vendor/github.com/shirou/gopsutil/v3/net/net_darwin.go b/vendor/github.com/shirou/gopsutil/v3/net/net_darwin.go index 1c8d4f4e..4d2cfbcd 100644 --- a/vendor/github.com/shirou/gopsutil/v3/net/net_darwin.go +++ b/vendor/github.com/shirou/gopsutil/v3/net/net_darwin.go @@ -278,7 +278,7 @@ func ConntrackStatsWithContext(ctx context.Context, percpu bool) ([]ConntrackSta return nil, common.ErrNotImplementedError } -// NetProtoCounters returns network statistics for the entire system +// ProtoCounters returns network statistics for the entire system // If protocols is empty then all protocols are returned, otherwise // just the protocols in the list are returned. // Not Implemented for Darwin diff --git a/vendor/github.com/shirou/gopsutil/v3/net/net_freebsd.go b/vendor/github.com/shirou/gopsutil/v3/net/net_freebsd.go index 7f31851e..bf8baf09 100644 --- a/vendor/github.com/shirou/gopsutil/v3/net/net_freebsd.go +++ b/vendor/github.com/shirou/gopsutil/v3/net/net_freebsd.go @@ -115,7 +115,7 @@ func ConntrackStatsWithContext(ctx context.Context, percpu bool) ([]ConntrackSta return nil, common.ErrNotImplementedError } -// NetProtoCounters returns network statistics for the entire system +// ProtoCounters returns network statistics for the entire system // If protocols is empty then all protocols are returned, otherwise // just the protocols in the list are returned. // Not Implemented for FreeBSD diff --git a/vendor/github.com/shirou/gopsutil/v3/net/net_linux.go b/vendor/github.com/shirou/gopsutil/v3/net/net_linux.go index c7cd0db1..dd62d479 100644 --- a/vendor/github.com/shirou/gopsutil/v3/net/net_linux.go +++ b/vendor/github.com/shirou/gopsutil/v3/net/net_linux.go @@ -157,7 +157,7 @@ var netProtocols = []string{ "udplite", } -// NetProtoCounters returns network statistics for the entire system +// ProtoCounters returns network statistics for the entire system // If protocols is empty then all protocols are returned, otherwise // just the protocols in the list are returned. // Available protocols: diff --git a/vendor/github.com/shirou/gopsutil/v3/net/net_openbsd.go b/vendor/github.com/shirou/gopsutil/v3/net/net_openbsd.go index 5f066a09..cf48f53e 100644 --- a/vendor/github.com/shirou/gopsutil/v3/net/net_openbsd.go +++ b/vendor/github.com/shirou/gopsutil/v3/net/net_openbsd.go @@ -164,7 +164,7 @@ func ConntrackStatsWithContext(ctx context.Context, percpu bool) ([]ConntrackSta return nil, common.ErrNotImplementedError } -// NetProtoCounters returns network statistics for the entire system +// ProtoCounters returns network statistics for the entire system // If protocols is empty then all protocols are returned, otherwise // just the protocols in the list are returned. // Not Implemented for OpenBSD diff --git a/vendor/github.com/shirou/gopsutil/v3/net/net_windows.go b/vendor/github.com/shirou/gopsutil/v3/net/net_windows.go index 68b26bdc..5d384342 100644 --- a/vendor/github.com/shirou/gopsutil/v3/net/net_windows.go +++ b/vendor/github.com/shirou/gopsutil/v3/net/net_windows.go @@ -338,7 +338,7 @@ func ConntrackStatsWithContext(ctx context.Context, percpu bool) ([]ConntrackSta return nil, common.ErrNotImplementedError } -// NetProtoCounters returns network statistics for the entire system +// ProtoCounters returns network statistics for the entire system // If protocols is empty then all protocols are returned, otherwise // just the protocols in the list are returned. // Not Implemented for Windows diff --git a/vendor/github.com/shirou/gopsutil/v3/process/process.go b/vendor/github.com/shirou/gopsutil/v3/process/process.go index 0ca26c21..1a7fe1b8 100644 --- a/vendor/github.com/shirou/gopsutil/v3/process/process.go +++ b/vendor/github.com/shirou/gopsutil/v3/process/process.go @@ -335,7 +335,7 @@ func (p *Process) MemoryPercentWithContext(ctx context.Context) (float32, error) return (100 * float32(used) / float32(total)), nil } -// CPU_Percent returns how many percent of the CPU time this process uses +// CPUPercent returns how many percent of the CPU time this process uses func (p *Process) CPUPercent() (float64, error) { return p.CPUPercentWithContext(context.Background()) } @@ -507,7 +507,7 @@ func (p *Process) MemoryInfoEx() (*MemoryInfoExStat, error) { return p.MemoryInfoExWithContext(context.Background()) } -// PageFaultsInfo returns the process's page fault counters. +// PageFaults returns the process's page fault counters. func (p *Process) PageFaults() (*PageFaultsStat, error) { return p.PageFaultsWithContext(context.Background()) } @@ -530,7 +530,7 @@ func (p *Process) Connections() ([]net.ConnectionStat, error) { return p.ConnectionsWithContext(context.Background()) } -// Connections returns a slice of net.ConnectionStat used by the process at most `max`. +// ConnectionsMax returns a slice of net.ConnectionStat used by the process at most `max`. func (p *Process) ConnectionsMax(max int) ([]net.ConnectionStat, error) { return p.ConnectionsMaxWithContext(context.Background(), max) } diff --git a/vendor/github.com/sirupsen/logrus/writer.go b/vendor/github.com/sirupsen/logrus/writer.go index 72e8e3a1..074fd4b8 100644 --- a/vendor/github.com/sirupsen/logrus/writer.go +++ b/vendor/github.com/sirupsen/logrus/writer.go @@ -4,6 +4,7 @@ import ( "bufio" "io" "runtime" + "strings" ) // Writer at INFO level. See WriterLevel for details. @@ -20,15 +21,18 @@ func (logger *Logger) WriterLevel(level Level) *io.PipeWriter { return NewEntry(logger).WriterLevel(level) } +// Writer returns an io.Writer that writes to the logger at the info log level func (entry *Entry) Writer() *io.PipeWriter { return entry.WriterLevel(InfoLevel) } +// WriterLevel returns an io.Writer that writes to the logger at the given log level func (entry *Entry) WriterLevel(level Level) *io.PipeWriter { reader, writer := io.Pipe() var printFunc func(args ...interface{}) + // Determine which log function to use based on the specified log level switch level { case TraceLevel: printFunc = entry.Trace @@ -48,23 +52,51 @@ func (entry *Entry) WriterLevel(level Level) *io.PipeWriter { printFunc = entry.Print } + // Start a new goroutine to scan the input and write it to the logger using the specified print function. + // It splits the input into chunks of up to 64KB to avoid buffer overflows. go entry.writerScanner(reader, printFunc) + + // Set a finalizer function to close the writer when it is garbage collected runtime.SetFinalizer(writer, writerFinalizer) return writer } +// writerScanner scans the input from the reader and writes it to the logger func (entry *Entry) writerScanner(reader *io.PipeReader, printFunc func(args ...interface{})) { scanner := bufio.NewScanner(reader) - for scanner.Scan() { - printFunc(scanner.Text()) + + // Set the buffer size to the maximum token size to avoid buffer overflows + scanner.Buffer(make([]byte, bufio.MaxScanTokenSize), bufio.MaxScanTokenSize) + + // Define a split function to split the input into chunks of up to 64KB + chunkSize := bufio.MaxScanTokenSize // 64KB + splitFunc := func(data []byte, atEOF bool) (int, []byte, error) { + if len(data) >= chunkSize { + return chunkSize, data[:chunkSize], nil + } + + return bufio.ScanLines(data, atEOF) } + + // Use the custom split function to split the input + scanner.Split(splitFunc) + + // Scan the input and write it to the logger using the specified print function + for scanner.Scan() { + printFunc(strings.TrimRight(scanner.Text(), "\r\n")) + } + + // If there was an error while scanning the input, log an error if err := scanner.Err(); err != nil { entry.Errorf("Error while reading from Writer: %s", err) } + + // Close the reader when we are done reader.Close() } +// WriterFinalizer is a finalizer function that closes then given writer when it is garbage collected func writerFinalizer(writer *io.PipeWriter) { writer.Close() } diff --git a/vendor/github.com/tklauser/numcpus/.cirrus.yml b/vendor/github.com/tklauser/numcpus/.cirrus.yml index 53c0110b..69c6ced5 100644 --- a/vendor/github.com/tklauser/numcpus/.cirrus.yml +++ b/vendor/github.com/tklauser/numcpus/.cirrus.yml @@ -1,6 +1,6 @@ env: CIRRUS_CLONE_DEPTH: 1 - GO_VERSION: go1.19.1 + GO_VERSION: go1.20 freebsd_12_task: freebsd_instance: diff --git a/vendor/github.com/urfave/cli/v2/app.go b/vendor/github.com/urfave/cli/v2/app.go index 4b6675a2..19b76c9b 100644 --- a/vendor/github.com/urfave/cli/v2/app.go +++ b/vendor/github.com/urfave/cli/v2/app.go @@ -332,11 +332,18 @@ func (a *App) RunContext(ctx context.Context, arguments []string) (err error) { return a.rootCommand.Run(cCtx, arguments...) } -// This is a stub function to keep public API unchanged from old code -// -// Deprecated: use App.Run or App.RunContext +// RunAsSubcommand is for legacy/compatibility purposes only. New code should only +// use App.RunContext. This function is slated to be removed in v3. func (a *App) RunAsSubcommand(ctx *Context) (err error) { - return a.RunContext(ctx.Context, ctx.Args().Slice()) + a.Setup() + + cCtx := NewContext(a, nil, ctx) + cCtx.shellComplete = ctx.shellComplete + + a.rootCommand = a.newRootCommand() + cCtx.Command = a.rootCommand + + return a.rootCommand.Run(cCtx, ctx.Args().Slice()...) } func (a *App) suggestFlagFromError(err error, command string) (string, error) { diff --git a/vendor/github.com/urfave/cli/v2/command.go b/vendor/github.com/urfave/cli/v2/command.go index f978b4a4..69a0fdf6 100644 --- a/vendor/github.com/urfave/cli/v2/command.go +++ b/vendor/github.com/urfave/cli/v2/command.go @@ -135,6 +135,7 @@ func (c *Command) setup(ctx *Context) { if scmd.HelpName == "" { scmd.HelpName = fmt.Sprintf("%s %s", c.HelpName, scmd.Name) } + scmd.separator = c.separator newCmds = append(newCmds, scmd) } c.Subcommands = newCmds diff --git a/vendor/github.com/urfave/cli/v2/context.go b/vendor/github.com/urfave/cli/v2/context.go index dbf50e49..a45c120b 100644 --- a/vendor/github.com/urfave/cli/v2/context.go +++ b/vendor/github.com/urfave/cli/v2/context.go @@ -56,6 +56,7 @@ func (cCtx *Context) Set(name, value string) error { // IsSet determines if the flag was actually set func (cCtx *Context) IsSet(name string) bool { + if fs := cCtx.lookupFlagSet(name); fs != nil { isSet := false fs.Visit(func(f *flag.Flag) { @@ -72,7 +73,23 @@ func (cCtx *Context) IsSet(name string) bool { return false } - return f.IsSet() + if f.IsSet() { + return true + } + + // now redo flagset search on aliases + aliases := f.Names() + fs.Visit(func(f *flag.Flag) { + for _, alias := range aliases { + if f.Name == alias { + isSet = true + } + } + }) + + if isSet { + return true + } } return false @@ -204,9 +221,10 @@ func (cCtx *Context) checkRequiredFlags(flags []Flag) requiredFlagsErr { var flagPresent bool var flagName string - for _, key := range f.Names() { - flagName = key + flagNames := f.Names() + flagName = flagNames[0] + for _, key := range flagNames { if cCtx.IsSet(strings.TrimSpace(key)) { flagPresent = true } diff --git a/vendor/github.com/urfave/cli/v2/docs.go b/vendor/github.com/urfave/cli/v2/docs.go index 8b1c9c8a..6cd0624a 100644 --- a/vendor/github.com/urfave/cli/v2/docs.go +++ b/vendor/github.com/urfave/cli/v2/docs.go @@ -153,9 +153,14 @@ func prepareFlags( // flagDetails returns a string containing the flags metadata func flagDetails(flag DocGenerationFlag) string { description := flag.GetUsage() - value := flag.GetValue() - if value != "" { - description += " (default: " + value + ")" + if flag.TakesValue() { + defaultText := flag.GetDefaultText() + if defaultText == "" { + defaultText = flag.GetValue() + } + if defaultText != "" { + description += " (default: " + defaultText + ")" + } } return ": " + description } diff --git a/vendor/github.com/urfave/cli/v2/flag_bool.go b/vendor/github.com/urfave/cli/v2/flag_bool.go index f64d1cd9..369d18b7 100644 --- a/vendor/github.com/urfave/cli/v2/flag_bool.go +++ b/vendor/github.com/urfave/cli/v2/flag_bool.go @@ -52,7 +52,7 @@ func (b *boolValue) String() string { func (b *boolValue) IsBoolFlag() bool { return true } func (b *boolValue) Count() int { - if b.count != nil { + if b.count != nil && *b.count > 0 { return *b.count } return 0 @@ -130,6 +130,11 @@ func (f *BoolFlag) Apply(set *flag.FlagSet) error { if count == nil { count = new(int) } + + // since count will be incremented for each alias as well + // subtract number of aliases from overall count + *count -= len(f.Aliases) + if dest == nil { dest = new(bool) } diff --git a/vendor/github.com/urfave/cli/v2/flag_generic.go b/vendor/github.com/urfave/cli/v2/flag_generic.go index 4f9ac0a7..039ffdfe 100644 --- a/vendor/github.com/urfave/cli/v2/flag_generic.go +++ b/vendor/github.com/urfave/cli/v2/flag_generic.go @@ -117,13 +117,8 @@ func (cCtx *Context) Generic(name string) interface{} { } func lookupGeneric(name string, set *flag.FlagSet) interface{} { - f := set.Lookup(name) - if f != nil { - parsed, err := f.Value, error(nil) - if err != nil { - return nil - } - return parsed + if f := set.Lookup(name); f != nil { + return f.Value } return nil } diff --git a/vendor/github.com/urfave/cli/v2/flag_path.go b/vendor/github.com/urfave/cli/v2/flag_path.go index 6434d322..c4986779 100644 --- a/vendor/github.com/urfave/cli/v2/flag_path.go +++ b/vendor/github.com/urfave/cli/v2/flag_path.go @@ -90,13 +90,8 @@ func (cCtx *Context) Path(name string) string { } func lookupPath(name string, set *flag.FlagSet) string { - f := set.Lookup(name) - if f != nil { - parsed, err := f.Value.String(), error(nil) - if err != nil { - return "" - } - return parsed + if f := set.Lookup(name); f != nil { + return f.Value.String() } return "" } diff --git a/vendor/github.com/urfave/cli/v2/flag_string.go b/vendor/github.com/urfave/cli/v2/flag_string.go index 3050086e..4e55a2ca 100644 --- a/vendor/github.com/urfave/cli/v2/flag_string.go +++ b/vendor/github.com/urfave/cli/v2/flag_string.go @@ -87,10 +87,8 @@ func (cCtx *Context) String(name string) string { } func lookupString(name string, set *flag.FlagSet) string { - f := set.Lookup(name) - if f != nil { - parsed := f.Value.String() - return parsed + if f := set.Lookup(name); f != nil { + return f.Value.String() } return "" } diff --git a/vendor/github.com/urfave/cli/v2/godoc-current.txt b/vendor/github.com/urfave/cli/v2/godoc-current.txt index bd5e1def..6016bd82 100644 --- a/vendor/github.com/urfave/cli/v2/godoc-current.txt +++ b/vendor/github.com/urfave/cli/v2/godoc-current.txt @@ -141,7 +141,7 @@ USAGE: DESCRIPTION: {{template "descriptionTemplate" .}}{{end}}{{if .VisibleCommands}} -COMMANDS:{{template "visibleCommandTemplate" .}}{{end}}{{if .VisibleFlagCategories}} +COMMANDS:{{template "visibleCommandCategoryTemplate" .}}{{end}}{{if .VisibleFlagCategories}} OPTIONS:{{template "visibleFlagCategoryTemplate" .}}{{else if .VisibleFlags}} @@ -357,9 +357,8 @@ func (a *App) RunAndExitOnError() code in the cli.ExitCoder func (a *App) RunAsSubcommand(ctx *Context) (err error) - This is a stub function to keep public API unchanged from old code - - Deprecated: use App.Run or App.RunContext + RunAsSubcommand is for legacy/compatibility purposes only. New code should + only use App.RunContext. This function is slated to be removed in v3. func (a *App) RunContext(ctx context.Context, arguments []string) (err error) RunContext is like Run except it takes a Context that will be passed to diff --git a/vendor/github.com/urfave/cli/v2/help.go b/vendor/github.com/urfave/cli/v2/help.go index c7b8f55a..a71fceb7 100644 --- a/vendor/github.com/urfave/cli/v2/help.go +++ b/vendor/github.com/urfave/cli/v2/help.go @@ -42,6 +42,7 @@ var helpCommand = &Command{ // 3 $ app foo // 4 $ app help foo // 5 $ app foo help + // 6 $ app foo -h (with no other sub-commands nor flags defined) // Case 4. when executing a help command set the context to parent // to allow resolution of subsequent args. This will transform @@ -77,6 +78,8 @@ var helpCommand = &Command{ HelpPrinter(cCtx.App.Writer, templ, cCtx.Command) return nil } + + // Case 6, handling incorporated in the callee itself return ShowSubcommandHelp(cCtx) }, } @@ -292,8 +295,12 @@ func ShowSubcommandHelp(cCtx *Context) error { if cCtx == nil { return nil } - - HelpPrinter(cCtx.App.Writer, SubcommandHelpTemplate, cCtx.Command) + // use custom template when provided (fixes #1703) + templ := SubcommandHelpTemplate + if cCtx.Command != nil && cCtx.Command.CustomHelpTemplate != "" { + templ = cCtx.Command.CustomHelpTemplate + } + HelpPrinter(cCtx.App.Writer, templ, cCtx.Command) return nil } diff --git a/vendor/github.com/urfave/cli/v2/sliceflag.go b/vendor/github.com/urfave/cli/v2/sliceflag.go index 7dea3576..b2ca5904 100644 --- a/vendor/github.com/urfave/cli/v2/sliceflag.go +++ b/vendor/github.com/urfave/cli/v2/sliceflag.go @@ -1,6 +1,3 @@ -//go:build go1.18 -// +build go1.18 - package cli import ( diff --git a/vendor/github.com/urfave/cli/v2/sliceflag_pre18.go b/vendor/github.com/urfave/cli/v2/sliceflag_pre18.go deleted file mode 100644 index 1173ae74..00000000 --- a/vendor/github.com/urfave/cli/v2/sliceflag_pre18.go +++ /dev/null @@ -1,10 +0,0 @@ -//go:build !go1.18 -// +build !go1.18 - -package cli - -import ( - "flag" -) - -func unwrapFlagValue(v flag.Value) flag.Value { return v } diff --git a/vendor/github.com/urfave/cli/v2/template.go b/vendor/github.com/urfave/cli/v2/template.go index b565ba61..da98890e 100644 --- a/vendor/github.com/urfave/cli/v2/template.go +++ b/vendor/github.com/urfave/cli/v2/template.go @@ -88,7 +88,7 @@ USAGE: DESCRIPTION: {{template "descriptionTemplate" .}}{{end}}{{if .VisibleCommands}} -COMMANDS:{{template "visibleCommandTemplate" .}}{{end}}{{if .VisibleFlagCategories}} +COMMANDS:{{template "visibleCommandCategoryTemplate" .}}{{end}}{{if .VisibleFlagCategories}} OPTIONS:{{template "visibleFlagCategoryTemplate" .}}{{else if .VisibleFlags}} diff --git a/vendor/github.com/vektah/gqlparser/v2/.go-version b/vendor/github.com/vektah/gqlparser/v2/.go-version new file mode 100644 index 00000000..66e2ae6c --- /dev/null +++ b/vendor/github.com/vektah/gqlparser/v2/.go-version @@ -0,0 +1 @@ +1.19.1 diff --git a/vendor/github.com/vektah/gqlparser/v2/.golangci.yaml b/vendor/github.com/vektah/gqlparser/v2/.golangci.yaml new file mode 100644 index 00000000..accb83fa --- /dev/null +++ b/vendor/github.com/vektah/gqlparser/v2/.golangci.yaml @@ -0,0 +1,45 @@ +run: + timeout: 10m +linters: + disable-all: true + enable: + - ineffassign + - typecheck + - varcheck + - unused + - structcheck + - deadcode + - gosimple + - goimports + - errcheck + - staticcheck + - stylecheck + - gosec + - asciicheck + - bodyclose + - exportloopref + - rowserrcheck + - makezero + - durationcheck + - prealloc + - predeclared + +linters-settings: + staticcheck: + checks: ["S1002","S1004","S1007","S1009","S1010","S1012","S1019","S1020","S1021","S1024","S1030","SA2*","SA3*","SA4009","SA5*","SA6000","SA6001","SA6005", "-SA2002"] + stylecheck: + checks: ["-ST1003"] + gosec: + severity: "low" + confidence: "low" + excludes: + - G101 + - G112 +issues: + exclude-rules: + - path: _test\.go + linters: + - errcheck + - gosec + - rowserrcheck + - makezero diff --git a/vendor/github.com/vektah/gqlparser/v2/ast/path.go b/vendor/github.com/vektah/gqlparser/v2/ast/path.go index 9af16843..be1a9e4e 100644 --- a/vendor/github.com/vektah/gqlparser/v2/ast/path.go +++ b/vendor/github.com/vektah/gqlparser/v2/ast/path.go @@ -60,8 +60,8 @@ func (path *Path) UnmarshalJSON(b []byte) error { type PathIndex int -func (_ PathIndex) isPathElement() {} +func (PathIndex) isPathElement() {} type PathName string -func (_ PathName) isPathElement() {} +func (PathName) isPathElement() {} diff --git a/vendor/github.com/vektah/gqlparser/v2/ast/selection.go b/vendor/github.com/vektah/gqlparser/v2/ast/selection.go index 159db844..5ef26c6a 100644 --- a/vendor/github.com/vektah/gqlparser/v2/ast/selection.go +++ b/vendor/github.com/vektah/gqlparser/v2/ast/selection.go @@ -34,6 +34,6 @@ type Argument struct { Position *Position `dump:"-"` } -func (f *Field) ArgumentMap(vars map[string]interface{}) map[string]interface{} { - return arg2map(f.Definition.Arguments, f.Arguments, vars) +func (s *Field) ArgumentMap(vars map[string]interface{}) map[string]interface{} { + return arg2map(s.Definition.Arguments, s.Arguments, vars) } diff --git a/vendor/github.com/vektah/gqlparser/v2/ast/type.go b/vendor/github.com/vektah/gqlparser/v2/ast/type.go index 9577fdb4..5f77bc7c 100644 --- a/vendor/github.com/vektah/gqlparser/v2/ast/type.go +++ b/vendor/github.com/vektah/gqlparser/v2/ast/type.go @@ -63,6 +63,6 @@ func (t *Type) IsCompatible(other *Type) bool { return true } -func (v *Type) Dump() string { - return v.String() +func (t *Type) Dump() string { + return t.String() } diff --git a/vendor/github.com/vektah/gqlparser/v2/gqlerror/error.go b/vendor/github.com/vektah/gqlparser/v2/gqlerror/error.go index 8145061a..79e9e0d1 100644 --- a/vendor/github.com/vektah/gqlparser/v2/gqlerror/error.go +++ b/vendor/github.com/vektah/gqlparser/v2/gqlerror/error.go @@ -9,7 +9,7 @@ import ( "github.com/vektah/gqlparser/v2/ast" ) -// Error is the standard graphql error type described in https://facebook.github.io/graphql/draft/#sec-Errors +// Error is the standard graphql error type described in https://spec.graphql.org/draft/#sec-Errors type Error struct { err error `json:"-"` Message string `json:"message"` @@ -107,6 +107,13 @@ func WrapPath(path ast.Path, err error) *Error { } } +func Wrap(err error) *Error { + return &Error{ + err: err, + Message: err.Error(), + } +} + func Errorf(message string, args ...interface{}) *Error { return &Error{ Message: fmt.Sprintf(message, args...), diff --git a/vendor/github.com/vektah/gqlparser/v2/gqlparser.go b/vendor/github.com/vektah/gqlparser/v2/gqlparser.go index e242a896..3a6e2d13 100644 --- a/vendor/github.com/vektah/gqlparser/v2/gqlparser.go +++ b/vendor/github.com/vektah/gqlparser/v2/gqlparser.go @@ -5,11 +5,21 @@ import ( "github.com/vektah/gqlparser/v2/gqlerror" "github.com/vektah/gqlparser/v2/parser" "github.com/vektah/gqlparser/v2/validator" + + // Blank import is used to load up the validator rules. _ "github.com/vektah/gqlparser/v2/validator/rules" ) func LoadSchema(str ...*ast.Source) (*ast.Schema, error) { - return validator.LoadSchema(append([]*ast.Source{validator.Prelude}, str...)...) + ast, err := validator.LoadSchema(append([]*ast.Source{validator.Prelude}, str...)...) + gqlErr, ok := err.(*gqlerror.Error) + if ok { + return ast, gqlErr + } + if err != nil { + return ast, gqlerror.Wrap(err) + } + return ast, nil } func MustLoadSchema(str ...*ast.Source) *ast.Schema { @@ -23,11 +33,14 @@ func MustLoadSchema(str ...*ast.Source) *ast.Schema { func LoadQuery(schema *ast.Schema, str string) (*ast.QueryDocument, gqlerror.List) { query, err := parser.ParseQuery(&ast.Source{Input: str}) if err != nil { - gqlErr := err.(*gqlerror.Error) - return nil, gqlerror.List{gqlErr} + gqlErr, ok := err.(*gqlerror.Error) + if ok { + return nil, gqlerror.List{gqlErr} + } + return nil, gqlerror.List{gqlerror.Wrap(err)} } errs := validator.Validate(schema, query) - if errs != nil { + if len(errs) > 0 { return nil, errs } diff --git a/vendor/github.com/vektah/gqlparser/v2/lexer/lexer.go b/vendor/github.com/vektah/gqlparser/v2/lexer/lexer.go index 25dcdcb9..8ce04fd2 100644 --- a/vendor/github.com/vektah/gqlparser/v2/lexer/lexer.go +++ b/vendor/github.com/vektah/gqlparser/v2/lexer/lexer.go @@ -121,7 +121,9 @@ func (s *Lexer) ReadToken() (token Token, err error) { case '|': return s.makeValueToken(Pipe, "") case '#': - s.readComment() + if comment, err := s.readComment(); err != nil { + return comment, err + } return s.ReadToken() case '_', 'a', 'b', 'c', 'd', 'e', 'f', 'g', 'h', 'i', 'j', 'k', 'l', 'm', 'n', 'o', 'p', 'q', 'r', 's', 't', 'u', 'v', 'w', 'x', 'y', 'z', 'A', 'B', 'C', 'D', 'E', 'F', 'G', 'H', 'I', 'J', 'K', 'L', 'M', 'N', 'O', 'P', 'Q', 'R', 'S', 'T', 'U', 'V', 'W', 'X', 'Y', 'Z': @@ -254,9 +256,9 @@ func (s *Lexer) readNumber() (Token, error) { if float { return s.makeToken(Float) - } else { - return s.makeToken(Int) } + return s.makeToken(Int) + } // acceptByte if it matches any of given bytes, returning true if it found anything @@ -393,8 +395,8 @@ func (s *Lexer) readString() (Token, error) { case 't': buf.WriteByte('\t') default: - s.end += 1 - s.endRunes += 1 + s.end++ + s.endRunes++ return s.makeError("Invalid character escape sequence: \\%s.", string(escape)) } s.end += 2 diff --git a/vendor/github.com/vektah/gqlparser/v2/lexer/lexer_test.yml b/vendor/github.com/vektah/gqlparser/v2/lexer/lexer_test.yml index 5c4d5f0f..d85afb41 100644 --- a/vendor/github.com/vektah/gqlparser/v2/lexer/lexer_test.yml +++ b/vendor/github.com/vektah/gqlparser/v2/lexer/lexer_test.yml @@ -674,7 +674,6 @@ lex reports useful unknown character error: - name: question mark input: "?" error: - message: 'Cannot parse the unexpected character "?".' message: 'Cannot parse the unexpected character "?".' locations: [{ line: 1, column: 1 }] diff --git a/vendor/github.com/vektah/gqlparser/v2/parser/query.go b/vendor/github.com/vektah/gqlparser/v2/parser/query.go index a38d982a..123423bb 100644 --- a/vendor/github.com/vektah/gqlparser/v2/parser/query.go +++ b/vendor/github.com/vektah/gqlparser/v2/parser/query.go @@ -3,6 +3,7 @@ package parser import ( "github.com/vektah/gqlparser/v2/lexer" + //nolint:revive . "github.com/vektah/gqlparser/v2/ast" ) diff --git a/vendor/github.com/vektah/gqlparser/v2/parser/schema.go b/vendor/github.com/vektah/gqlparser/v2/parser/schema.go index aec08a97..9656bcca 100644 --- a/vendor/github.com/vektah/gqlparser/v2/parser/schema.go +++ b/vendor/github.com/vektah/gqlparser/v2/parser/schema.go @@ -1,6 +1,7 @@ package parser import ( + //nolint:revive . "github.com/vektah/gqlparser/v2/ast" "github.com/vektah/gqlparser/v2/lexer" ) diff --git a/vendor/github.com/vektah/gqlparser/v2/validator/prelude.go b/vendor/github.com/vektah/gqlparser/v2/validator/prelude.go index c354ec0d..43766f22 100644 --- a/vendor/github.com/vektah/gqlparser/v2/validator/prelude.go +++ b/vendor/github.com/vektah/gqlparser/v2/validator/prelude.go @@ -2,6 +2,7 @@ package validator import ( _ "embed" + "github.com/vektah/gqlparser/v2/ast" ) diff --git a/vendor/github.com/vektah/gqlparser/v2/validator/prelude.graphql b/vendor/github.com/vektah/gqlparser/v2/validator/prelude.graphql index bdca0096..e199da5d 100644 --- a/vendor/github.com/vektah/gqlparser/v2/validator/prelude.graphql +++ b/vendor/github.com/vektah/gqlparser/v2/validator/prelude.graphql @@ -27,6 +27,9 @@ directive @deprecated(reason: String = "No longer supported") on FIELD_DEFINITIO "The @specifiedBy built-in directive is used within the type system definition language to provide a scalar specification URL for specifying the behavior of custom scalar types." directive @specifiedBy(url: String!) on SCALAR +"The @defer directive may be specified on a fragment spread to imply de-prioritization, that causes the fragment to be omitted in the initial response, and delivered as a subsequent response afterward. A query with @defer directive will cause the request to potentially return multiple responses, where non-deferred data is delivered in the initial response and data deferred delivered in a subsequent response. @include and @skip take precedence over @defer." +directive @defer(if: Boolean = true, label: String) on FRAGMENT_SPREAD | INLINE_FRAGMENT + type __Schema { description: String types: [__Type!]! diff --git a/vendor/github.com/vektah/gqlparser/v2/validator/rules/fields_on_correct_type.go b/vendor/github.com/vektah/gqlparser/v2/validator/rules/fields_on_correct_type.go index aa83c696..77c3fdac 100644 --- a/vendor/github.com/vektah/gqlparser/v2/validator/rules/fields_on_correct_type.go +++ b/vendor/github.com/vektah/gqlparser/v2/validator/rules/fields_on_correct_type.go @@ -6,6 +6,8 @@ import ( "strings" "github.com/vektah/gqlparser/v2/ast" + + //nolint:revive // Validator rules each use dot imports for convenience. . "github.com/vektah/gqlparser/v2/validator" ) @@ -41,11 +43,12 @@ func getSuggestedTypeNames(walker *Walker, parent *ast.Definition, name string) return nil } - var suggestedObjectTypes []string + possibleTypes := walker.Schema.GetPossibleTypes(parent) + var suggestedObjectTypes = make([]string, 0, len(possibleTypes)) var suggestedInterfaceTypes []string interfaceUsageCount := map[string]int{} - for _, possibleType := range walker.Schema.GetPossibleTypes(parent) { + for _, possibleType := range possibleTypes { field := possibleType.Fields.ForName(name) if field == nil { continue @@ -85,7 +88,7 @@ func getSuggestedFieldNames(parent *ast.Definition, name string) []string { return nil } - var possibleFieldNames []string + var possibleFieldNames = make([]string, 0, len(parent.Fields)) for _, field := range parent.Fields { possibleFieldNames = append(possibleFieldNames, field.Name) } diff --git a/vendor/github.com/vektah/gqlparser/v2/validator/rules/fragments_on_composite_types.go b/vendor/github.com/vektah/gqlparser/v2/validator/rules/fragments_on_composite_types.go index 5215f697..81ef861b 100644 --- a/vendor/github.com/vektah/gqlparser/v2/validator/rules/fragments_on_composite_types.go +++ b/vendor/github.com/vektah/gqlparser/v2/validator/rules/fragments_on_composite_types.go @@ -4,6 +4,8 @@ import ( "fmt" "github.com/vektah/gqlparser/v2/ast" + + //nolint:revive // Validator rules each use dot imports for convenience. . "github.com/vektah/gqlparser/v2/validator" ) diff --git a/vendor/github.com/vektah/gqlparser/v2/validator/rules/known_argument_names.go b/vendor/github.com/vektah/gqlparser/v2/validator/rules/known_argument_names.go index da5a7962..c187dabf 100644 --- a/vendor/github.com/vektah/gqlparser/v2/validator/rules/known_argument_names.go +++ b/vendor/github.com/vektah/gqlparser/v2/validator/rules/known_argument_names.go @@ -2,6 +2,8 @@ package validator import ( "github.com/vektah/gqlparser/v2/ast" + + //nolint:revive // Validator rules each use dot imports for convenience. . "github.com/vektah/gqlparser/v2/validator" ) diff --git a/vendor/github.com/vektah/gqlparser/v2/validator/rules/known_directives.go b/vendor/github.com/vektah/gqlparser/v2/validator/rules/known_directives.go index 18fe41fd..9b5f28db 100644 --- a/vendor/github.com/vektah/gqlparser/v2/validator/rules/known_directives.go +++ b/vendor/github.com/vektah/gqlparser/v2/validator/rules/known_directives.go @@ -2,6 +2,8 @@ package validator import ( "github.com/vektah/gqlparser/v2/ast" + + //nolint:revive // Validator rules each use dot imports for convenience. . "github.com/vektah/gqlparser/v2/validator" ) @@ -12,7 +14,7 @@ func init() { Line int Column int } - var seen map[mayNotBeUsedDirective]bool = map[mayNotBeUsedDirective]bool{} + var seen = map[mayNotBeUsedDirective]bool{} observers.OnDirective(func(walker *Walker, directive *ast.Directive) { if directive.Definition == nil { addError( diff --git a/vendor/github.com/vektah/gqlparser/v2/validator/rules/known_fragment_names.go b/vendor/github.com/vektah/gqlparser/v2/validator/rules/known_fragment_names.go index b7427d0d..3afd9c1c 100644 --- a/vendor/github.com/vektah/gqlparser/v2/validator/rules/known_fragment_names.go +++ b/vendor/github.com/vektah/gqlparser/v2/validator/rules/known_fragment_names.go @@ -2,6 +2,8 @@ package validator import ( "github.com/vektah/gqlparser/v2/ast" + + //nolint:revive // Validator rules each use dot imports for convenience. . "github.com/vektah/gqlparser/v2/validator" ) diff --git a/vendor/github.com/vektah/gqlparser/v2/validator/rules/known_root_type.go b/vendor/github.com/vektah/gqlparser/v2/validator/rules/known_root_type.go index 4c60c8d8..60bc0d52 100644 --- a/vendor/github.com/vektah/gqlparser/v2/validator/rules/known_root_type.go +++ b/vendor/github.com/vektah/gqlparser/v2/validator/rules/known_root_type.go @@ -4,6 +4,8 @@ import ( "fmt" "github.com/vektah/gqlparser/v2/ast" + + //nolint:revive // Validator rules each use dot imports for convenience. . "github.com/vektah/gqlparser/v2/validator" ) diff --git a/vendor/github.com/vektah/gqlparser/v2/validator/rules/known_type_names.go b/vendor/github.com/vektah/gqlparser/v2/validator/rules/known_type_names.go index 7abfbf62..902939d3 100644 --- a/vendor/github.com/vektah/gqlparser/v2/validator/rules/known_type_names.go +++ b/vendor/github.com/vektah/gqlparser/v2/validator/rules/known_type_names.go @@ -2,6 +2,8 @@ package validator import ( "github.com/vektah/gqlparser/v2/ast" + + //nolint:revive // Validator rules each use dot imports for convenience. . "github.com/vektah/gqlparser/v2/validator" ) diff --git a/vendor/github.com/vektah/gqlparser/v2/validator/rules/lone_anonymous_operation.go b/vendor/github.com/vektah/gqlparser/v2/validator/rules/lone_anonymous_operation.go index d2752854..fe8bb203 100644 --- a/vendor/github.com/vektah/gqlparser/v2/validator/rules/lone_anonymous_operation.go +++ b/vendor/github.com/vektah/gqlparser/v2/validator/rules/lone_anonymous_operation.go @@ -2,6 +2,8 @@ package validator import ( "github.com/vektah/gqlparser/v2/ast" + + //nolint:revive // Validator rules each use dot imports for convenience. . "github.com/vektah/gqlparser/v2/validator" ) diff --git a/vendor/github.com/vektah/gqlparser/v2/validator/rules/no_fragment_cycles.go b/vendor/github.com/vektah/gqlparser/v2/validator/rules/no_fragment_cycles.go index da73f349..a953174f 100644 --- a/vendor/github.com/vektah/gqlparser/v2/validator/rules/no_fragment_cycles.go +++ b/vendor/github.com/vektah/gqlparser/v2/validator/rules/no_fragment_cycles.go @@ -5,6 +5,8 @@ import ( "strings" "github.com/vektah/gqlparser/v2/ast" + + //nolint:revive // Validator rules each use dot imports for convenience. . "github.com/vektah/gqlparser/v2/validator" ) diff --git a/vendor/github.com/vektah/gqlparser/v2/validator/rules/no_undefined_variables.go b/vendor/github.com/vektah/gqlparser/v2/validator/rules/no_undefined_variables.go index 91df727a..46c18d12 100644 --- a/vendor/github.com/vektah/gqlparser/v2/validator/rules/no_undefined_variables.go +++ b/vendor/github.com/vektah/gqlparser/v2/validator/rules/no_undefined_variables.go @@ -2,6 +2,8 @@ package validator import ( "github.com/vektah/gqlparser/v2/ast" + + //nolint:revive // Validator rules each use dot imports for convenience. . "github.com/vektah/gqlparser/v2/validator" ) diff --git a/vendor/github.com/vektah/gqlparser/v2/validator/rules/no_unused_fragments.go b/vendor/github.com/vektah/gqlparser/v2/validator/rules/no_unused_fragments.go index dfc89672..218ffa77 100644 --- a/vendor/github.com/vektah/gqlparser/v2/validator/rules/no_unused_fragments.go +++ b/vendor/github.com/vektah/gqlparser/v2/validator/rules/no_unused_fragments.go @@ -2,6 +2,8 @@ package validator import ( "github.com/vektah/gqlparser/v2/ast" + + //nolint:revive // Validator rules each use dot imports for convenience. . "github.com/vektah/gqlparser/v2/validator" ) diff --git a/vendor/github.com/vektah/gqlparser/v2/validator/rules/no_unused_variables.go b/vendor/github.com/vektah/gqlparser/v2/validator/rules/no_unused_variables.go index df2e5f4b..d3088109 100644 --- a/vendor/github.com/vektah/gqlparser/v2/validator/rules/no_unused_variables.go +++ b/vendor/github.com/vektah/gqlparser/v2/validator/rules/no_unused_variables.go @@ -2,6 +2,8 @@ package validator import ( "github.com/vektah/gqlparser/v2/ast" + + //nolint:revive // Validator rules each use dot imports for convenience. . "github.com/vektah/gqlparser/v2/validator" ) diff --git a/vendor/github.com/vektah/gqlparser/v2/validator/rules/overlapping_fields_can_be_merged.go b/vendor/github.com/vektah/gqlparser/v2/validator/rules/overlapping_fields_can_be_merged.go index 38e1efa1..2ffc3dd1 100644 --- a/vendor/github.com/vektah/gqlparser/v2/validator/rules/overlapping_fields_can_be_merged.go +++ b/vendor/github.com/vektah/gqlparser/v2/validator/rules/overlapping_fields_can_be_merged.go @@ -6,6 +6,8 @@ import ( "reflect" "github.com/vektah/gqlparser/v2/ast" + + //nolint:revive // Validator rules each use dot imports for convenience. . "github.com/vektah/gqlparser/v2/validator" ) diff --git a/vendor/github.com/vektah/gqlparser/v2/validator/rules/possible_fragment_spreads.go b/vendor/github.com/vektah/gqlparser/v2/validator/rules/possible_fragment_spreads.go index a3f795c9..bed70289 100644 --- a/vendor/github.com/vektah/gqlparser/v2/validator/rules/possible_fragment_spreads.go +++ b/vendor/github.com/vektah/gqlparser/v2/validator/rules/possible_fragment_spreads.go @@ -2,6 +2,8 @@ package validator import ( "github.com/vektah/gqlparser/v2/ast" + + //nolint:revive // Validator rules each use dot imports for convenience. . "github.com/vektah/gqlparser/v2/validator" ) diff --git a/vendor/github.com/vektah/gqlparser/v2/validator/rules/provided_required_arguments.go b/vendor/github.com/vektah/gqlparser/v2/validator/rules/provided_required_arguments.go index d8ed6520..ab79163b 100644 --- a/vendor/github.com/vektah/gqlparser/v2/validator/rules/provided_required_arguments.go +++ b/vendor/github.com/vektah/gqlparser/v2/validator/rules/provided_required_arguments.go @@ -2,6 +2,8 @@ package validator import ( "github.com/vektah/gqlparser/v2/ast" + + //nolint:revive // Validator rules each use dot imports for convenience. . "github.com/vektah/gqlparser/v2/validator" ) diff --git a/vendor/github.com/vektah/gqlparser/v2/validator/rules/scalar_leafs.go b/vendor/github.com/vektah/gqlparser/v2/validator/rules/scalar_leafs.go index 718bc683..605ab9e8 100644 --- a/vendor/github.com/vektah/gqlparser/v2/validator/rules/scalar_leafs.go +++ b/vendor/github.com/vektah/gqlparser/v2/validator/rules/scalar_leafs.go @@ -2,6 +2,8 @@ package validator import ( "github.com/vektah/gqlparser/v2/ast" + + //nolint:revive // Validator rules each use dot imports for convenience. . "github.com/vektah/gqlparser/v2/validator" ) diff --git a/vendor/github.com/vektah/gqlparser/v2/validator/rules/single_field_subscriptions.go b/vendor/github.com/vektah/gqlparser/v2/validator/rules/single_field_subscriptions.go index a9e5bf63..7d4c6843 100644 --- a/vendor/github.com/vektah/gqlparser/v2/validator/rules/single_field_subscriptions.go +++ b/vendor/github.com/vektah/gqlparser/v2/validator/rules/single_field_subscriptions.go @@ -5,6 +5,8 @@ import ( "strings" "github.com/vektah/gqlparser/v2/ast" + + //nolint:revive // Validator rules each use dot imports for convenience. . "github.com/vektah/gqlparser/v2/validator" ) diff --git a/vendor/github.com/vektah/gqlparser/v2/validator/rules/unique_argument_names.go b/vendor/github.com/vektah/gqlparser/v2/validator/rules/unique_argument_names.go index 1d9a50ab..e977d638 100644 --- a/vendor/github.com/vektah/gqlparser/v2/validator/rules/unique_argument_names.go +++ b/vendor/github.com/vektah/gqlparser/v2/validator/rules/unique_argument_names.go @@ -2,6 +2,8 @@ package validator import ( "github.com/vektah/gqlparser/v2/ast" + + //nolint:revive // Validator rules each use dot imports for convenience. . "github.com/vektah/gqlparser/v2/validator" ) diff --git a/vendor/github.com/vektah/gqlparser/v2/validator/rules/unique_directives_per_location.go b/vendor/github.com/vektah/gqlparser/v2/validator/rules/unique_directives_per_location.go index 52dfb21e..47971ee1 100644 --- a/vendor/github.com/vektah/gqlparser/v2/validator/rules/unique_directives_per_location.go +++ b/vendor/github.com/vektah/gqlparser/v2/validator/rules/unique_directives_per_location.go @@ -2,6 +2,8 @@ package validator import ( "github.com/vektah/gqlparser/v2/ast" + + //nolint:revive // Validator rules each use dot imports for convenience. . "github.com/vektah/gqlparser/v2/validator" ) diff --git a/vendor/github.com/vektah/gqlparser/v2/validator/rules/unique_fragment_names.go b/vendor/github.com/vektah/gqlparser/v2/validator/rules/unique_fragment_names.go index 8c348aea..2c44a437 100644 --- a/vendor/github.com/vektah/gqlparser/v2/validator/rules/unique_fragment_names.go +++ b/vendor/github.com/vektah/gqlparser/v2/validator/rules/unique_fragment_names.go @@ -2,6 +2,8 @@ package validator import ( "github.com/vektah/gqlparser/v2/ast" + + //nolint:revive // Validator rules each use dot imports for convenience. . "github.com/vektah/gqlparser/v2/validator" ) diff --git a/vendor/github.com/vektah/gqlparser/v2/validator/rules/unique_input_field_names.go b/vendor/github.com/vektah/gqlparser/v2/validator/rules/unique_input_field_names.go index 092be671..c5fce8ff 100644 --- a/vendor/github.com/vektah/gqlparser/v2/validator/rules/unique_input_field_names.go +++ b/vendor/github.com/vektah/gqlparser/v2/validator/rules/unique_input_field_names.go @@ -2,6 +2,8 @@ package validator import ( "github.com/vektah/gqlparser/v2/ast" + + //nolint:revive // Validator rules each use dot imports for convenience. . "github.com/vektah/gqlparser/v2/validator" ) diff --git a/vendor/github.com/vektah/gqlparser/v2/validator/rules/unique_operation_names.go b/vendor/github.com/vektah/gqlparser/v2/validator/rules/unique_operation_names.go index 4d41b60a..49ffbe47 100644 --- a/vendor/github.com/vektah/gqlparser/v2/validator/rules/unique_operation_names.go +++ b/vendor/github.com/vektah/gqlparser/v2/validator/rules/unique_operation_names.go @@ -2,6 +2,8 @@ package validator import ( "github.com/vektah/gqlparser/v2/ast" + + //nolint:revive // Validator rules each use dot imports for convenience. . "github.com/vektah/gqlparser/v2/validator" ) diff --git a/vendor/github.com/vektah/gqlparser/v2/validator/rules/unique_variable_names.go b/vendor/github.com/vektah/gqlparser/v2/validator/rules/unique_variable_names.go index 6481ef4c..c93948c1 100644 --- a/vendor/github.com/vektah/gqlparser/v2/validator/rules/unique_variable_names.go +++ b/vendor/github.com/vektah/gqlparser/v2/validator/rules/unique_variable_names.go @@ -2,6 +2,8 @@ package validator import ( "github.com/vektah/gqlparser/v2/ast" + + //nolint:revive // Validator rules each use dot imports for convenience. . "github.com/vektah/gqlparser/v2/validator" ) diff --git a/vendor/github.com/vektah/gqlparser/v2/validator/rules/values_of_correct_type.go b/vendor/github.com/vektah/gqlparser/v2/validator/rules/values_of_correct_type.go index 22bea771..7ba6928b 100644 --- a/vendor/github.com/vektah/gqlparser/v2/validator/rules/values_of_correct_type.go +++ b/vendor/github.com/vektah/gqlparser/v2/validator/rules/values_of_correct_type.go @@ -6,6 +6,8 @@ import ( "strconv" "github.com/vektah/gqlparser/v2/ast" + + //nolint:revive // Validator rules each use dot imports for convenience. . "github.com/vektah/gqlparser/v2/validator" ) diff --git a/vendor/github.com/vektah/gqlparser/v2/validator/rules/variables_are_input_types.go b/vendor/github.com/vektah/gqlparser/v2/validator/rules/variables_are_input_types.go index 4ea94e5a..d16ee021 100644 --- a/vendor/github.com/vektah/gqlparser/v2/validator/rules/variables_are_input_types.go +++ b/vendor/github.com/vektah/gqlparser/v2/validator/rules/variables_are_input_types.go @@ -2,6 +2,8 @@ package validator import ( "github.com/vektah/gqlparser/v2/ast" + + //nolint:revive // Validator rules each use dot imports for convenience. . "github.com/vektah/gqlparser/v2/validator" ) diff --git a/vendor/github.com/vektah/gqlparser/v2/validator/rules/variables_in_allowed_position.go b/vendor/github.com/vektah/gqlparser/v2/validator/rules/variables_in_allowed_position.go index eef74354..e3fd6fbb 100644 --- a/vendor/github.com/vektah/gqlparser/v2/validator/rules/variables_in_allowed_position.go +++ b/vendor/github.com/vektah/gqlparser/v2/validator/rules/variables_in_allowed_position.go @@ -2,6 +2,8 @@ package validator import ( "github.com/vektah/gqlparser/v2/ast" + + //nolint:revive // Validator rules each use dot imports for convenience. . "github.com/vektah/gqlparser/v2/validator" ) diff --git a/vendor/github.com/vektah/gqlparser/v2/validator/schema.go b/vendor/github.com/vektah/gqlparser/v2/validator/schema.go index 976ed830..21eb51a5 100644 --- a/vendor/github.com/vektah/gqlparser/v2/validator/schema.go +++ b/vendor/github.com/vektah/gqlparser/v2/validator/schema.go @@ -5,6 +5,7 @@ import ( "strconv" "strings" + //nolint:revive . "github.com/vektah/gqlparser/v2/ast" "github.com/vektah/gqlparser/v2/gqlerror" "github.com/vektah/gqlparser/v2/parser" @@ -85,7 +86,7 @@ func ValidateSchemaDocument(ast *SchemaDocument) (*Schema, error) { // scalars, it may (§3.13) define builtin directives. Here we check for // that, and reject doubly-defined directives otherwise. switch dir.Name { - case "include", "skip", "deprecated", "specifiedBy": // the builtins + case "include", "skip", "deprecated", "specifiedBy", "defer": // the builtins // In principle here we might want to validate that the // directives are the same. But they might not be, if the // server has an older spec than we do. (Plus, validating this @@ -283,6 +284,9 @@ func validateDefinition(schema *Schema, def *Definition) *gqlerror.Error { return gqlerror.ErrorPosf(def.Position, "%s %s: non-enum value %s.", def.Kind, def.Name, value.Name) } } + if err := validateDirectives(schema, value.Directives, LocationEnumValue, nil); err != nil { + return err + } } case InputObject: if len(def.Fields) == 0 { @@ -358,11 +362,12 @@ func validateDirectives(schema *Schema, dirs DirectiveList, location DirectiveLo if currentDirective != nil && dir.Name == currentDirective.Name { return gqlerror.ErrorPosf(dir.Position, "Directive %s cannot refer to itself.", currentDirective.Name) } - if schema.Directives[dir.Name] == nil { + dirDefinition := schema.Directives[dir.Name] + if dirDefinition == nil { return gqlerror.ErrorPosf(dir.Position, "Undefined directive %s.", dir.Name) } validKind := false - for _, dirLocation := range schema.Directives[dir.Name].Locations { + for _, dirLocation := range dirDefinition.Locations { if dirLocation == location { validKind = true break @@ -371,6 +376,18 @@ func validateDirectives(schema *Schema, dirs DirectiveList, location DirectiveLo if !validKind { return gqlerror.ErrorPosf(dir.Position, "Directive %s is not applicable on %s.", dir.Name, location) } + for _, arg := range dir.Arguments { + if dirDefinition.Arguments.ForName(arg.Name) == nil { + return gqlerror.ErrorPosf(arg.Position, "Undefined argument %s for directive %s.", arg.Name, dir.Name) + } + } + for _, schemaArg := range dirDefinition.Arguments { + if schemaArg.Type.NonNull { + if arg := dir.Arguments.ForName(schemaArg.Name); arg == nil || arg.Value.Kind == NullValue { + return gqlerror.ErrorPosf(dir.Position, "Argument %s for directive %s cannot be null.", schemaArg.Name, dir.Name) + } + } + } dir.Definition = schema.Directives[dir.Name] } return nil @@ -378,7 +395,7 @@ func validateDirectives(schema *Schema, dirs DirectiveList, location DirectiveLo func validateImplements(schema *Schema, def *Definition, intfName string) *gqlerror.Error { // see validation rules at the bottom of - // https://facebook.github.io/graphql/October2021/#sec-Objects + // https://spec.graphql.org/October2021/#sec-Objects intf := schema.Types[intfName] if intf == nil { return gqlerror.ErrorPosf(def.Position, "Undefined type %s.", strconv.Quote(intfName)) diff --git a/vendor/github.com/vektah/gqlparser/v2/validator/schema_test.yml b/vendor/github.com/vektah/gqlparser/v2/validator/schema_test.yml index 7034a469..c16caabb 100644 --- a/vendor/github.com/vektah/gqlparser/v2/validator/schema_test.yml +++ b/vendor/github.com/vektah/gqlparser/v2/validator/schema_test.yml @@ -528,7 +528,16 @@ directives: directive @skip(if: Boolean!) on FIELD | FRAGMENT_SPREAD | INLINE_FRAGMENT directive @skip(if: Boolean!) on FIELD | FRAGMENT_SPREAD | INLINE_FRAGMENT - - name: must be declared + - name: must be declared (type) + input: | + type User @foo { + name: String + } + error: + message: "Undefined directive foo." + locations: [{line: 1, column: 12}] + + - name: must be declared (field) input: | type User { name: String @foo @@ -537,6 +546,15 @@ directives: message: "Undefined directive foo." locations: [{line: 2, column: 17}] + - name: must be declared (enum) + input: | + enum Unit { + METER @foo + } + error: + message: "Undefined directive foo." + locations: [{line: 2, column: 10}] + - name: cannot be self-referential input: | directive @A(foo: Int! @A) on FIELD_DEFINITION @@ -604,6 +622,32 @@ directives: type P { name: String @testField } interface I { id: ID @testField } + - name: Invalid directive argument not allowed + input: | + directive @foo(bla: Int!) on FIELD_DEFINITION + type P {f: Int @foo(foobla: 11)} + + error: + message: 'Undefined argument foobla for directive foo.' + locations: [{line: 2, column: 21}] + + - name: non-null argument must be provided + input: | + directive @foo(bla: Int!) on FIELD_DEFINITION + type P {f: Int @foo } + + error: + message: 'Argument bla for directive foo cannot be null.' + locations: [{line: 2, column: 17}] + + - name: non-null argument must not be null + input: | + directive @foo(bla: Int!) on FIELD_DEFINITION + type P {f: Int @foo(bla: null) } + + error: + message: 'Argument bla for directive foo cannot be null.' + locations: [{line: 2, column: 17}] entry points: - name: multiple schema entry points diff --git a/vendor/github.com/vektah/gqlparser/v2/validator/validator.go b/vendor/github.com/vektah/gqlparser/v2/validator/validator.go index 34bf93db..b4f37ce2 100644 --- a/vendor/github.com/vektah/gqlparser/v2/validator/validator.go +++ b/vendor/github.com/vektah/gqlparser/v2/validator/validator.go @@ -1,6 +1,7 @@ package validator import ( + //nolint:revive . "github.com/vektah/gqlparser/v2/ast" "github.com/vektah/gqlparser/v2/gqlerror" ) @@ -24,7 +25,15 @@ func AddRule(name string, f ruleFunc) { func Validate(schema *Schema, doc *QueryDocument) gqlerror.List { var errs gqlerror.List - + if schema == nil { + errs = append(errs, gqlerror.Errorf("cannot validate as Schema is nil")) + } + if doc == nil { + errs = append(errs, gqlerror.Errorf("cannot validate as QueryDocument is nil")) + } + if len(errs) > 0 { + return errs + } observers := &Events{} for i := range rules { rule := rules[i] diff --git a/vendor/github.com/vektah/gqlparser/v2/validator/vars.go b/vendor/github.com/vektah/gqlparser/v2/validator/vars.go index 8dbb05bc..df530234 100644 --- a/vendor/github.com/vektah/gqlparser/v2/validator/vars.go +++ b/vendor/github.com/vektah/gqlparser/v2/validator/vars.go @@ -11,7 +11,7 @@ import ( "github.com/vektah/gqlparser/v2/gqlerror" ) -var UnexpectedType = fmt.Errorf("Unexpected Type") +var ErrUnexpectedType = fmt.Errorf("Unexpected Type") // VariableValues coerces and validates variable values func VariableValues(schema *ast.Schema, op *ast.OperationDefinition, variables map[string]interface{}) (map[string]interface{}, error) { @@ -53,8 +53,8 @@ func VariableValues(schema *ast.Schema, op *ast.OperationDefinition, variables m } else { rv := reflect.ValueOf(val) - jsonNumber, isJsonNumber := val.(json.Number) - if isJsonNumber { + jsonNumber, isJSONNumber := val.(json.Number) + if isJSONNumber { if v.Type.NamedType == "Int" { n, err := jsonNumber.Int64() if err != nil { diff --git a/vendor/golang.org/x/net/http2/h2c/h2c.go b/vendor/golang.org/x/net/http2/h2c/h2c.go index a72bbed1..2d6bf861 100644 --- a/vendor/golang.org/x/net/http2/h2c/h2c.go +++ b/vendor/golang.org/x/net/http2/h2c/h2c.go @@ -44,7 +44,7 @@ func init() { // HTTP/1, but unlikely to occur in practice and (2) Upgrading from HTTP/1 to // h2c - this works by using the HTTP/1 Upgrade header to request an upgrade to // h2c. When either of those situations occur we hijack the HTTP/1 connection, -// convert it to a HTTP/2 connection and pass the net.Conn to http2.ServeConn. +// convert it to an HTTP/2 connection and pass the net.Conn to http2.ServeConn. type h2cHandler struct { Handler http.Handler s *http2.Server diff --git a/vendor/golang.org/x/net/http2/server.go b/vendor/golang.org/x/net/http2/server.go index cd057f39..033b6e6d 100644 --- a/vendor/golang.org/x/net/http2/server.go +++ b/vendor/golang.org/x/net/http2/server.go @@ -441,7 +441,7 @@ func (s *Server) ServeConn(c net.Conn, opts *ServeConnOpts) { if s.NewWriteScheduler != nil { sc.writeSched = s.NewWriteScheduler() } else { - sc.writeSched = NewPriorityWriteScheduler(nil) + sc.writeSched = newRoundRobinWriteScheduler() } // These start at the RFC-specified defaults. If there is a higher @@ -2429,7 +2429,7 @@ type requestBody struct { conn *serverConn closeOnce sync.Once // for use by Close only sawEOF bool // for use by Read only - pipe *pipe // non-nil if we have a HTTP entity message body + pipe *pipe // non-nil if we have an HTTP entity message body needsContinue bool // need to send a 100-continue } @@ -2569,7 +2569,8 @@ func (rws *responseWriterState) writeChunk(p []byte) (n int, err error) { clen = "" } } - if clen == "" && rws.handlerDone && bodyAllowedForStatus(rws.status) && (len(p) > 0 || !isHeadResp) { + _, hasContentLength := rws.snapHeader["Content-Length"] + if !hasContentLength && clen == "" && rws.handlerDone && bodyAllowedForStatus(rws.status) && (len(p) > 0 || !isHeadResp) { clen = strconv.Itoa(len(p)) } _, hasContentType := rws.snapHeader["Content-Type"] @@ -2774,7 +2775,7 @@ func (w *responseWriter) FlushError() error { err = rws.bw.Flush() } else { // The bufio.Writer won't call chunkWriter.Write - // (writeChunk with zero bytes, so we have to do it + // (writeChunk with zero bytes), so we have to do it // ourselves to force the HTTP response header and/or // final DATA frame (with END_STREAM) to be sent. _, err = chunkWriter{rws}.Write(nil) diff --git a/vendor/golang.org/x/net/http2/transport.go b/vendor/golang.org/x/net/http2/transport.go index ac90a263..4f08ccba 100644 --- a/vendor/golang.org/x/net/http2/transport.go +++ b/vendor/golang.org/x/net/http2/transport.go @@ -1268,8 +1268,8 @@ func (cc *ClientConn) RoundTrip(req *http.Request) (*http.Response, error) { cancelRequest := func(cs *clientStream, err error) error { cs.cc.mu.Lock() - defer cs.cc.mu.Unlock() cs.abortStreamLocked(err) + bodyClosed := cs.reqBodyClosed if cs.ID != 0 { // This request may have failed because of a problem with the connection, // or for some unrelated reason. (For example, the user might have canceled @@ -1284,6 +1284,23 @@ func (cc *ClientConn) RoundTrip(req *http.Request) (*http.Response, error) { // will not help. cs.cc.doNotReuse = true } + cs.cc.mu.Unlock() + // Wait for the request body to be closed. + // + // If nothing closed the body before now, abortStreamLocked + // will have started a goroutine to close it. + // + // Closing the body before returning avoids a race condition + // with net/http checking its readTrackingBody to see if the + // body was read from or closed. See golang/go#60041. + // + // The body is closed in a separate goroutine without the + // connection mutex held, but dropping the mutex before waiting + // will keep us from holding it indefinitely if the body + // close is slow for some reason. + if bodyClosed != nil { + <-bodyClosed + } return err } @@ -1899,7 +1916,7 @@ func (cc *ClientConn) encodeHeaders(req *http.Request, addGzipHeader bool, trail // 8.1.2.3 Request Pseudo-Header Fields // The :path pseudo-header field includes the path and query parts of the // target URI (the path-absolute production and optionally a '?' character - // followed by the query production (see Sections 3.3 and 3.4 of + // followed by the query production, see Sections 3.3 and 3.4 of // [RFC3986]). f(":authority", host) m := req.Method diff --git a/vendor/golang.org/x/net/http2/writesched.go b/vendor/golang.org/x/net/http2/writesched.go index c7cd0017..cc893adc 100644 --- a/vendor/golang.org/x/net/http2/writesched.go +++ b/vendor/golang.org/x/net/http2/writesched.go @@ -184,7 +184,8 @@ func (wr *FrameWriteRequest) replyToWriter(err error) { // writeQueue is used by implementations of WriteScheduler. type writeQueue struct { - s []FrameWriteRequest + s []FrameWriteRequest + prev, next *writeQueue } func (q *writeQueue) empty() bool { return len(q.s) == 0 } diff --git a/vendor/golang.org/x/net/http2/writesched_roundrobin.go b/vendor/golang.org/x/net/http2/writesched_roundrobin.go new file mode 100644 index 00000000..54fe8632 --- /dev/null +++ b/vendor/golang.org/x/net/http2/writesched_roundrobin.go @@ -0,0 +1,119 @@ +// Copyright 2023 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package http2 + +import ( + "fmt" + "math" +) + +type roundRobinWriteScheduler struct { + // control contains control frames (SETTINGS, PING, etc.). + control writeQueue + + // streams maps stream ID to a queue. + streams map[uint32]*writeQueue + + // stream queues are stored in a circular linked list. + // head is the next stream to write, or nil if there are no streams open. + head *writeQueue + + // pool of empty queues for reuse. + queuePool writeQueuePool +} + +// newRoundRobinWriteScheduler constructs a new write scheduler. +// The round robin scheduler priorizes control frames +// like SETTINGS and PING over DATA frames. +// When there are no control frames to send, it performs a round-robin +// selection from the ready streams. +func newRoundRobinWriteScheduler() WriteScheduler { + ws := &roundRobinWriteScheduler{ + streams: make(map[uint32]*writeQueue), + } + return ws +} + +func (ws *roundRobinWriteScheduler) OpenStream(streamID uint32, options OpenStreamOptions) { + if ws.streams[streamID] != nil { + panic(fmt.Errorf("stream %d already opened", streamID)) + } + q := ws.queuePool.get() + ws.streams[streamID] = q + if ws.head == nil { + ws.head = q + q.next = q + q.prev = q + } else { + // Queues are stored in a ring. + // Insert the new stream before ws.head, putting it at the end of the list. + q.prev = ws.head.prev + q.next = ws.head + q.prev.next = q + q.next.prev = q + } +} + +func (ws *roundRobinWriteScheduler) CloseStream(streamID uint32) { + q := ws.streams[streamID] + if q == nil { + return + } + if q.next == q { + // This was the only open stream. + ws.head = nil + } else { + q.prev.next = q.next + q.next.prev = q.prev + if ws.head == q { + ws.head = q.next + } + } + delete(ws.streams, streamID) + ws.queuePool.put(q) +} + +func (ws *roundRobinWriteScheduler) AdjustStream(streamID uint32, priority PriorityParam) {} + +func (ws *roundRobinWriteScheduler) Push(wr FrameWriteRequest) { + if wr.isControl() { + ws.control.push(wr) + return + } + q := ws.streams[wr.StreamID()] + if q == nil { + // This is a closed stream. + // wr should not be a HEADERS or DATA frame. + // We push the request onto the control queue. + if wr.DataSize() > 0 { + panic("add DATA on non-open stream") + } + ws.control.push(wr) + return + } + q.push(wr) +} + +func (ws *roundRobinWriteScheduler) Pop() (FrameWriteRequest, bool) { + // Control and RST_STREAM frames first. + if !ws.control.empty() { + return ws.control.shift(), true + } + if ws.head == nil { + return FrameWriteRequest{}, false + } + q := ws.head + for { + if wr, ok := q.consume(math.MaxInt32); ok { + ws.head = q.next + return wr, true + } + q = q.next + if q == ws.head { + break + } + } + return FrameWriteRequest{}, false +} diff --git a/vendor/golang.org/x/sys/cpu/endian_little.go b/vendor/golang.org/x/sys/cpu/endian_little.go index fe545966..55db853e 100644 --- a/vendor/golang.org/x/sys/cpu/endian_little.go +++ b/vendor/golang.org/x/sys/cpu/endian_little.go @@ -2,8 +2,8 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. -//go:build 386 || amd64 || amd64p32 || alpha || arm || arm64 || loong64 || mipsle || mips64le || mips64p32le || nios2 || ppc64le || riscv || riscv64 || sh -// +build 386 amd64 amd64p32 alpha arm arm64 loong64 mipsle mips64le mips64p32le nios2 ppc64le riscv riscv64 sh +//go:build 386 || amd64 || amd64p32 || alpha || arm || arm64 || loong64 || mipsle || mips64le || mips64p32le || nios2 || ppc64le || riscv || riscv64 || sh || wasm +// +build 386 amd64 amd64p32 alpha arm arm64 loong64 mipsle mips64le mips64p32le nios2 ppc64le riscv riscv64 sh wasm package cpu diff --git a/vendor/golang.org/x/sys/unix/mkall.sh b/vendor/golang.org/x/sys/unix/mkall.sh index 8e3947c3..e6f31d37 100644 --- a/vendor/golang.org/x/sys/unix/mkall.sh +++ b/vendor/golang.org/x/sys/unix/mkall.sh @@ -50,7 +50,7 @@ if [[ "$GOOS" = "linux" ]]; then # Use the Docker-based build system # Files generated through docker (use $cmd so you can Ctl-C the build or run) $cmd docker build --tag generate:$GOOS $GOOS - $cmd docker run --interactive --tty --volume $(cd -- "$(dirname -- "$0")/.." && /bin/pwd):/build generate:$GOOS + $cmd docker run --interactive --tty --volume $(cd -- "$(dirname -- "$0")/.." && pwd):/build generate:$GOOS exit fi diff --git a/vendor/golang.org/x/sys/unix/mkerrors.sh b/vendor/golang.org/x/sys/unix/mkerrors.sh index be0423e6..31564627 100644 --- a/vendor/golang.org/x/sys/unix/mkerrors.sh +++ b/vendor/golang.org/x/sys/unix/mkerrors.sh @@ -741,7 +741,8 @@ main(void) e = errors[i].num; if(i > 0 && errors[i-1].num == e) continue; - strcpy(buf, strerror(e)); + strncpy(buf, strerror(e), sizeof(buf) - 1); + buf[sizeof(buf) - 1] = '\0'; // lowercase first letter: Bad -> bad, but STREAM -> STREAM. if(A <= buf[0] && buf[0] <= Z && a <= buf[1] && buf[1] <= z) buf[0] += a - A; @@ -760,7 +761,8 @@ main(void) e = signals[i].num; if(i > 0 && signals[i-1].num == e) continue; - strcpy(buf, strsignal(e)); + strncpy(buf, strsignal(e), sizeof(buf) - 1); + buf[sizeof(buf) - 1] = '\0'; // lowercase first letter: Bad -> bad, but STREAM -> STREAM. if(A <= buf[0] && buf[0] <= Z && a <= buf[1] && buf[1] <= z) buf[0] += a - A; diff --git a/vendor/golang.org/x/sys/unix/syscall_linux.go b/vendor/golang.org/x/sys/unix/syscall_linux.go index fbaeb5ff..6de486be 100644 --- a/vendor/golang.org/x/sys/unix/syscall_linux.go +++ b/vendor/golang.org/x/sys/unix/syscall_linux.go @@ -1699,12 +1699,23 @@ func PtracePokeUser(pid int, addr uintptr, data []byte) (count int, err error) { return ptracePoke(PTRACE_POKEUSR, PTRACE_PEEKUSR, pid, addr, data) } +// elfNT_PRSTATUS is a copy of the debug/elf.NT_PRSTATUS constant so +// x/sys/unix doesn't need to depend on debug/elf and thus +// compress/zlib, debug/dwarf, and other packages. +const elfNT_PRSTATUS = 1 + func PtraceGetRegs(pid int, regsout *PtraceRegs) (err error) { - return ptracePtr(PTRACE_GETREGS, pid, 0, unsafe.Pointer(regsout)) + var iov Iovec + iov.Base = (*byte)(unsafe.Pointer(regsout)) + iov.SetLen(int(unsafe.Sizeof(*regsout))) + return ptracePtr(PTRACE_GETREGSET, pid, uintptr(elfNT_PRSTATUS), unsafe.Pointer(&iov)) } func PtraceSetRegs(pid int, regs *PtraceRegs) (err error) { - return ptracePtr(PTRACE_SETREGS, pid, 0, unsafe.Pointer(regs)) + var iov Iovec + iov.Base = (*byte)(unsafe.Pointer(regs)) + iov.SetLen(int(unsafe.Sizeof(*regs))) + return ptracePtr(PTRACE_SETREGSET, pid, uintptr(elfNT_PRSTATUS), unsafe.Pointer(&iov)) } func PtraceSetOptions(pid int, options int) (err error) { @@ -2420,6 +2431,21 @@ func PthreadSigmask(how int, set, oldset *Sigset_t) error { return rtSigprocmask(how, set, oldset, _C__NSIG/8) } +//sysnb getresuid(ruid *_C_int, euid *_C_int, suid *_C_int) +//sysnb getresgid(rgid *_C_int, egid *_C_int, sgid *_C_int) + +func Getresuid() (ruid, euid, suid int) { + var r, e, s _C_int + getresuid(&r, &e, &s) + return int(r), int(e), int(s) +} + +func Getresgid() (rgid, egid, sgid int) { + var r, e, s _C_int + getresgid(&r, &e, &s) + return int(r), int(e), int(s) +} + /* * Unimplemented */ diff --git a/vendor/golang.org/x/sys/unix/syscall_openbsd.go b/vendor/golang.org/x/sys/unix/syscall_openbsd.go index f9c7a966..c5f166a1 100644 --- a/vendor/golang.org/x/sys/unix/syscall_openbsd.go +++ b/vendor/golang.org/x/sys/unix/syscall_openbsd.go @@ -151,6 +151,21 @@ func Getfsstat(buf []Statfs_t, flags int) (n int, err error) { return } +//sysnb getresuid(ruid *_C_int, euid *_C_int, suid *_C_int) +//sysnb getresgid(rgid *_C_int, egid *_C_int, sgid *_C_int) + +func Getresuid() (ruid, euid, suid int) { + var r, e, s _C_int + getresuid(&r, &e, &s) + return int(r), int(e), int(s) +} + +func Getresgid() (rgid, egid, sgid int) { + var r, e, s _C_int + getresgid(&r, &e, &s) + return int(r), int(e), int(s) +} + //sys ioctl(fd int, req uint, arg uintptr) (err error) //sys ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) = SYS_IOCTL @@ -338,8 +353,6 @@ func Uname(uname *Utsname) error { // getgid // getitimer // getlogin -// getresgid -// getresuid // getthrid // ktrace // lfs_bmapv diff --git a/vendor/golang.org/x/sys/unix/zerrors_linux_sparc64.go b/vendor/golang.org/x/sys/unix/zerrors_linux_sparc64.go index f6192526..48984202 100644 --- a/vendor/golang.org/x/sys/unix/zerrors_linux_sparc64.go +++ b/vendor/golang.org/x/sys/unix/zerrors_linux_sparc64.go @@ -329,6 +329,54 @@ const ( SCM_WIFI_STATUS = 0x25 SFD_CLOEXEC = 0x400000 SFD_NONBLOCK = 0x4000 + SF_FP = 0x38 + SF_I0 = 0x20 + SF_I1 = 0x24 + SF_I2 = 0x28 + SF_I3 = 0x2c + SF_I4 = 0x30 + SF_I5 = 0x34 + SF_L0 = 0x0 + SF_L1 = 0x4 + SF_L2 = 0x8 + SF_L3 = 0xc + SF_L4 = 0x10 + SF_L5 = 0x14 + SF_L6 = 0x18 + SF_L7 = 0x1c + SF_PC = 0x3c + SF_RETP = 0x40 + SF_V9_FP = 0x70 + SF_V9_I0 = 0x40 + SF_V9_I1 = 0x48 + SF_V9_I2 = 0x50 + SF_V9_I3 = 0x58 + SF_V9_I4 = 0x60 + SF_V9_I5 = 0x68 + SF_V9_L0 = 0x0 + SF_V9_L1 = 0x8 + SF_V9_L2 = 0x10 + SF_V9_L3 = 0x18 + SF_V9_L4 = 0x20 + SF_V9_L5 = 0x28 + SF_V9_L6 = 0x30 + SF_V9_L7 = 0x38 + SF_V9_PC = 0x78 + SF_V9_RETP = 0x80 + SF_V9_XARG0 = 0x88 + SF_V9_XARG1 = 0x90 + SF_V9_XARG2 = 0x98 + SF_V9_XARG3 = 0xa0 + SF_V9_XARG4 = 0xa8 + SF_V9_XARG5 = 0xb0 + SF_V9_XXARG = 0xb8 + SF_XARG0 = 0x44 + SF_XARG1 = 0x48 + SF_XARG2 = 0x4c + SF_XARG3 = 0x50 + SF_XARG4 = 0x54 + SF_XARG5 = 0x58 + SF_XXARG = 0x5c SIOCATMARK = 0x8905 SIOCGPGRP = 0x8904 SIOCGSTAMPNS_NEW = 0x40108907 diff --git a/vendor/golang.org/x/sys/unix/zsyscall_linux.go b/vendor/golang.org/x/sys/unix/zsyscall_linux.go index da63d9d7..722c29a0 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_linux.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_linux.go @@ -2172,3 +2172,17 @@ func rtSigprocmask(how int, set *Sigset_t, oldset *Sigset_t, sigsetsize uintptr) } return } + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getresuid(ruid *_C_int, euid *_C_int, suid *_C_int) { + RawSyscallNoError(SYS_GETRESUID, uintptr(unsafe.Pointer(ruid)), uintptr(unsafe.Pointer(euid)), uintptr(unsafe.Pointer(suid))) + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getresgid(rgid *_C_int, egid *_C_int, sgid *_C_int) { + RawSyscallNoError(SYS_GETRESGID, uintptr(unsafe.Pointer(rgid)), uintptr(unsafe.Pointer(egid)), uintptr(unsafe.Pointer(sgid))) + return +} diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_386.go b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_386.go index 6699a783..9ab9abf7 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_386.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_386.go @@ -519,6 +519,28 @@ var libc_getcwd_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func getresuid(ruid *_C_int, euid *_C_int, suid *_C_int) { + syscall_rawSyscall(libc_getresuid_trampoline_addr, uintptr(unsafe.Pointer(ruid)), uintptr(unsafe.Pointer(euid)), uintptr(unsafe.Pointer(suid))) + return +} + +var libc_getresuid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresuid getresuid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getresgid(rgid *_C_int, egid *_C_int, sgid *_C_int) { + syscall_rawSyscall(libc_getresgid_trampoline_addr, uintptr(unsafe.Pointer(rgid)), uintptr(unsafe.Pointer(egid)), uintptr(unsafe.Pointer(sgid))) + return +} + +var libc_getresgid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresgid getresgid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ioctl(fd int, req uint, arg uintptr) (err error) { _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) if e1 != 0 { diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_386.s b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_386.s index 04f0de34..3dcacd30 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_386.s +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_386.s @@ -158,6 +158,16 @@ TEXT libc_getcwd_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_getcwd_trampoline_addr(SB), RODATA, $4 DATA ·libc_getcwd_trampoline_addr(SB)/4, $libc_getcwd_trampoline<>(SB) +TEXT libc_getresuid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getresuid(SB) +GLOBL ·libc_getresuid_trampoline_addr(SB), RODATA, $4 +DATA ·libc_getresuid_trampoline_addr(SB)/4, $libc_getresuid_trampoline<>(SB) + +TEXT libc_getresgid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getresgid(SB) +GLOBL ·libc_getresgid_trampoline_addr(SB), RODATA, $4 +DATA ·libc_getresgid_trampoline_addr(SB)/4, $libc_getresgid_trampoline<>(SB) + TEXT libc_ioctl_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_ioctl(SB) GLOBL ·libc_ioctl_trampoline_addr(SB), RODATA, $4 diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_amd64.go b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_amd64.go index 1e775fe0..915761ea 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_amd64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_amd64.go @@ -519,15 +519,29 @@ var libc_getcwd_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT -func ioctl(fd int, req uint, arg uintptr) (err error) { - _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) - if e1 != 0 { - err = errnoErr(e1) - } +func getresuid(ruid *_C_int, euid *_C_int, suid *_C_int) { + syscall_rawSyscall(libc_getresuid_trampoline_addr, uintptr(unsafe.Pointer(ruid)), uintptr(unsafe.Pointer(euid)), uintptr(unsafe.Pointer(suid))) return } -func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) { +var libc_getresuid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresuid getresuid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getresgid(rgid *_C_int, egid *_C_int, sgid *_C_int) { + syscall_rawSyscall(libc_getresgid_trampoline_addr, uintptr(unsafe.Pointer(rgid)), uintptr(unsafe.Pointer(egid)), uintptr(unsafe.Pointer(sgid))) + return +} + +var libc_getresgid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresgid getresgid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func ioctl(fd int, req uint, arg uintptr) (err error) { _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) if e1 != 0 { err = errnoErr(e1) @@ -541,6 +555,16 @@ var libc_ioctl_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func ioctlPtr(fd int, req uint, arg unsafe.Pointer) (err error) { + _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) + if e1 != 0 { + err = errnoErr(e1) + } + return +} + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func sysctl(mib []_C_int, old *byte, oldlen *uintptr, new *byte, newlen uintptr) (err error) { var _p0 unsafe.Pointer if len(mib) > 0 { diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_amd64.s b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_amd64.s index 27b6f4df..2763620b 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_amd64.s +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_amd64.s @@ -158,6 +158,16 @@ TEXT libc_getcwd_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_getcwd_trampoline_addr(SB), RODATA, $8 DATA ·libc_getcwd_trampoline_addr(SB)/8, $libc_getcwd_trampoline<>(SB) +TEXT libc_getresuid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getresuid(SB) +GLOBL ·libc_getresuid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getresuid_trampoline_addr(SB)/8, $libc_getresuid_trampoline<>(SB) + +TEXT libc_getresgid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getresgid(SB) +GLOBL ·libc_getresgid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getresgid_trampoline_addr(SB)/8, $libc_getresgid_trampoline<>(SB) + TEXT libc_ioctl_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_ioctl(SB) GLOBL ·libc_ioctl_trampoline_addr(SB), RODATA, $8 diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm.go b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm.go index 7f642789..8e87fdf1 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm.go @@ -519,6 +519,28 @@ var libc_getcwd_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func getresuid(ruid *_C_int, euid *_C_int, suid *_C_int) { + syscall_rawSyscall(libc_getresuid_trampoline_addr, uintptr(unsafe.Pointer(ruid)), uintptr(unsafe.Pointer(euid)), uintptr(unsafe.Pointer(suid))) + return +} + +var libc_getresuid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresuid getresuid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getresgid(rgid *_C_int, egid *_C_int, sgid *_C_int) { + syscall_rawSyscall(libc_getresgid_trampoline_addr, uintptr(unsafe.Pointer(rgid)), uintptr(unsafe.Pointer(egid)), uintptr(unsafe.Pointer(sgid))) + return +} + +var libc_getresgid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresgid getresgid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ioctl(fd int, req uint, arg uintptr) (err error) { _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) if e1 != 0 { diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm.s b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm.s index b797045f..c9223140 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm.s +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm.s @@ -158,6 +158,16 @@ TEXT libc_getcwd_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_getcwd_trampoline_addr(SB), RODATA, $4 DATA ·libc_getcwd_trampoline_addr(SB)/4, $libc_getcwd_trampoline<>(SB) +TEXT libc_getresuid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getresuid(SB) +GLOBL ·libc_getresuid_trampoline_addr(SB), RODATA, $4 +DATA ·libc_getresuid_trampoline_addr(SB)/4, $libc_getresuid_trampoline<>(SB) + +TEXT libc_getresgid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getresgid(SB) +GLOBL ·libc_getresgid_trampoline_addr(SB), RODATA, $4 +DATA ·libc_getresgid_trampoline_addr(SB)/4, $libc_getresgid_trampoline<>(SB) + TEXT libc_ioctl_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_ioctl(SB) GLOBL ·libc_ioctl_trampoline_addr(SB), RODATA, $4 diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm64.go b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm64.go index 756ef7b1..12a7a216 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm64.go @@ -519,6 +519,28 @@ var libc_getcwd_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func getresuid(ruid *_C_int, euid *_C_int, suid *_C_int) { + syscall_rawSyscall(libc_getresuid_trampoline_addr, uintptr(unsafe.Pointer(ruid)), uintptr(unsafe.Pointer(euid)), uintptr(unsafe.Pointer(suid))) + return +} + +var libc_getresuid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresuid getresuid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getresgid(rgid *_C_int, egid *_C_int, sgid *_C_int) { + syscall_rawSyscall(libc_getresgid_trampoline_addr, uintptr(unsafe.Pointer(rgid)), uintptr(unsafe.Pointer(egid)), uintptr(unsafe.Pointer(sgid))) + return +} + +var libc_getresgid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresgid getresgid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ioctl(fd int, req uint, arg uintptr) (err error) { _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) if e1 != 0 { diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm64.s b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm64.s index a8712662..a6bc32c9 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm64.s +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_arm64.s @@ -158,6 +158,16 @@ TEXT libc_getcwd_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_getcwd_trampoline_addr(SB), RODATA, $8 DATA ·libc_getcwd_trampoline_addr(SB)/8, $libc_getcwd_trampoline<>(SB) +TEXT libc_getresuid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getresuid(SB) +GLOBL ·libc_getresuid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getresuid_trampoline_addr(SB)/8, $libc_getresuid_trampoline<>(SB) + +TEXT libc_getresgid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getresgid(SB) +GLOBL ·libc_getresgid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getresgid_trampoline_addr(SB)/8, $libc_getresgid_trampoline<>(SB) + TEXT libc_ioctl_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_ioctl(SB) GLOBL ·libc_ioctl_trampoline_addr(SB), RODATA, $8 diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_mips64.go b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_mips64.go index 7bc2e24e..b19e8aa0 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_mips64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_mips64.go @@ -519,6 +519,28 @@ var libc_getcwd_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func getresuid(ruid *_C_int, euid *_C_int, suid *_C_int) { + syscall_rawSyscall(libc_getresuid_trampoline_addr, uintptr(unsafe.Pointer(ruid)), uintptr(unsafe.Pointer(euid)), uintptr(unsafe.Pointer(suid))) + return +} + +var libc_getresuid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresuid getresuid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getresgid(rgid *_C_int, egid *_C_int, sgid *_C_int) { + syscall_rawSyscall(libc_getresgid_trampoline_addr, uintptr(unsafe.Pointer(rgid)), uintptr(unsafe.Pointer(egid)), uintptr(unsafe.Pointer(sgid))) + return +} + +var libc_getresgid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresgid getresgid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ioctl(fd int, req uint, arg uintptr) (err error) { _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) if e1 != 0 { diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_mips64.s b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_mips64.s index 05d4bffd..b4e7bcea 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_mips64.s +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_mips64.s @@ -158,6 +158,16 @@ TEXT libc_getcwd_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_getcwd_trampoline_addr(SB), RODATA, $8 DATA ·libc_getcwd_trampoline_addr(SB)/8, $libc_getcwd_trampoline<>(SB) +TEXT libc_getresuid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getresuid(SB) +GLOBL ·libc_getresuid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getresuid_trampoline_addr(SB)/8, $libc_getresuid_trampoline<>(SB) + +TEXT libc_getresgid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getresgid(SB) +GLOBL ·libc_getresgid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getresgid_trampoline_addr(SB)/8, $libc_getresgid_trampoline<>(SB) + TEXT libc_ioctl_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_ioctl(SB) GLOBL ·libc_ioctl_trampoline_addr(SB), RODATA, $8 diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_ppc64.go b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_ppc64.go index 739be621..fb99594c 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_ppc64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_ppc64.go @@ -519,6 +519,28 @@ var libc_getcwd_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func getresuid(ruid *_C_int, euid *_C_int, suid *_C_int) { + syscall_rawSyscall(libc_getresuid_trampoline_addr, uintptr(unsafe.Pointer(ruid)), uintptr(unsafe.Pointer(euid)), uintptr(unsafe.Pointer(suid))) + return +} + +var libc_getresuid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresuid getresuid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getresgid(rgid *_C_int, egid *_C_int, sgid *_C_int) { + syscall_rawSyscall(libc_getresgid_trampoline_addr, uintptr(unsafe.Pointer(rgid)), uintptr(unsafe.Pointer(egid)), uintptr(unsafe.Pointer(sgid))) + return +} + +var libc_getresgid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresgid getresgid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ioctl(fd int, req uint, arg uintptr) (err error) { _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) if e1 != 0 { diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_ppc64.s b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_ppc64.s index 74a25f8d..ca3f7660 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_ppc64.s +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_ppc64.s @@ -189,6 +189,18 @@ TEXT libc_getcwd_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_getcwd_trampoline_addr(SB), RODATA, $8 DATA ·libc_getcwd_trampoline_addr(SB)/8, $libc_getcwd_trampoline<>(SB) +TEXT libc_getresuid_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_getresuid(SB) + RET +GLOBL ·libc_getresuid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getresuid_trampoline_addr(SB)/8, $libc_getresuid_trampoline<>(SB) + +TEXT libc_getresgid_trampoline<>(SB),NOSPLIT,$0-0 + CALL libc_getresgid(SB) + RET +GLOBL ·libc_getresgid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getresgid_trampoline_addr(SB)/8, $libc_getresgid_trampoline<>(SB) + TEXT libc_ioctl_trampoline<>(SB),NOSPLIT,$0-0 CALL libc_ioctl(SB) RET diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_riscv64.go b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_riscv64.go index 7d95a197..32cbbbc5 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_riscv64.go +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_riscv64.go @@ -519,6 +519,28 @@ var libc_getcwd_trampoline_addr uintptr // THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT +func getresuid(ruid *_C_int, euid *_C_int, suid *_C_int) { + syscall_rawSyscall(libc_getresuid_trampoline_addr, uintptr(unsafe.Pointer(ruid)), uintptr(unsafe.Pointer(euid)), uintptr(unsafe.Pointer(suid))) + return +} + +var libc_getresuid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresuid getresuid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + +func getresgid(rgid *_C_int, egid *_C_int, sgid *_C_int) { + syscall_rawSyscall(libc_getresgid_trampoline_addr, uintptr(unsafe.Pointer(rgid)), uintptr(unsafe.Pointer(egid)), uintptr(unsafe.Pointer(sgid))) + return +} + +var libc_getresgid_trampoline_addr uintptr + +//go:cgo_import_dynamic libc_getresgid getresgid "libc.so" + +// THIS FILE IS GENERATED BY THE COMMAND AT THE TOP; DO NOT EDIT + func ioctl(fd int, req uint, arg uintptr) (err error) { _, _, e1 := syscall_syscall(libc_ioctl_trampoline_addr, uintptr(fd), uintptr(req), uintptr(arg)) if e1 != 0 { diff --git a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_riscv64.s b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_riscv64.s index 990be245..477a7d5b 100644 --- a/vendor/golang.org/x/sys/unix/zsyscall_openbsd_riscv64.s +++ b/vendor/golang.org/x/sys/unix/zsyscall_openbsd_riscv64.s @@ -158,6 +158,16 @@ TEXT libc_getcwd_trampoline<>(SB),NOSPLIT,$0-0 GLOBL ·libc_getcwd_trampoline_addr(SB), RODATA, $8 DATA ·libc_getcwd_trampoline_addr(SB)/8, $libc_getcwd_trampoline<>(SB) +TEXT libc_getresuid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getresuid(SB) +GLOBL ·libc_getresuid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getresuid_trampoline_addr(SB)/8, $libc_getresuid_trampoline<>(SB) + +TEXT libc_getresgid_trampoline<>(SB),NOSPLIT,$0-0 + JMP libc_getresgid(SB) +GLOBL ·libc_getresgid_trampoline_addr(SB), RODATA, $8 +DATA ·libc_getresgid_trampoline_addr(SB)/8, $libc_getresgid_trampoline<>(SB) + TEXT libc_ioctl_trampoline<>(SB),NOSPLIT,$0-0 JMP libc_ioctl(SB) GLOBL ·libc_ioctl_trampoline_addr(SB), RODATA, $8 diff --git a/vendor/golang.org/x/sys/unix/ztypes_linux.go b/vendor/golang.org/x/sys/unix/ztypes_linux.go index ca84727c..00c3b8c2 100644 --- a/vendor/golang.org/x/sys/unix/ztypes_linux.go +++ b/vendor/golang.org/x/sys/unix/ztypes_linux.go @@ -2555,6 +2555,11 @@ const ( BPF_REG_8 = 0x8 BPF_REG_9 = 0x9 BPF_REG_10 = 0xa + BPF_CGROUP_ITER_ORDER_UNSPEC = 0x0 + BPF_CGROUP_ITER_SELF_ONLY = 0x1 + BPF_CGROUP_ITER_DESCENDANTS_PRE = 0x2 + BPF_CGROUP_ITER_DESCENDANTS_POST = 0x3 + BPF_CGROUP_ITER_ANCESTORS_UP = 0x4 BPF_MAP_CREATE = 0x0 BPF_MAP_LOOKUP_ELEM = 0x1 BPF_MAP_UPDATE_ELEM = 0x2 @@ -2566,6 +2571,7 @@ const ( BPF_PROG_ATTACH = 0x8 BPF_PROG_DETACH = 0x9 BPF_PROG_TEST_RUN = 0xa + BPF_PROG_RUN = 0xa BPF_PROG_GET_NEXT_ID = 0xb BPF_MAP_GET_NEXT_ID = 0xc BPF_PROG_GET_FD_BY_ID = 0xd @@ -2610,6 +2616,7 @@ const ( BPF_MAP_TYPE_CPUMAP = 0x10 BPF_MAP_TYPE_XSKMAP = 0x11 BPF_MAP_TYPE_SOCKHASH = 0x12 + BPF_MAP_TYPE_CGROUP_STORAGE_DEPRECATED = 0x13 BPF_MAP_TYPE_CGROUP_STORAGE = 0x13 BPF_MAP_TYPE_REUSEPORT_SOCKARRAY = 0x14 BPF_MAP_TYPE_PERCPU_CGROUP_STORAGE = 0x15 @@ -2620,6 +2627,10 @@ const ( BPF_MAP_TYPE_STRUCT_OPS = 0x1a BPF_MAP_TYPE_RINGBUF = 0x1b BPF_MAP_TYPE_INODE_STORAGE = 0x1c + BPF_MAP_TYPE_TASK_STORAGE = 0x1d + BPF_MAP_TYPE_BLOOM_FILTER = 0x1e + BPF_MAP_TYPE_USER_RINGBUF = 0x1f + BPF_MAP_TYPE_CGRP_STORAGE = 0x20 BPF_PROG_TYPE_UNSPEC = 0x0 BPF_PROG_TYPE_SOCKET_FILTER = 0x1 BPF_PROG_TYPE_KPROBE = 0x2 @@ -2651,6 +2662,7 @@ const ( BPF_PROG_TYPE_EXT = 0x1c BPF_PROG_TYPE_LSM = 0x1d BPF_PROG_TYPE_SK_LOOKUP = 0x1e + BPF_PROG_TYPE_SYSCALL = 0x1f BPF_CGROUP_INET_INGRESS = 0x0 BPF_CGROUP_INET_EGRESS = 0x1 BPF_CGROUP_INET_SOCK_CREATE = 0x2 @@ -2689,6 +2701,12 @@ const ( BPF_XDP_CPUMAP = 0x23 BPF_SK_LOOKUP = 0x24 BPF_XDP = 0x25 + BPF_SK_SKB_VERDICT = 0x26 + BPF_SK_REUSEPORT_SELECT = 0x27 + BPF_SK_REUSEPORT_SELECT_OR_MIGRATE = 0x28 + BPF_PERF_EVENT = 0x29 + BPF_TRACE_KPROBE_MULTI = 0x2a + BPF_LSM_CGROUP = 0x2b BPF_LINK_TYPE_UNSPEC = 0x0 BPF_LINK_TYPE_RAW_TRACEPOINT = 0x1 BPF_LINK_TYPE_TRACING = 0x2 @@ -2696,6 +2714,9 @@ const ( BPF_LINK_TYPE_ITER = 0x4 BPF_LINK_TYPE_NETNS = 0x5 BPF_LINK_TYPE_XDP = 0x6 + BPF_LINK_TYPE_PERF_EVENT = 0x7 + BPF_LINK_TYPE_KPROBE_MULTI = 0x8 + BPF_LINK_TYPE_STRUCT_OPS = 0x9 BPF_ANY = 0x0 BPF_NOEXIST = 0x1 BPF_EXIST = 0x2 @@ -2733,6 +2754,7 @@ const ( BPF_F_ZERO_CSUM_TX = 0x2 BPF_F_DONT_FRAGMENT = 0x4 BPF_F_SEQ_NUMBER = 0x8 + BPF_F_TUNINFO_FLAGS = 0x10 BPF_F_INDEX_MASK = 0xffffffff BPF_F_CURRENT_CPU = 0xffffffff BPF_F_CTXLEN_MASK = 0xfffff00000000 @@ -2747,6 +2769,7 @@ const ( BPF_F_ADJ_ROOM_ENCAP_L4_GRE = 0x8 BPF_F_ADJ_ROOM_ENCAP_L4_UDP = 0x10 BPF_F_ADJ_ROOM_NO_CSUM_RESET = 0x20 + BPF_F_ADJ_ROOM_ENCAP_L2_ETH = 0x40 BPF_ADJ_ROOM_ENCAP_L2_MASK = 0xff BPF_ADJ_ROOM_ENCAP_L2_SHIFT = 0x38 BPF_F_SYSCTL_BASE_NAME = 0x1 @@ -2771,10 +2794,16 @@ const ( BPF_LWT_ENCAP_SEG6 = 0x0 BPF_LWT_ENCAP_SEG6_INLINE = 0x1 BPF_LWT_ENCAP_IP = 0x2 + BPF_F_BPRM_SECUREEXEC = 0x1 + BPF_F_BROADCAST = 0x8 + BPF_F_EXCLUDE_INGRESS = 0x10 + BPF_SKB_TSTAMP_UNSPEC = 0x0 + BPF_SKB_TSTAMP_DELIVERY_MONO = 0x1 BPF_OK = 0x0 BPF_DROP = 0x2 BPF_REDIRECT = 0x7 BPF_LWT_REROUTE = 0x80 + BPF_FLOW_DISSECTOR_CONTINUE = 0x81 BPF_SOCK_OPS_RTO_CB_FLAG = 0x1 BPF_SOCK_OPS_RETRANS_CB_FLAG = 0x2 BPF_SOCK_OPS_STATE_CB_FLAG = 0x4 @@ -2838,6 +2867,10 @@ const ( BPF_FIB_LKUP_RET_UNSUPP_LWT = 0x6 BPF_FIB_LKUP_RET_NO_NEIGH = 0x7 BPF_FIB_LKUP_RET_FRAG_NEEDED = 0x8 + BPF_MTU_CHK_SEGS = 0x1 + BPF_MTU_CHK_RET_SUCCESS = 0x0 + BPF_MTU_CHK_RET_FRAG_NEEDED = 0x1 + BPF_MTU_CHK_RET_SEGS_TOOBIG = 0x2 BPF_FD_TYPE_RAW_TRACEPOINT = 0x0 BPF_FD_TYPE_TRACEPOINT = 0x1 BPF_FD_TYPE_KPROBE = 0x2 @@ -2847,6 +2880,19 @@ const ( BPF_FLOW_DISSECTOR_F_PARSE_1ST_FRAG = 0x1 BPF_FLOW_DISSECTOR_F_STOP_AT_FLOW_LABEL = 0x2 BPF_FLOW_DISSECTOR_F_STOP_AT_ENCAP = 0x4 + BPF_CORE_FIELD_BYTE_OFFSET = 0x0 + BPF_CORE_FIELD_BYTE_SIZE = 0x1 + BPF_CORE_FIELD_EXISTS = 0x2 + BPF_CORE_FIELD_SIGNED = 0x3 + BPF_CORE_FIELD_LSHIFT_U64 = 0x4 + BPF_CORE_FIELD_RSHIFT_U64 = 0x5 + BPF_CORE_TYPE_ID_LOCAL = 0x6 + BPF_CORE_TYPE_ID_TARGET = 0x7 + BPF_CORE_TYPE_EXISTS = 0x8 + BPF_CORE_TYPE_SIZE = 0x9 + BPF_CORE_ENUMVAL_EXISTS = 0xa + BPF_CORE_ENUMVAL_VALUE = 0xb + BPF_CORE_TYPE_MATCHES = 0xc ) const ( diff --git a/vendor/golang.org/x/sys/windows/syscall_windows.go b/vendor/golang.org/x/sys/windows/syscall_windows.go index 3723b2c2..96459007 100644 --- a/vendor/golang.org/x/sys/windows/syscall_windows.go +++ b/vendor/golang.org/x/sys/windows/syscall_windows.go @@ -405,7 +405,7 @@ func NewCallbackCDecl(fn interface{}) uintptr { //sys VerQueryValue(block unsafe.Pointer, subBlock string, pointerToBufferPointer unsafe.Pointer, bufSize *uint32) (err error) = version.VerQueryValueW // Process Status API (PSAPI) -//sys EnumProcesses(processIds []uint32, bytesReturned *uint32) (err error) = psapi.EnumProcesses +//sys enumProcesses(processIds *uint32, nSize uint32, bytesReturned *uint32) (err error) = psapi.EnumProcesses //sys EnumProcessModules(process Handle, module *Handle, cb uint32, cbNeeded *uint32) (err error) = psapi.EnumProcessModules //sys EnumProcessModulesEx(process Handle, module *Handle, cb uint32, cbNeeded *uint32, filterFlag uint32) (err error) = psapi.EnumProcessModulesEx //sys GetModuleInformation(process Handle, module Handle, modinfo *ModuleInfo, cb uint32) (err error) = psapi.GetModuleInformation @@ -1354,6 +1354,17 @@ func SetsockoptIPv6Mreq(fd Handle, level, opt int, mreq *IPv6Mreq) (err error) { return syscall.EWINDOWS } +func EnumProcesses(processIds []uint32, bytesReturned *uint32) error { + // EnumProcesses syscall expects the size parameter to be in bytes, but the code generated with mksyscall uses + // the length of the processIds slice instead. Hence, this wrapper function is added to fix the discrepancy. + var p *uint32 + if len(processIds) > 0 { + p = &processIds[0] + } + size := uint32(len(processIds) * 4) + return enumProcesses(p, size, bytesReturned) +} + func Getpid() (pid int) { return int(GetCurrentProcessId()) } func FindFirstFile(name *uint16, data *Win32finddata) (handle Handle, err error) { diff --git a/vendor/golang.org/x/sys/windows/zsyscall_windows.go b/vendor/golang.org/x/sys/windows/zsyscall_windows.go index a81ea2c7..566dd3e3 100644 --- a/vendor/golang.org/x/sys/windows/zsyscall_windows.go +++ b/vendor/golang.org/x/sys/windows/zsyscall_windows.go @@ -3516,12 +3516,8 @@ func EnumProcessModulesEx(process Handle, module *Handle, cb uint32, cbNeeded *u return } -func EnumProcesses(processIds []uint32, bytesReturned *uint32) (err error) { - var _p0 *uint32 - if len(processIds) > 0 { - _p0 = &processIds[0] - } - r1, _, e1 := syscall.Syscall(procEnumProcesses.Addr(), 3, uintptr(unsafe.Pointer(_p0)), uintptr(len(processIds)), uintptr(unsafe.Pointer(bytesReturned))) +func enumProcesses(processIds *uint32, nSize uint32, bytesReturned *uint32) (err error) { + r1, _, e1 := syscall.Syscall(procEnumProcesses.Addr(), 3, uintptr(unsafe.Pointer(processIds)), uintptr(nSize), uintptr(unsafe.Pointer(bytesReturned))) if r1 == 0 { err = errnoErr(e1) } diff --git a/vendor/golang.org/x/tools/go/gcexportdata/gcexportdata.go b/vendor/golang.org/x/tools/go/gcexportdata/gcexportdata.go index 165ede0f..03543bd4 100644 --- a/vendor/golang.org/x/tools/go/gcexportdata/gcexportdata.go +++ b/vendor/golang.org/x/tools/go/gcexportdata/gcexportdata.go @@ -128,15 +128,14 @@ func Read(in io.Reader, fset *token.FileSet, imports map[string]*types.Package, // (from "version"). Select appropriate importer. if len(data) > 0 { switch data[0] { - case 'i': + case 'v', 'c', 'd': // binary, till go1.10 + return nil, fmt.Errorf("binary (%c) import format is no longer supported", data[0]) + + case 'i': // indexed, till go1.19 _, pkg, err := gcimporter.IImportData(fset, imports, data[1:], path) return pkg, err - case 'v', 'c', 'd': - _, pkg, err := gcimporter.BImportData(fset, imports, data, path) - return pkg, err - - case 'u': + case 'u': // unified, from go1.20 _, pkg, err := gcimporter.UImportData(fset, imports, data[1:], path) return pkg, err diff --git a/vendor/golang.org/x/tools/go/packages/golist.go b/vendor/golang.org/x/tools/go/packages/golist.go index 6bb7168d..e84f19df 100644 --- a/vendor/golang.org/x/tools/go/packages/golist.go +++ b/vendor/golang.org/x/tools/go/packages/golist.go @@ -625,7 +625,12 @@ func (state *golistState) createDriverResponse(words ...string) (*driverResponse } if pkg.PkgPath == "unsafe" { - pkg.GoFiles = nil // ignore fake unsafe.go file + pkg.CompiledGoFiles = nil // ignore fake unsafe.go file (#59929) + } else if len(pkg.CompiledGoFiles) == 0 { + // Work around for pre-go.1.11 versions of go list. + // TODO(matloob): they should be handled by the fallback. + // Can we delete this? + pkg.CompiledGoFiles = pkg.GoFiles } // Assume go list emits only absolute paths for Dir. @@ -663,13 +668,6 @@ func (state *golistState) createDriverResponse(words ...string) (*driverResponse response.Roots = append(response.Roots, pkg.ID) } - // Work around for pre-go.1.11 versions of go list. - // TODO(matloob): they should be handled by the fallback. - // Can we delete this? - if len(pkg.CompiledGoFiles) == 0 { - pkg.CompiledGoFiles = pkg.GoFiles - } - // Temporary work-around for golang/go#39986. Parse filenames out of // error messages. This happens if there are unrecoverable syntax // errors in the source, so we can't match on a specific error message. @@ -891,6 +889,15 @@ func golistargs(cfg *Config, words []string, goVersion int) []string { // probably because you'd just get the TestMain. fmt.Sprintf("-find=%t", !cfg.Tests && cfg.Mode&findFlags == 0 && !usesExportData(cfg)), } + + // golang/go#60456: with go1.21 and later, go list serves pgo variants, which + // can be costly to compute and may result in redundant processing for the + // caller. Disable these variants. If someone wants to add e.g. a NeedPGO + // mode flag, that should be a separate proposal. + if goVersion >= 21 { + fullargs = append(fullargs, "-pgo=off") + } + fullargs = append(fullargs, cfg.BuildFlags...) fullargs = append(fullargs, "--") fullargs = append(fullargs, words...) diff --git a/vendor/golang.org/x/tools/go/packages/packages.go b/vendor/golang.org/x/tools/go/packages/packages.go index 0f1505b8..632be722 100644 --- a/vendor/golang.org/x/tools/go/packages/packages.go +++ b/vendor/golang.org/x/tools/go/packages/packages.go @@ -308,6 +308,9 @@ type Package struct { TypeErrors []types.Error // GoFiles lists the absolute file paths of the package's Go source files. + // It may include files that should not be compiled, for example because + // they contain non-matching build tags, are documentary pseudo-files such as + // unsafe/unsafe.go or builtin/builtin.go, or are subject to cgo preprocessing. GoFiles []string // CompiledGoFiles lists the absolute file paths of the package's source diff --git a/vendor/golang.org/x/tools/go/types/objectpath/objectpath.go b/vendor/golang.org/x/tools/go/types/objectpath/objectpath.go deleted file mode 100644 index aa7dfacc..00000000 --- a/vendor/golang.org/x/tools/go/types/objectpath/objectpath.go +++ /dev/null @@ -1,764 +0,0 @@ -// Copyright 2018 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -// Package objectpath defines a naming scheme for types.Objects -// (that is, named entities in Go programs) relative to their enclosing -// package. -// -// Type-checker objects are canonical, so they are usually identified by -// their address in memory (a pointer), but a pointer has meaning only -// within one address space. By contrast, objectpath names allow the -// identity of an object to be sent from one program to another, -// establishing a correspondence between types.Object variables that are -// distinct but logically equivalent. -// -// A single object may have multiple paths. In this example, -// -// type A struct{ X int } -// type B A -// -// the field X has two paths due to its membership of both A and B. -// The For(obj) function always returns one of these paths, arbitrarily -// but consistently. -package objectpath - -import ( - "fmt" - "go/types" - "sort" - "strconv" - "strings" - - "golang.org/x/tools/internal/typeparams" - - _ "unsafe" // for go:linkname -) - -// A Path is an opaque name that identifies a types.Object -// relative to its package. Conceptually, the name consists of a -// sequence of destructuring operations applied to the package scope -// to obtain the original object. -// The name does not include the package itself. -type Path string - -// Encoding -// -// An object path is a textual and (with training) human-readable encoding -// of a sequence of destructuring operators, starting from a types.Package. -// The sequences represent a path through the package/object/type graph. -// We classify these operators by their type: -// -// PO package->object Package.Scope.Lookup -// OT object->type Object.Type -// TT type->type Type.{Elem,Key,Params,Results,Underlying} [EKPRU] -// TO type->object Type.{At,Field,Method,Obj} [AFMO] -// -// All valid paths start with a package and end at an object -// and thus may be defined by the regular language: -// -// objectpath = PO (OT TT* TO)* -// -// The concrete encoding follows directly: -// - The only PO operator is Package.Scope.Lookup, which requires an identifier. -// - The only OT operator is Object.Type, -// which we encode as '.' because dot cannot appear in an identifier. -// - The TT operators are encoded as [EKPRUTC]; -// one of these (TypeParam) requires an integer operand, -// which is encoded as a string of decimal digits. -// - The TO operators are encoded as [AFMO]; -// three of these (At,Field,Method) require an integer operand, -// which is encoded as a string of decimal digits. -// These indices are stable across different representations -// of the same package, even source and export data. -// The indices used are implementation specific and may not correspond to -// the argument to the go/types function. -// -// In the example below, -// -// package p -// -// type T interface { -// f() (a string, b struct{ X int }) -// } -// -// field X has the path "T.UM0.RA1.F0", -// representing the following sequence of operations: -// -// p.Lookup("T") T -// .Type().Underlying().Method(0). f -// .Type().Results().At(1) b -// .Type().Field(0) X -// -// The encoding is not maximally compact---every R or P is -// followed by an A, for example---but this simplifies the -// encoder and decoder. -const ( - // object->type operators - opType = '.' // .Type() (Object) - - // type->type operators - opElem = 'E' // .Elem() (Pointer, Slice, Array, Chan, Map) - opKey = 'K' // .Key() (Map) - opParams = 'P' // .Params() (Signature) - opResults = 'R' // .Results() (Signature) - opUnderlying = 'U' // .Underlying() (Named) - opTypeParam = 'T' // .TypeParams.At(i) (Named, Signature) - opConstraint = 'C' // .Constraint() (TypeParam) - - // type->object operators - opAt = 'A' // .At(i) (Tuple) - opField = 'F' // .Field(i) (Struct) - opMethod = 'M' // .Method(i) (Named or Interface; not Struct: "promoted" names are ignored) - opObj = 'O' // .Obj() (Named, TypeParam) -) - -// For is equivalent to new(Encoder).For(obj). -// -// It may be more efficient to reuse a single Encoder across several calls. -func For(obj types.Object) (Path, error) { - return new(Encoder).For(obj) -} - -// An Encoder amortizes the cost of encoding the paths of multiple objects. -// The zero value of an Encoder is ready to use. -type Encoder struct { - scopeNamesMemo map[*types.Scope][]string // memoization of Scope.Names() - namedMethodsMemo map[*types.Named][]*types.Func // memoization of namedMethods() -} - -// For returns the path to an object relative to its package, -// or an error if the object is not accessible from the package's Scope. -// -// The For function guarantees to return a path only for the following objects: -// - package-level types -// - exported package-level non-types -// - methods -// - parameter and result variables -// - struct fields -// These objects are sufficient to define the API of their package. -// The objects described by a package's export data are drawn from this set. -// -// For does not return a path for predeclared names, imported package -// names, local names, and unexported package-level names (except -// types). -// -// Example: given this definition, -// -// package p -// -// type T interface { -// f() (a string, b struct{ X int }) -// } -// -// For(X) would return a path that denotes the following sequence of operations: -// -// p.Scope().Lookup("T") (TypeName T) -// .Type().Underlying().Method(0). (method Func f) -// .Type().Results().At(1) (field Var b) -// .Type().Field(0) (field Var X) -// -// where p is the package (*types.Package) to which X belongs. -func (enc *Encoder) For(obj types.Object) (Path, error) { - pkg := obj.Pkg() - - // This table lists the cases of interest. - // - // Object Action - // ------ ------ - // nil reject - // builtin reject - // pkgname reject - // label reject - // var - // package-level accept - // func param/result accept - // local reject - // struct field accept - // const - // package-level accept - // local reject - // func - // package-level accept - // init functions reject - // concrete method accept - // interface method accept - // type - // package-level accept - // local reject - // - // The only accessible package-level objects are members of pkg itself. - // - // The cases are handled in four steps: - // - // 1. reject nil and builtin - // 2. accept package-level objects - // 3. reject obviously invalid objects - // 4. search the API for the path to the param/result/field/method. - - // 1. reference to nil or builtin? - if pkg == nil { - return "", fmt.Errorf("predeclared %s has no path", obj) - } - scope := pkg.Scope() - - // 2. package-level object? - if scope.Lookup(obj.Name()) == obj { - // Only exported objects (and non-exported types) have a path. - // Non-exported types may be referenced by other objects. - if _, ok := obj.(*types.TypeName); !ok && !obj.Exported() { - return "", fmt.Errorf("no path for non-exported %v", obj) - } - return Path(obj.Name()), nil - } - - // 3. Not a package-level object. - // Reject obviously non-viable cases. - switch obj := obj.(type) { - case *types.TypeName: - if _, ok := obj.Type().(*typeparams.TypeParam); !ok { - // With the exception of type parameters, only package-level type names - // have a path. - return "", fmt.Errorf("no path for %v", obj) - } - case *types.Const, // Only package-level constants have a path. - *types.Label, // Labels are function-local. - *types.PkgName: // PkgNames are file-local. - return "", fmt.Errorf("no path for %v", obj) - - case *types.Var: - // Could be: - // - a field (obj.IsField()) - // - a func parameter or result - // - a local var. - // Sadly there is no way to distinguish - // a param/result from a local - // so we must proceed to the find. - - case *types.Func: - // A func, if not package-level, must be a method. - if recv := obj.Type().(*types.Signature).Recv(); recv == nil { - return "", fmt.Errorf("func is not a method: %v", obj) - } - - if path, ok := enc.concreteMethod(obj); ok { - // Fast path for concrete methods that avoids looping over scope. - return path, nil - } - - default: - panic(obj) - } - - // 4. Search the API for the path to the var (field/param/result) or method. - - // First inspect package-level named types. - // In the presence of path aliases, these give - // the best paths because non-types may - // refer to types, but not the reverse. - empty := make([]byte, 0, 48) // initial space - names := enc.scopeNames(scope) - for _, name := range names { - o := scope.Lookup(name) - tname, ok := o.(*types.TypeName) - if !ok { - continue // handle non-types in second pass - } - - path := append(empty, name...) - path = append(path, opType) - - T := o.Type() - - if tname.IsAlias() { - // type alias - if r := find(obj, T, path, nil); r != nil { - return Path(r), nil - } - } else { - if named, _ := T.(*types.Named); named != nil { - if r := findTypeParam(obj, typeparams.ForNamed(named), path, nil); r != nil { - // generic named type - return Path(r), nil - } - } - // defined (named) type - if r := find(obj, T.Underlying(), append(path, opUnderlying), nil); r != nil { - return Path(r), nil - } - } - } - - // Then inspect everything else: - // non-types, and declared methods of defined types. - for _, name := range names { - o := scope.Lookup(name) - path := append(empty, name...) - if _, ok := o.(*types.TypeName); !ok { - if o.Exported() { - // exported non-type (const, var, func) - if r := find(obj, o.Type(), append(path, opType), nil); r != nil { - return Path(r), nil - } - } - continue - } - - // Inspect declared methods of defined types. - if T, ok := o.Type().(*types.Named); ok { - path = append(path, opType) - // Note that method index here is always with respect - // to canonical ordering of methods, regardless of how - // they appear in the underlying type. - for i, m := range enc.namedMethods(T) { - path2 := appendOpArg(path, opMethod, i) - if m == obj { - return Path(path2), nil // found declared method - } - if r := find(obj, m.Type(), append(path2, opType), nil); r != nil { - return Path(r), nil - } - } - } - } - - return "", fmt.Errorf("can't find path for %v in %s", obj, pkg.Path()) -} - -func appendOpArg(path []byte, op byte, arg int) []byte { - path = append(path, op) - path = strconv.AppendInt(path, int64(arg), 10) - return path -} - -// concreteMethod returns the path for meth, which must have a non-nil receiver. -// The second return value indicates success and may be false if the method is -// an interface method or if it is an instantiated method. -// -// This function is just an optimization that avoids the general scope walking -// approach. You are expected to fall back to the general approach if this -// function fails. -func (enc *Encoder) concreteMethod(meth *types.Func) (Path, bool) { - // Concrete methods can only be declared on package-scoped named types. For - // that reason we can skip the expensive walk over the package scope: the - // path will always be package -> named type -> method. We can trivially get - // the type name from the receiver, and only have to look over the type's - // methods to find the method index. - // - // Methods on generic types require special consideration, however. Consider - // the following package: - // - // L1: type S[T any] struct{} - // L2: func (recv S[A]) Foo() { recv.Bar() } - // L3: func (recv S[B]) Bar() { } - // L4: type Alias = S[int] - // L5: func _[T any]() { var s S[int]; s.Foo() } - // - // The receivers of methods on generic types are instantiations. L2 and L3 - // instantiate S with the type-parameters A and B, which are scoped to the - // respective methods. L4 and L5 each instantiate S with int. Each of these - // instantiations has its own method set, full of methods (and thus objects) - // with receivers whose types are the respective instantiations. In other - // words, we have - // - // S[A].Foo, S[A].Bar - // S[B].Foo, S[B].Bar - // S[int].Foo, S[int].Bar - // - // We may thus be trying to produce object paths for any of these objects. - // - // S[A].Foo and S[B].Bar are the origin methods, and their paths are S.Foo - // and S.Bar, which are the paths that this function naturally produces. - // - // S[A].Bar, S[B].Foo, and both methods on S[int] are instantiations that - // don't correspond to the origin methods. For S[int], this is significant. - // The most precise object path for S[int].Foo, for example, is Alias.Foo, - // not S.Foo. Our function, however, would produce S.Foo, which would - // resolve to a different object. - // - // For S[A].Bar and S[B].Foo it could be argued that S.Bar and S.Foo are - // still the correct paths, since only the origin methods have meaningful - // paths. But this is likely only true for trivial cases and has edge cases. - // Since this function is only an optimization, we err on the side of giving - // up, deferring to the slower but definitely correct algorithm. Most users - // of objectpath will only be giving us origin methods, anyway, as referring - // to instantiated methods is usually not useful. - - if typeparams.OriginMethod(meth) != meth { - return "", false - } - - recvT := meth.Type().(*types.Signature).Recv().Type() - if ptr, ok := recvT.(*types.Pointer); ok { - recvT = ptr.Elem() - } - - named, ok := recvT.(*types.Named) - if !ok { - return "", false - } - - if types.IsInterface(named) { - // Named interfaces don't have to be package-scoped - // - // TODO(dominikh): opt: if scope.Lookup(name) == named, then we can apply this optimization to interface - // methods, too, I think. - return "", false - } - - // Preallocate space for the name, opType, opMethod, and some digits. - name := named.Obj().Name() - path := make([]byte, 0, len(name)+8) - path = append(path, name...) - path = append(path, opType) - for i, m := range enc.namedMethods(named) { - if m == meth { - path = appendOpArg(path, opMethod, i) - return Path(path), true - } - } - - // Due to golang/go#59944, go/types fails to associate the receiver with - // certain methods on cgo types. - // - // TODO(rfindley): replace this panic once golang/go#59944 is fixed in all Go - // versions gopls supports. - return "", false - // panic(fmt.Sprintf("couldn't find method %s on type %s; methods: %#v", meth, named, enc.namedMethods(named))) -} - -// find finds obj within type T, returning the path to it, or nil if not found. -// -// The seen map is used to short circuit cycles through type parameters. If -// nil, it will be allocated as necessary. -func find(obj types.Object, T types.Type, path []byte, seen map[*types.TypeName]bool) []byte { - switch T := T.(type) { - case *types.Basic, *types.Named: - // Named types belonging to pkg were handled already, - // so T must belong to another package. No path. - return nil - case *types.Pointer: - return find(obj, T.Elem(), append(path, opElem), seen) - case *types.Slice: - return find(obj, T.Elem(), append(path, opElem), seen) - case *types.Array: - return find(obj, T.Elem(), append(path, opElem), seen) - case *types.Chan: - return find(obj, T.Elem(), append(path, opElem), seen) - case *types.Map: - if r := find(obj, T.Key(), append(path, opKey), seen); r != nil { - return r - } - return find(obj, T.Elem(), append(path, opElem), seen) - case *types.Signature: - if r := findTypeParam(obj, typeparams.ForSignature(T), path, seen); r != nil { - return r - } - if r := find(obj, T.Params(), append(path, opParams), seen); r != nil { - return r - } - return find(obj, T.Results(), append(path, opResults), seen) - case *types.Struct: - for i := 0; i < T.NumFields(); i++ { - fld := T.Field(i) - path2 := appendOpArg(path, opField, i) - if fld == obj { - return path2 // found field var - } - if r := find(obj, fld.Type(), append(path2, opType), seen); r != nil { - return r - } - } - return nil - case *types.Tuple: - for i := 0; i < T.Len(); i++ { - v := T.At(i) - path2 := appendOpArg(path, opAt, i) - if v == obj { - return path2 // found param/result var - } - if r := find(obj, v.Type(), append(path2, opType), seen); r != nil { - return r - } - } - return nil - case *types.Interface: - for i := 0; i < T.NumMethods(); i++ { - m := T.Method(i) - path2 := appendOpArg(path, opMethod, i) - if m == obj { - return path2 // found interface method - } - if r := find(obj, m.Type(), append(path2, opType), seen); r != nil { - return r - } - } - return nil - case *typeparams.TypeParam: - name := T.Obj() - if name == obj { - return append(path, opObj) - } - if seen[name] { - return nil - } - if seen == nil { - seen = make(map[*types.TypeName]bool) - } - seen[name] = true - if r := find(obj, T.Constraint(), append(path, opConstraint), seen); r != nil { - return r - } - return nil - } - panic(T) -} - -func findTypeParam(obj types.Object, list *typeparams.TypeParamList, path []byte, seen map[*types.TypeName]bool) []byte { - for i := 0; i < list.Len(); i++ { - tparam := list.At(i) - path2 := appendOpArg(path, opTypeParam, i) - if r := find(obj, tparam, path2, seen); r != nil { - return r - } - } - return nil -} - -// Object returns the object denoted by path p within the package pkg. -func Object(pkg *types.Package, p Path) (types.Object, error) { - if p == "" { - return nil, fmt.Errorf("empty path") - } - - pathstr := string(p) - var pkgobj, suffix string - if dot := strings.IndexByte(pathstr, opType); dot < 0 { - pkgobj = pathstr - } else { - pkgobj = pathstr[:dot] - suffix = pathstr[dot:] // suffix starts with "." - } - - obj := pkg.Scope().Lookup(pkgobj) - if obj == nil { - return nil, fmt.Errorf("package %s does not contain %q", pkg.Path(), pkgobj) - } - - // abstraction of *types.{Pointer,Slice,Array,Chan,Map} - type hasElem interface { - Elem() types.Type - } - // abstraction of *types.{Named,Signature} - type hasTypeParams interface { - TypeParams() *typeparams.TypeParamList - } - // abstraction of *types.{Named,TypeParam} - type hasObj interface { - Obj() *types.TypeName - } - - // The loop state is the pair (t, obj), - // exactly one of which is non-nil, initially obj. - // All suffixes start with '.' (the only object->type operation), - // followed by optional type->type operations, - // then a type->object operation. - // The cycle then repeats. - var t types.Type - for suffix != "" { - code := suffix[0] - suffix = suffix[1:] - - // Codes [AFM] have an integer operand. - var index int - switch code { - case opAt, opField, opMethod, opTypeParam: - rest := strings.TrimLeft(suffix, "0123456789") - numerals := suffix[:len(suffix)-len(rest)] - suffix = rest - i, err := strconv.Atoi(numerals) - if err != nil { - return nil, fmt.Errorf("invalid path: bad numeric operand %q for code %q", numerals, code) - } - index = int(i) - case opObj: - // no operand - default: - // The suffix must end with a type->object operation. - if suffix == "" { - return nil, fmt.Errorf("invalid path: ends with %q, want [AFMO]", code) - } - } - - if code == opType { - if t != nil { - return nil, fmt.Errorf("invalid path: unexpected %q in type context", opType) - } - t = obj.Type() - obj = nil - continue - } - - if t == nil { - return nil, fmt.Errorf("invalid path: code %q in object context", code) - } - - // Inv: t != nil, obj == nil - - switch code { - case opElem: - hasElem, ok := t.(hasElem) // Pointer, Slice, Array, Chan, Map - if !ok { - return nil, fmt.Errorf("cannot apply %q to %s (got %T, want pointer, slice, array, chan or map)", code, t, t) - } - t = hasElem.Elem() - - case opKey: - mapType, ok := t.(*types.Map) - if !ok { - return nil, fmt.Errorf("cannot apply %q to %s (got %T, want map)", code, t, t) - } - t = mapType.Key() - - case opParams: - sig, ok := t.(*types.Signature) - if !ok { - return nil, fmt.Errorf("cannot apply %q to %s (got %T, want signature)", code, t, t) - } - t = sig.Params() - - case opResults: - sig, ok := t.(*types.Signature) - if !ok { - return nil, fmt.Errorf("cannot apply %q to %s (got %T, want signature)", code, t, t) - } - t = sig.Results() - - case opUnderlying: - named, ok := t.(*types.Named) - if !ok { - return nil, fmt.Errorf("cannot apply %q to %s (got %T, want named)", code, t, t) - } - t = named.Underlying() - - case opTypeParam: - hasTypeParams, ok := t.(hasTypeParams) // Named, Signature - if !ok { - return nil, fmt.Errorf("cannot apply %q to %s (got %T, want named or signature)", code, t, t) - } - tparams := hasTypeParams.TypeParams() - if n := tparams.Len(); index >= n { - return nil, fmt.Errorf("tuple index %d out of range [0-%d)", index, n) - } - t = tparams.At(index) - - case opConstraint: - tparam, ok := t.(*typeparams.TypeParam) - if !ok { - return nil, fmt.Errorf("cannot apply %q to %s (got %T, want type parameter)", code, t, t) - } - t = tparam.Constraint() - - case opAt: - tuple, ok := t.(*types.Tuple) - if !ok { - return nil, fmt.Errorf("cannot apply %q to %s (got %T, want tuple)", code, t, t) - } - if n := tuple.Len(); index >= n { - return nil, fmt.Errorf("tuple index %d out of range [0-%d)", index, n) - } - obj = tuple.At(index) - t = nil - - case opField: - structType, ok := t.(*types.Struct) - if !ok { - return nil, fmt.Errorf("cannot apply %q to %s (got %T, want struct)", code, t, t) - } - if n := structType.NumFields(); index >= n { - return nil, fmt.Errorf("field index %d out of range [0-%d)", index, n) - } - obj = structType.Field(index) - t = nil - - case opMethod: - switch t := t.(type) { - case *types.Interface: - if index >= t.NumMethods() { - return nil, fmt.Errorf("method index %d out of range [0-%d)", index, t.NumMethods()) - } - obj = t.Method(index) // Id-ordered - - case *types.Named: - methods := namedMethods(t) // (unmemoized) - if index >= len(methods) { - return nil, fmt.Errorf("method index %d out of range [0-%d)", index, len(methods)) - } - obj = methods[index] // Id-ordered - - default: - return nil, fmt.Errorf("cannot apply %q to %s (got %T, want interface or named)", code, t, t) - } - t = nil - - case opObj: - hasObj, ok := t.(hasObj) - if !ok { - return nil, fmt.Errorf("cannot apply %q to %s (got %T, want named or type param)", code, t, t) - } - obj = hasObj.Obj() - t = nil - - default: - return nil, fmt.Errorf("invalid path: unknown code %q", code) - } - } - - if obj.Pkg() != pkg { - return nil, fmt.Errorf("path denotes %s, which belongs to a different package", obj) - } - - return obj, nil // success -} - -// namedMethods returns the methods of a Named type in ascending Id order. -func namedMethods(named *types.Named) []*types.Func { - methods := make([]*types.Func, named.NumMethods()) - for i := range methods { - methods[i] = named.Method(i) - } - sort.Slice(methods, func(i, j int) bool { - return methods[i].Id() < methods[j].Id() - }) - return methods -} - -// namedMethods is a memoization of the namedMethods function. Callers must not modify the result. -func (enc *Encoder) namedMethods(named *types.Named) []*types.Func { - m := enc.namedMethodsMemo - if m == nil { - m = make(map[*types.Named][]*types.Func) - enc.namedMethodsMemo = m - } - methods, ok := m[named] - if !ok { - methods = namedMethods(named) // allocates and sorts - m[named] = methods - } - return methods -} - -// scopeNames is a memoization of scope.Names. Callers must not modify the result. -func (enc *Encoder) scopeNames(scope *types.Scope) []string { - m := enc.scopeNamesMemo - if m == nil { - m = make(map[*types.Scope][]string) - enc.scopeNamesMemo = m - } - names, ok := m[scope] - if !ok { - names = scope.Names() // allocates and sorts - m[scope] = names - } - return names -} diff --git a/vendor/golang.org/x/tools/internal/event/tag/tag.go b/vendor/golang.org/x/tools/internal/event/tag/tag.go new file mode 100644 index 00000000..ff2f2ecd --- /dev/null +++ b/vendor/golang.org/x/tools/internal/event/tag/tag.go @@ -0,0 +1,59 @@ +// Copyright 2019 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// Package tag provides the labels used for telemetry throughout gopls. +package tag + +import ( + "golang.org/x/tools/internal/event/keys" +) + +var ( + // create the label keys we use + Method = keys.NewString("method", "") + StatusCode = keys.NewString("status.code", "") + StatusMessage = keys.NewString("status.message", "") + RPCID = keys.NewString("id", "") + RPCDirection = keys.NewString("direction", "") + File = keys.NewString("file", "") + Directory = keys.New("directory", "") + URI = keys.New("URI", "") + Package = keys.NewString("package", "") // Package ID + PackagePath = keys.NewString("package_path", "") + Query = keys.New("query", "") + Snapshot = keys.NewUInt64("snapshot", "") + Operation = keys.NewString("operation", "") + + Position = keys.New("position", "") + Category = keys.NewString("category", "") + PackageCount = keys.NewInt("packages", "") + Files = keys.New("files", "") + Port = keys.NewInt("port", "") + Type = keys.New("type", "") + HoverKind = keys.NewString("hoverkind", "") + + NewServer = keys.NewString("new_server", "A new server was added") + EndServer = keys.NewString("end_server", "A server was shut down") + + ServerID = keys.NewString("server", "The server ID an event is related to") + Logfile = keys.NewString("logfile", "") + DebugAddress = keys.NewString("debug_address", "") + GoplsPath = keys.NewString("gopls_path", "") + ClientID = keys.NewString("client_id", "") + + Level = keys.NewInt("level", "The logging level") +) + +var ( + // create the stats we measure + Started = keys.NewInt64("started", "Count of started RPCs.") + ReceivedBytes = keys.NewInt64("received_bytes", "Bytes received.") //, unit.Bytes) + SentBytes = keys.NewInt64("sent_bytes", "Bytes sent.") //, unit.Bytes) + Latency = keys.NewFloat64("latency_ms", "Elapsed time in milliseconds") //, unit.Milliseconds) +) + +const ( + Inbound = "in" + Outbound = "out" +) diff --git a/vendor/golang.org/x/tools/internal/gcimporter/bexport.go b/vendor/golang.org/x/tools/internal/gcimporter/bexport.go deleted file mode 100644 index 30582ed6..00000000 --- a/vendor/golang.org/x/tools/internal/gcimporter/bexport.go +++ /dev/null @@ -1,852 +0,0 @@ -// Copyright 2016 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -// Binary package export. -// This file was derived from $GOROOT/src/cmd/compile/internal/gc/bexport.go; -// see that file for specification of the format. - -package gcimporter - -import ( - "bytes" - "encoding/binary" - "fmt" - "go/constant" - "go/token" - "go/types" - "math" - "math/big" - "sort" - "strings" -) - -// If debugFormat is set, each integer and string value is preceded by a marker -// and position information in the encoding. This mechanism permits an importer -// to recognize immediately when it is out of sync. The importer recognizes this -// mode automatically (i.e., it can import export data produced with debugging -// support even if debugFormat is not set at the time of import). This mode will -// lead to massively larger export data (by a factor of 2 to 3) and should only -// be enabled during development and debugging. -// -// NOTE: This flag is the first flag to enable if importing dies because of -// (suspected) format errors, and whenever a change is made to the format. -const debugFormat = false // default: false - -// Current export format version. Increase with each format change. -// -// Note: The latest binary (non-indexed) export format is at version 6. -// This exporter is still at level 4, but it doesn't matter since -// the binary importer can handle older versions just fine. -// -// 6: package height (CL 105038) -- NOT IMPLEMENTED HERE -// 5: improved position encoding efficiency (issue 20080, CL 41619) -- NOT IMPLEMENTED HERE -// 4: type name objects support type aliases, uses aliasTag -// 3: Go1.8 encoding (same as version 2, aliasTag defined but never used) -// 2: removed unused bool in ODCL export (compiler only) -// 1: header format change (more regular), export package for _ struct fields -// 0: Go1.7 encoding -const exportVersion = 4 - -// trackAllTypes enables cycle tracking for all types, not just named -// types. The existing compiler invariants assume that unnamed types -// that are not completely set up are not used, or else there are spurious -// errors. -// If disabled, only named types are tracked, possibly leading to slightly -// less efficient encoding in rare cases. It also prevents the export of -// some corner-case type declarations (but those are not handled correctly -// with with the textual export format either). -// TODO(gri) enable and remove once issues caused by it are fixed -const trackAllTypes = false - -type exporter struct { - fset *token.FileSet - out bytes.Buffer - - // object -> index maps, indexed in order of serialization - strIndex map[string]int - pkgIndex map[*types.Package]int - typIndex map[types.Type]int - - // position encoding - posInfoFormat bool - prevFile string - prevLine int - - // debugging support - written int // bytes written - indent int // for trace -} - -// internalError represents an error generated inside this package. -type internalError string - -func (e internalError) Error() string { return "gcimporter: " + string(e) } - -func internalErrorf(format string, args ...interface{}) error { - return internalError(fmt.Sprintf(format, args...)) -} - -// BExportData returns binary export data for pkg. -// If no file set is provided, position info will be missing. -func BExportData(fset *token.FileSet, pkg *types.Package) (b []byte, err error) { - if !debug { - defer func() { - if e := recover(); e != nil { - if ierr, ok := e.(internalError); ok { - err = ierr - return - } - // Not an internal error; panic again. - panic(e) - } - }() - } - - p := exporter{ - fset: fset, - strIndex: map[string]int{"": 0}, // empty string is mapped to 0 - pkgIndex: make(map[*types.Package]int), - typIndex: make(map[types.Type]int), - posInfoFormat: true, // TODO(gri) might become a flag, eventually - } - - // write version info - // The version string must start with "version %d" where %d is the version - // number. Additional debugging information may follow after a blank; that - // text is ignored by the importer. - p.rawStringln(fmt.Sprintf("version %d", exportVersion)) - var debug string - if debugFormat { - debug = "debug" - } - p.rawStringln(debug) // cannot use p.bool since it's affected by debugFormat; also want to see this clearly - p.bool(trackAllTypes) - p.bool(p.posInfoFormat) - - // --- generic export data --- - - // populate type map with predeclared "known" types - for index, typ := range predeclared() { - p.typIndex[typ] = index - } - if len(p.typIndex) != len(predeclared()) { - return nil, internalError("duplicate entries in type map?") - } - - // write package data - p.pkg(pkg, true) - if trace { - p.tracef("\n") - } - - // write objects - objcount := 0 - scope := pkg.Scope() - for _, name := range scope.Names() { - if !token.IsExported(name) { - continue - } - if trace { - p.tracef("\n") - } - p.obj(scope.Lookup(name)) - objcount++ - } - - // indicate end of list - if trace { - p.tracef("\n") - } - p.tag(endTag) - - // for self-verification only (redundant) - p.int(objcount) - - if trace { - p.tracef("\n") - } - - // --- end of export data --- - - return p.out.Bytes(), nil -} - -func (p *exporter) pkg(pkg *types.Package, emptypath bool) { - if pkg == nil { - panic(internalError("unexpected nil pkg")) - } - - // if we saw the package before, write its index (>= 0) - if i, ok := p.pkgIndex[pkg]; ok { - p.index('P', i) - return - } - - // otherwise, remember the package, write the package tag (< 0) and package data - if trace { - p.tracef("P%d = { ", len(p.pkgIndex)) - defer p.tracef("} ") - } - p.pkgIndex[pkg] = len(p.pkgIndex) - - p.tag(packageTag) - p.string(pkg.Name()) - if emptypath { - p.string("") - } else { - p.string(pkg.Path()) - } -} - -func (p *exporter) obj(obj types.Object) { - switch obj := obj.(type) { - case *types.Const: - p.tag(constTag) - p.pos(obj) - p.qualifiedName(obj) - p.typ(obj.Type()) - p.value(obj.Val()) - - case *types.TypeName: - if obj.IsAlias() { - p.tag(aliasTag) - p.pos(obj) - p.qualifiedName(obj) - } else { - p.tag(typeTag) - } - p.typ(obj.Type()) - - case *types.Var: - p.tag(varTag) - p.pos(obj) - p.qualifiedName(obj) - p.typ(obj.Type()) - - case *types.Func: - p.tag(funcTag) - p.pos(obj) - p.qualifiedName(obj) - sig := obj.Type().(*types.Signature) - p.paramList(sig.Params(), sig.Variadic()) - p.paramList(sig.Results(), false) - - default: - panic(internalErrorf("unexpected object %v (%T)", obj, obj)) - } -} - -func (p *exporter) pos(obj types.Object) { - if !p.posInfoFormat { - return - } - - file, line := p.fileLine(obj) - if file == p.prevFile { - // common case: write line delta - // delta == 0 means different file or no line change - delta := line - p.prevLine - p.int(delta) - if delta == 0 { - p.int(-1) // -1 means no file change - } - } else { - // different file - p.int(0) - // Encode filename as length of common prefix with previous - // filename, followed by (possibly empty) suffix. Filenames - // frequently share path prefixes, so this can save a lot - // of space and make export data size less dependent on file - // path length. The suffix is unlikely to be empty because - // file names tend to end in ".go". - n := commonPrefixLen(p.prevFile, file) - p.int(n) // n >= 0 - p.string(file[n:]) // write suffix only - p.prevFile = file - p.int(line) - } - p.prevLine = line -} - -func (p *exporter) fileLine(obj types.Object) (file string, line int) { - if p.fset != nil { - pos := p.fset.Position(obj.Pos()) - file = pos.Filename - line = pos.Line - } - return -} - -func commonPrefixLen(a, b string) int { - if len(a) > len(b) { - a, b = b, a - } - // len(a) <= len(b) - i := 0 - for i < len(a) && a[i] == b[i] { - i++ - } - return i -} - -func (p *exporter) qualifiedName(obj types.Object) { - p.string(obj.Name()) - p.pkg(obj.Pkg(), false) -} - -func (p *exporter) typ(t types.Type) { - if t == nil { - panic(internalError("nil type")) - } - - // Possible optimization: Anonymous pointer types *T where - // T is a named type are common. We could canonicalize all - // such types *T to a single type PT = *T. This would lead - // to at most one *T entry in typIndex, and all future *T's - // would be encoded as the respective index directly. Would - // save 1 byte (pointerTag) per *T and reduce the typIndex - // size (at the cost of a canonicalization map). We can do - // this later, without encoding format change. - - // if we saw the type before, write its index (>= 0) - if i, ok := p.typIndex[t]; ok { - p.index('T', i) - return - } - - // otherwise, remember the type, write the type tag (< 0) and type data - if trackAllTypes { - if trace { - p.tracef("T%d = {>\n", len(p.typIndex)) - defer p.tracef("<\n} ") - } - p.typIndex[t] = len(p.typIndex) - } - - switch t := t.(type) { - case *types.Named: - if !trackAllTypes { - // if we don't track all types, track named types now - p.typIndex[t] = len(p.typIndex) - } - - p.tag(namedTag) - p.pos(t.Obj()) - p.qualifiedName(t.Obj()) - p.typ(t.Underlying()) - if !types.IsInterface(t) { - p.assocMethods(t) - } - - case *types.Array: - p.tag(arrayTag) - p.int64(t.Len()) - p.typ(t.Elem()) - - case *types.Slice: - p.tag(sliceTag) - p.typ(t.Elem()) - - case *dddSlice: - p.tag(dddTag) - p.typ(t.elem) - - case *types.Struct: - p.tag(structTag) - p.fieldList(t) - - case *types.Pointer: - p.tag(pointerTag) - p.typ(t.Elem()) - - case *types.Signature: - p.tag(signatureTag) - p.paramList(t.Params(), t.Variadic()) - p.paramList(t.Results(), false) - - case *types.Interface: - p.tag(interfaceTag) - p.iface(t) - - case *types.Map: - p.tag(mapTag) - p.typ(t.Key()) - p.typ(t.Elem()) - - case *types.Chan: - p.tag(chanTag) - p.int(int(3 - t.Dir())) // hack - p.typ(t.Elem()) - - default: - panic(internalErrorf("unexpected type %T: %s", t, t)) - } -} - -func (p *exporter) assocMethods(named *types.Named) { - // Sort methods (for determinism). - var methods []*types.Func - for i := 0; i < named.NumMethods(); i++ { - methods = append(methods, named.Method(i)) - } - sort.Sort(methodsByName(methods)) - - p.int(len(methods)) - - if trace && methods != nil { - p.tracef("associated methods {>\n") - } - - for i, m := range methods { - if trace && i > 0 { - p.tracef("\n") - } - - p.pos(m) - name := m.Name() - p.string(name) - if !exported(name) { - p.pkg(m.Pkg(), false) - } - - sig := m.Type().(*types.Signature) - p.paramList(types.NewTuple(sig.Recv()), false) - p.paramList(sig.Params(), sig.Variadic()) - p.paramList(sig.Results(), false) - p.int(0) // dummy value for go:nointerface pragma - ignored by importer - } - - if trace && methods != nil { - p.tracef("<\n} ") - } -} - -type methodsByName []*types.Func - -func (x methodsByName) Len() int { return len(x) } -func (x methodsByName) Swap(i, j int) { x[i], x[j] = x[j], x[i] } -func (x methodsByName) Less(i, j int) bool { return x[i].Name() < x[j].Name() } - -func (p *exporter) fieldList(t *types.Struct) { - if trace && t.NumFields() > 0 { - p.tracef("fields {>\n") - defer p.tracef("<\n} ") - } - - p.int(t.NumFields()) - for i := 0; i < t.NumFields(); i++ { - if trace && i > 0 { - p.tracef("\n") - } - p.field(t.Field(i)) - p.string(t.Tag(i)) - } -} - -func (p *exporter) field(f *types.Var) { - if !f.IsField() { - panic(internalError("field expected")) - } - - p.pos(f) - p.fieldName(f) - p.typ(f.Type()) -} - -func (p *exporter) iface(t *types.Interface) { - // TODO(gri): enable importer to load embedded interfaces, - // then emit Embeddeds and ExplicitMethods separately here. - p.int(0) - - n := t.NumMethods() - if trace && n > 0 { - p.tracef("methods {>\n") - defer p.tracef("<\n} ") - } - p.int(n) - for i := 0; i < n; i++ { - if trace && i > 0 { - p.tracef("\n") - } - p.method(t.Method(i)) - } -} - -func (p *exporter) method(m *types.Func) { - sig := m.Type().(*types.Signature) - if sig.Recv() == nil { - panic(internalError("method expected")) - } - - p.pos(m) - p.string(m.Name()) - if m.Name() != "_" && !token.IsExported(m.Name()) { - p.pkg(m.Pkg(), false) - } - - // interface method; no need to encode receiver. - p.paramList(sig.Params(), sig.Variadic()) - p.paramList(sig.Results(), false) -} - -func (p *exporter) fieldName(f *types.Var) { - name := f.Name() - - if f.Anonymous() { - // anonymous field - we distinguish between 3 cases: - // 1) field name matches base type name and is exported - // 2) field name matches base type name and is not exported - // 3) field name doesn't match base type name (alias name) - bname := basetypeName(f.Type()) - if name == bname { - if token.IsExported(name) { - name = "" // 1) we don't need to know the field name or package - } else { - name = "?" // 2) use unexported name "?" to force package export - } - } else { - // 3) indicate alias and export name as is - // (this requires an extra "@" but this is a rare case) - p.string("@") - } - } - - p.string(name) - if name != "" && !token.IsExported(name) { - p.pkg(f.Pkg(), false) - } -} - -func basetypeName(typ types.Type) string { - switch typ := deref(typ).(type) { - case *types.Basic: - return typ.Name() - case *types.Named: - return typ.Obj().Name() - default: - return "" // unnamed type - } -} - -func (p *exporter) paramList(params *types.Tuple, variadic bool) { - // use negative length to indicate unnamed parameters - // (look at the first parameter only since either all - // names are present or all are absent) - n := params.Len() - if n > 0 && params.At(0).Name() == "" { - n = -n - } - p.int(n) - for i := 0; i < params.Len(); i++ { - q := params.At(i) - t := q.Type() - if variadic && i == params.Len()-1 { - t = &dddSlice{t.(*types.Slice).Elem()} - } - p.typ(t) - if n > 0 { - name := q.Name() - p.string(name) - if name != "_" { - p.pkg(q.Pkg(), false) - } - } - p.string("") // no compiler-specific info - } -} - -func (p *exporter) value(x constant.Value) { - if trace { - p.tracef("= ") - } - - switch x.Kind() { - case constant.Bool: - tag := falseTag - if constant.BoolVal(x) { - tag = trueTag - } - p.tag(tag) - - case constant.Int: - if v, exact := constant.Int64Val(x); exact { - // common case: x fits into an int64 - use compact encoding - p.tag(int64Tag) - p.int64(v) - return - } - // uncommon case: large x - use float encoding - // (powers of 2 will be encoded efficiently with exponent) - p.tag(floatTag) - p.float(constant.ToFloat(x)) - - case constant.Float: - p.tag(floatTag) - p.float(x) - - case constant.Complex: - p.tag(complexTag) - p.float(constant.Real(x)) - p.float(constant.Imag(x)) - - case constant.String: - p.tag(stringTag) - p.string(constant.StringVal(x)) - - case constant.Unknown: - // package contains type errors - p.tag(unknownTag) - - default: - panic(internalErrorf("unexpected value %v (%T)", x, x)) - } -} - -func (p *exporter) float(x constant.Value) { - if x.Kind() != constant.Float { - panic(internalErrorf("unexpected constant %v, want float", x)) - } - // extract sign (there is no -0) - sign := constant.Sign(x) - if sign == 0 { - // x == 0 - p.int(0) - return - } - // x != 0 - - var f big.Float - if v, exact := constant.Float64Val(x); exact { - // float64 - f.SetFloat64(v) - } else if num, denom := constant.Num(x), constant.Denom(x); num.Kind() == constant.Int { - // TODO(gri): add big.Rat accessor to constant.Value. - r := valueToRat(num) - f.SetRat(r.Quo(r, valueToRat(denom))) - } else { - // Value too large to represent as a fraction => inaccessible. - // TODO(gri): add big.Float accessor to constant.Value. - f.SetFloat64(math.MaxFloat64) // FIXME - } - - // extract exponent such that 0.5 <= m < 1.0 - var m big.Float - exp := f.MantExp(&m) - - // extract mantissa as *big.Int - // - set exponent large enough so mant satisfies mant.IsInt() - // - get *big.Int from mant - m.SetMantExp(&m, int(m.MinPrec())) - mant, acc := m.Int(nil) - if acc != big.Exact { - panic(internalError("internal error")) - } - - p.int(sign) - p.int(exp) - p.string(string(mant.Bytes())) -} - -func valueToRat(x constant.Value) *big.Rat { - // Convert little-endian to big-endian. - // I can't believe this is necessary. - bytes := constant.Bytes(x) - for i := 0; i < len(bytes)/2; i++ { - bytes[i], bytes[len(bytes)-1-i] = bytes[len(bytes)-1-i], bytes[i] - } - return new(big.Rat).SetInt(new(big.Int).SetBytes(bytes)) -} - -func (p *exporter) bool(b bool) bool { - if trace { - p.tracef("[") - defer p.tracef("= %v] ", b) - } - - x := 0 - if b { - x = 1 - } - p.int(x) - return b -} - -// ---------------------------------------------------------------------------- -// Low-level encoders - -func (p *exporter) index(marker byte, index int) { - if index < 0 { - panic(internalError("invalid index < 0")) - } - if debugFormat { - p.marker('t') - } - if trace { - p.tracef("%c%d ", marker, index) - } - p.rawInt64(int64(index)) -} - -func (p *exporter) tag(tag int) { - if tag >= 0 { - panic(internalError("invalid tag >= 0")) - } - if debugFormat { - p.marker('t') - } - if trace { - p.tracef("%s ", tagString[-tag]) - } - p.rawInt64(int64(tag)) -} - -func (p *exporter) int(x int) { - p.int64(int64(x)) -} - -func (p *exporter) int64(x int64) { - if debugFormat { - p.marker('i') - } - if trace { - p.tracef("%d ", x) - } - p.rawInt64(x) -} - -func (p *exporter) string(s string) { - if debugFormat { - p.marker('s') - } - if trace { - p.tracef("%q ", s) - } - // if we saw the string before, write its index (>= 0) - // (the empty string is mapped to 0) - if i, ok := p.strIndex[s]; ok { - p.rawInt64(int64(i)) - return - } - // otherwise, remember string and write its negative length and bytes - p.strIndex[s] = len(p.strIndex) - p.rawInt64(-int64(len(s))) - for i := 0; i < len(s); i++ { - p.rawByte(s[i]) - } -} - -// marker emits a marker byte and position information which makes -// it easy for a reader to detect if it is "out of sync". Used for -// debugFormat format only. -func (p *exporter) marker(m byte) { - p.rawByte(m) - // Enable this for help tracking down the location - // of an incorrect marker when running in debugFormat. - if false && trace { - p.tracef("#%d ", p.written) - } - p.rawInt64(int64(p.written)) -} - -// rawInt64 should only be used by low-level encoders. -func (p *exporter) rawInt64(x int64) { - var tmp [binary.MaxVarintLen64]byte - n := binary.PutVarint(tmp[:], x) - for i := 0; i < n; i++ { - p.rawByte(tmp[i]) - } -} - -// rawStringln should only be used to emit the initial version string. -func (p *exporter) rawStringln(s string) { - for i := 0; i < len(s); i++ { - p.rawByte(s[i]) - } - p.rawByte('\n') -} - -// rawByte is the bottleneck interface to write to p.out. -// rawByte escapes b as follows (any encoding does that -// hides '$'): -// -// '$' => '|' 'S' -// '|' => '|' '|' -// -// Necessary so other tools can find the end of the -// export data by searching for "$$". -// rawByte should only be used by low-level encoders. -func (p *exporter) rawByte(b byte) { - switch b { - case '$': - // write '$' as '|' 'S' - b = 'S' - fallthrough - case '|': - // write '|' as '|' '|' - p.out.WriteByte('|') - p.written++ - } - p.out.WriteByte(b) - p.written++ -} - -// tracef is like fmt.Printf but it rewrites the format string -// to take care of indentation. -func (p *exporter) tracef(format string, args ...interface{}) { - if strings.ContainsAny(format, "<>\n") { - var buf bytes.Buffer - for i := 0; i < len(format); i++ { - // no need to deal with runes - ch := format[i] - switch ch { - case '>': - p.indent++ - continue - case '<': - p.indent-- - continue - } - buf.WriteByte(ch) - if ch == '\n' { - for j := p.indent; j > 0; j-- { - buf.WriteString(". ") - } - } - } - format = buf.String() - } - fmt.Printf(format, args...) -} - -// Debugging support. -// (tagString is only used when tracing is enabled) -var tagString = [...]string{ - // Packages - -packageTag: "package", - - // Types - -namedTag: "named type", - -arrayTag: "array", - -sliceTag: "slice", - -dddTag: "ddd", - -structTag: "struct", - -pointerTag: "pointer", - -signatureTag: "signature", - -interfaceTag: "interface", - -mapTag: "map", - -chanTag: "chan", - - // Values - -falseTag: "false", - -trueTag: "true", - -int64Tag: "int64", - -floatTag: "float", - -fractionTag: "fraction", - -complexTag: "complex", - -stringTag: "string", - -unknownTag: "unknown", - - // Type aliases - -aliasTag: "alias", -} diff --git a/vendor/golang.org/x/tools/internal/gcimporter/bimport.go b/vendor/golang.org/x/tools/internal/gcimporter/bimport.go index b85de014..d98b0db2 100644 --- a/vendor/golang.org/x/tools/internal/gcimporter/bimport.go +++ b/vendor/golang.org/x/tools/internal/gcimporter/bimport.go @@ -2,340 +2,24 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. -// This file is a copy of $GOROOT/src/go/internal/gcimporter/bimport.go. +// This file contains the remaining vestiges of +// $GOROOT/src/go/internal/gcimporter/bimport.go. package gcimporter import ( - "encoding/binary" "fmt" - "go/constant" "go/token" "go/types" - "sort" - "strconv" - "strings" "sync" - "unicode" - "unicode/utf8" ) -type importer struct { - imports map[string]*types.Package - data []byte - importpath string - buf []byte // for reading strings - version int // export format version - - // object lists - strList []string // in order of appearance - pathList []string // in order of appearance - pkgList []*types.Package // in order of appearance - typList []types.Type // in order of appearance - interfaceList []*types.Interface // for delayed completion only - trackAllTypes bool - - // position encoding - posInfoFormat bool - prevFile string - prevLine int - fake fakeFileSet - - // debugging support - debugFormat bool - read int // bytes read -} - -// BImportData imports a package from the serialized package data -// and returns the number of bytes consumed and a reference to the package. -// If the export data version is not recognized or the format is otherwise -// compromised, an error is returned. -func BImportData(fset *token.FileSet, imports map[string]*types.Package, data []byte, path string) (_ int, pkg *types.Package, err error) { - // catch panics and return them as errors - const currentVersion = 6 - version := -1 // unknown version - defer func() { - if e := recover(); e != nil { - // Return a (possibly nil or incomplete) package unchanged (see #16088). - if version > currentVersion { - err = fmt.Errorf("cannot import %q (%v), export data is newer version - update tool", path, e) - } else { - err = fmt.Errorf("cannot import %q (%v), possibly version skew - reinstall package", path, e) - } - } - }() - - p := importer{ - imports: imports, - data: data, - importpath: path, - version: version, - strList: []string{""}, // empty string is mapped to 0 - pathList: []string{""}, // empty string is mapped to 0 - fake: fakeFileSet{ - fset: fset, - files: make(map[string]*fileInfo), - }, - } - defer p.fake.setLines() // set lines for files in fset - - // read version info - var versionstr string - if b := p.rawByte(); b == 'c' || b == 'd' { - // Go1.7 encoding; first byte encodes low-level - // encoding format (compact vs debug). - // For backward-compatibility only (avoid problems with - // old installed packages). Newly compiled packages use - // the extensible format string. - // TODO(gri) Remove this support eventually; after Go1.8. - if b == 'd' { - p.debugFormat = true - } - p.trackAllTypes = p.rawByte() == 'a' - p.posInfoFormat = p.int() != 0 - versionstr = p.string() - if versionstr == "v1" { - version = 0 - } - } else { - // Go1.8 extensible encoding - // read version string and extract version number (ignore anything after the version number) - versionstr = p.rawStringln(b) - if s := strings.SplitN(versionstr, " ", 3); len(s) >= 2 && s[0] == "version" { - if v, err := strconv.Atoi(s[1]); err == nil && v > 0 { - version = v - } - } - } - p.version = version - - // read version specific flags - extend as necessary - switch p.version { - // case currentVersion: - // ... - // fallthrough - case currentVersion, 5, 4, 3, 2, 1: - p.debugFormat = p.rawStringln(p.rawByte()) == "debug" - p.trackAllTypes = p.int() != 0 - p.posInfoFormat = p.int() != 0 - case 0: - // Go1.7 encoding format - nothing to do here - default: - errorf("unknown bexport format version %d (%q)", p.version, versionstr) - } - - // --- generic export data --- - - // populate typList with predeclared "known" types - p.typList = append(p.typList, predeclared()...) - - // read package data - pkg = p.pkg() - - // read objects of phase 1 only (see cmd/compile/internal/gc/bexport.go) - objcount := 0 - for { - tag := p.tagOrIndex() - if tag == endTag { - break - } - p.obj(tag) - objcount++ - } - - // self-verification - if count := p.int(); count != objcount { - errorf("got %d objects; want %d", objcount, count) - } - - // ignore compiler-specific import data - - // complete interfaces - // TODO(gri) re-investigate if we still need to do this in a delayed fashion - for _, typ := range p.interfaceList { - typ.Complete() - } - - // record all referenced packages as imports - list := append(([]*types.Package)(nil), p.pkgList[1:]...) - sort.Sort(byPath(list)) - pkg.SetImports(list) - - // package was imported completely and without errors - pkg.MarkComplete() - - return p.read, pkg, nil -} - func errorf(format string, args ...interface{}) { panic(fmt.Sprintf(format, args...)) } -func (p *importer) pkg() *types.Package { - // if the package was seen before, i is its index (>= 0) - i := p.tagOrIndex() - if i >= 0 { - return p.pkgList[i] - } - - // otherwise, i is the package tag (< 0) - if i != packageTag { - errorf("unexpected package tag %d version %d", i, p.version) - } - - // read package data - name := p.string() - var path string - if p.version >= 5 { - path = p.path() - } else { - path = p.string() - } - if p.version >= 6 { - p.int() // package height; unused by go/types - } - - // we should never see an empty package name - if name == "" { - errorf("empty package name in import") - } - - // an empty path denotes the package we are currently importing; - // it must be the first package we see - if (path == "") != (len(p.pkgList) == 0) { - errorf("package path %q for pkg index %d", path, len(p.pkgList)) - } - - // if the package was imported before, use that one; otherwise create a new one - if path == "" { - path = p.importpath - } - pkg := p.imports[path] - if pkg == nil { - pkg = types.NewPackage(path, name) - p.imports[path] = pkg - } else if pkg.Name() != name { - errorf("conflicting names %s and %s for package %q", pkg.Name(), name, path) - } - p.pkgList = append(p.pkgList, pkg) - - return pkg -} - -// objTag returns the tag value for each object kind. -func objTag(obj types.Object) int { - switch obj.(type) { - case *types.Const: - return constTag - case *types.TypeName: - return typeTag - case *types.Var: - return varTag - case *types.Func: - return funcTag - default: - errorf("unexpected object: %v (%T)", obj, obj) // panics - panic("unreachable") - } -} - -func sameObj(a, b types.Object) bool { - // Because unnamed types are not canonicalized, we cannot simply compare types for - // (pointer) identity. - // Ideally we'd check equality of constant values as well, but this is good enough. - return objTag(a) == objTag(b) && types.Identical(a.Type(), b.Type()) -} - -func (p *importer) declare(obj types.Object) { - pkg := obj.Pkg() - if alt := pkg.Scope().Insert(obj); alt != nil { - // This can only trigger if we import a (non-type) object a second time. - // Excluding type aliases, this cannot happen because 1) we only import a package - // once; and b) we ignore compiler-specific export data which may contain - // functions whose inlined function bodies refer to other functions that - // were already imported. - // However, type aliases require reexporting the original type, so we need - // to allow it (see also the comment in cmd/compile/internal/gc/bimport.go, - // method importer.obj, switch case importing functions). - // TODO(gri) review/update this comment once the gc compiler handles type aliases. - if !sameObj(obj, alt) { - errorf("inconsistent import:\n\t%v\npreviously imported as:\n\t%v\n", obj, alt) - } - } -} - -func (p *importer) obj(tag int) { - switch tag { - case constTag: - pos := p.pos() - pkg, name := p.qualifiedName() - typ := p.typ(nil, nil) - val := p.value() - p.declare(types.NewConst(pos, pkg, name, typ, val)) - - case aliasTag: - // TODO(gri) verify type alias hookup is correct - pos := p.pos() - pkg, name := p.qualifiedName() - typ := p.typ(nil, nil) - p.declare(types.NewTypeName(pos, pkg, name, typ)) - - case typeTag: - p.typ(nil, nil) - - case varTag: - pos := p.pos() - pkg, name := p.qualifiedName() - typ := p.typ(nil, nil) - p.declare(types.NewVar(pos, pkg, name, typ)) - - case funcTag: - pos := p.pos() - pkg, name := p.qualifiedName() - params, isddd := p.paramList() - result, _ := p.paramList() - sig := types.NewSignature(nil, params, result, isddd) - p.declare(types.NewFunc(pos, pkg, name, sig)) - - default: - errorf("unexpected object tag %d", tag) - } -} - const deltaNewFile = -64 // see cmd/compile/internal/gc/bexport.go -func (p *importer) pos() token.Pos { - if !p.posInfoFormat { - return token.NoPos - } - - file := p.prevFile - line := p.prevLine - delta := p.int() - line += delta - if p.version >= 5 { - if delta == deltaNewFile { - if n := p.int(); n >= 0 { - // file changed - file = p.path() - line = n - } - } - } else { - if delta == 0 { - if n := p.int(); n >= 0 { - // file changed - file = p.prevFile[:n] + p.string() - line = p.int() - } - } - } - p.prevFile = file - p.prevLine = line - - return p.fake.pos(file, line, 0) -} - // Synthesize a token.Pos type fakeFileSet struct { fset *token.FileSet @@ -389,205 +73,6 @@ var ( fakeLinesOnce sync.Once ) -func (p *importer) qualifiedName() (pkg *types.Package, name string) { - name = p.string() - pkg = p.pkg() - return -} - -func (p *importer) record(t types.Type) { - p.typList = append(p.typList, t) -} - -// A dddSlice is a types.Type representing ...T parameters. -// It only appears for parameter types and does not escape -// the importer. -type dddSlice struct { - elem types.Type -} - -func (t *dddSlice) Underlying() types.Type { return t } -func (t *dddSlice) String() string { return "..." + t.elem.String() } - -// parent is the package which declared the type; parent == nil means -// the package currently imported. The parent package is needed for -// exported struct fields and interface methods which don't contain -// explicit package information in the export data. -// -// A non-nil tname is used as the "owner" of the result type; i.e., -// the result type is the underlying type of tname. tname is used -// to give interface methods a named receiver type where possible. -func (p *importer) typ(parent *types.Package, tname *types.Named) types.Type { - // if the type was seen before, i is its index (>= 0) - i := p.tagOrIndex() - if i >= 0 { - return p.typList[i] - } - - // otherwise, i is the type tag (< 0) - switch i { - case namedTag: - // read type object - pos := p.pos() - parent, name := p.qualifiedName() - scope := parent.Scope() - obj := scope.Lookup(name) - - // if the object doesn't exist yet, create and insert it - if obj == nil { - obj = types.NewTypeName(pos, parent, name, nil) - scope.Insert(obj) - } - - if _, ok := obj.(*types.TypeName); !ok { - errorf("pkg = %s, name = %s => %s", parent, name, obj) - } - - // associate new named type with obj if it doesn't exist yet - t0 := types.NewNamed(obj.(*types.TypeName), nil, nil) - - // but record the existing type, if any - tname := obj.Type().(*types.Named) // tname is either t0 or the existing type - p.record(tname) - - // read underlying type - t0.SetUnderlying(p.typ(parent, t0)) - - // interfaces don't have associated methods - if types.IsInterface(t0) { - return tname - } - - // read associated methods - for i := p.int(); i > 0; i-- { - // TODO(gri) replace this with something closer to fieldName - pos := p.pos() - name := p.string() - if !exported(name) { - p.pkg() - } - - recv, _ := p.paramList() // TODO(gri) do we need a full param list for the receiver? - params, isddd := p.paramList() - result, _ := p.paramList() - p.int() // go:nointerface pragma - discarded - - sig := types.NewSignature(recv.At(0), params, result, isddd) - t0.AddMethod(types.NewFunc(pos, parent, name, sig)) - } - - return tname - - case arrayTag: - t := new(types.Array) - if p.trackAllTypes { - p.record(t) - } - - n := p.int64() - *t = *types.NewArray(p.typ(parent, nil), n) - return t - - case sliceTag: - t := new(types.Slice) - if p.trackAllTypes { - p.record(t) - } - - *t = *types.NewSlice(p.typ(parent, nil)) - return t - - case dddTag: - t := new(dddSlice) - if p.trackAllTypes { - p.record(t) - } - - t.elem = p.typ(parent, nil) - return t - - case structTag: - t := new(types.Struct) - if p.trackAllTypes { - p.record(t) - } - - *t = *types.NewStruct(p.fieldList(parent)) - return t - - case pointerTag: - t := new(types.Pointer) - if p.trackAllTypes { - p.record(t) - } - - *t = *types.NewPointer(p.typ(parent, nil)) - return t - - case signatureTag: - t := new(types.Signature) - if p.trackAllTypes { - p.record(t) - } - - params, isddd := p.paramList() - result, _ := p.paramList() - *t = *types.NewSignature(nil, params, result, isddd) - return t - - case interfaceTag: - // Create a dummy entry in the type list. This is safe because we - // cannot expect the interface type to appear in a cycle, as any - // such cycle must contain a named type which would have been - // first defined earlier. - // TODO(gri) Is this still true now that we have type aliases? - // See issue #23225. - n := len(p.typList) - if p.trackAllTypes { - p.record(nil) - } - - var embeddeds []types.Type - for n := p.int(); n > 0; n-- { - p.pos() - embeddeds = append(embeddeds, p.typ(parent, nil)) - } - - t := newInterface(p.methodList(parent, tname), embeddeds) - p.interfaceList = append(p.interfaceList, t) - if p.trackAllTypes { - p.typList[n] = t - } - return t - - case mapTag: - t := new(types.Map) - if p.trackAllTypes { - p.record(t) - } - - key := p.typ(parent, nil) - val := p.typ(parent, nil) - *t = *types.NewMap(key, val) - return t - - case chanTag: - t := new(types.Chan) - if p.trackAllTypes { - p.record(t) - } - - dir := chanDir(p.int()) - val := p.typ(parent, nil) - *t = *types.NewChan(dir, val) - return t - - default: - errorf("unexpected type tag %d", i) // panics - panic("unreachable") - } -} - func chanDir(d int) types.ChanDir { // tag values must match the constants in cmd/compile/internal/gc/go.go switch d { @@ -603,394 +88,6 @@ func chanDir(d int) types.ChanDir { } } -func (p *importer) fieldList(parent *types.Package) (fields []*types.Var, tags []string) { - if n := p.int(); n > 0 { - fields = make([]*types.Var, n) - tags = make([]string, n) - for i := range fields { - fields[i], tags[i] = p.field(parent) - } - } - return -} - -func (p *importer) field(parent *types.Package) (*types.Var, string) { - pos := p.pos() - pkg, name, alias := p.fieldName(parent) - typ := p.typ(parent, nil) - tag := p.string() - - anonymous := false - if name == "" { - // anonymous field - typ must be T or *T and T must be a type name - switch typ := deref(typ).(type) { - case *types.Basic: // basic types are named types - pkg = nil // // objects defined in Universe scope have no package - name = typ.Name() - case *types.Named: - name = typ.Obj().Name() - default: - errorf("named base type expected") - } - anonymous = true - } else if alias { - // anonymous field: we have an explicit name because it's an alias - anonymous = true - } - - return types.NewField(pos, pkg, name, typ, anonymous), tag -} - -func (p *importer) methodList(parent *types.Package, baseType *types.Named) (methods []*types.Func) { - if n := p.int(); n > 0 { - methods = make([]*types.Func, n) - for i := range methods { - methods[i] = p.method(parent, baseType) - } - } - return -} - -func (p *importer) method(parent *types.Package, baseType *types.Named) *types.Func { - pos := p.pos() - pkg, name, _ := p.fieldName(parent) - // If we don't have a baseType, use a nil receiver. - // A receiver using the actual interface type (which - // we don't know yet) will be filled in when we call - // types.Interface.Complete. - var recv *types.Var - if baseType != nil { - recv = types.NewVar(token.NoPos, parent, "", baseType) - } - params, isddd := p.paramList() - result, _ := p.paramList() - sig := types.NewSignature(recv, params, result, isddd) - return types.NewFunc(pos, pkg, name, sig) -} - -func (p *importer) fieldName(parent *types.Package) (pkg *types.Package, name string, alias bool) { - name = p.string() - pkg = parent - if pkg == nil { - // use the imported package instead - pkg = p.pkgList[0] - } - if p.version == 0 && name == "_" { - // version 0 didn't export a package for _ fields - return - } - switch name { - case "": - // 1) field name matches base type name and is exported: nothing to do - case "?": - // 2) field name matches base type name and is not exported: need package - name = "" - pkg = p.pkg() - case "@": - // 3) field name doesn't match type name (alias) - name = p.string() - alias = true - fallthrough - default: - if !exported(name) { - pkg = p.pkg() - } - } - return -} - -func (p *importer) paramList() (*types.Tuple, bool) { - n := p.int() - if n == 0 { - return nil, false - } - // negative length indicates unnamed parameters - named := true - if n < 0 { - n = -n - named = false - } - // n > 0 - params := make([]*types.Var, n) - isddd := false - for i := range params { - params[i], isddd = p.param(named) - } - return types.NewTuple(params...), isddd -} - -func (p *importer) param(named bool) (*types.Var, bool) { - t := p.typ(nil, nil) - td, isddd := t.(*dddSlice) - if isddd { - t = types.NewSlice(td.elem) - } - - var pkg *types.Package - var name string - if named { - name = p.string() - if name == "" { - errorf("expected named parameter") - } - if name != "_" { - pkg = p.pkg() - } - if i := strings.Index(name, "·"); i > 0 { - name = name[:i] // cut off gc-specific parameter numbering - } - } - - // read and discard compiler-specific info - p.string() - - return types.NewVar(token.NoPos, pkg, name, t), isddd -} - -func exported(name string) bool { - ch, _ := utf8.DecodeRuneInString(name) - return unicode.IsUpper(ch) -} - -func (p *importer) value() constant.Value { - switch tag := p.tagOrIndex(); tag { - case falseTag: - return constant.MakeBool(false) - case trueTag: - return constant.MakeBool(true) - case int64Tag: - return constant.MakeInt64(p.int64()) - case floatTag: - return p.float() - case complexTag: - re := p.float() - im := p.float() - return constant.BinaryOp(re, token.ADD, constant.MakeImag(im)) - case stringTag: - return constant.MakeString(p.string()) - case unknownTag: - return constant.MakeUnknown() - default: - errorf("unexpected value tag %d", tag) // panics - panic("unreachable") - } -} - -func (p *importer) float() constant.Value { - sign := p.int() - if sign == 0 { - return constant.MakeInt64(0) - } - - exp := p.int() - mant := []byte(p.string()) // big endian - - // remove leading 0's if any - for len(mant) > 0 && mant[0] == 0 { - mant = mant[1:] - } - - // convert to little endian - // TODO(gri) go/constant should have a more direct conversion function - // (e.g., once it supports a big.Float based implementation) - for i, j := 0, len(mant)-1; i < j; i, j = i+1, j-1 { - mant[i], mant[j] = mant[j], mant[i] - } - - // adjust exponent (constant.MakeFromBytes creates an integer value, - // but mant represents the mantissa bits such that 0.5 <= mant < 1.0) - exp -= len(mant) << 3 - if len(mant) > 0 { - for msd := mant[len(mant)-1]; msd&0x80 == 0; msd <<= 1 { - exp++ - } - } - - x := constant.MakeFromBytes(mant) - switch { - case exp < 0: - d := constant.Shift(constant.MakeInt64(1), token.SHL, uint(-exp)) - x = constant.BinaryOp(x, token.QUO, d) - case exp > 0: - x = constant.Shift(x, token.SHL, uint(exp)) - } - - if sign < 0 { - x = constant.UnaryOp(token.SUB, x, 0) - } - return x -} - -// ---------------------------------------------------------------------------- -// Low-level decoders - -func (p *importer) tagOrIndex() int { - if p.debugFormat { - p.marker('t') - } - - return int(p.rawInt64()) -} - -func (p *importer) int() int { - x := p.int64() - if int64(int(x)) != x { - errorf("exported integer too large") - } - return int(x) -} - -func (p *importer) int64() int64 { - if p.debugFormat { - p.marker('i') - } - - return p.rawInt64() -} - -func (p *importer) path() string { - if p.debugFormat { - p.marker('p') - } - // if the path was seen before, i is its index (>= 0) - // (the empty string is at index 0) - i := p.rawInt64() - if i >= 0 { - return p.pathList[i] - } - // otherwise, i is the negative path length (< 0) - a := make([]string, -i) - for n := range a { - a[n] = p.string() - } - s := strings.Join(a, "/") - p.pathList = append(p.pathList, s) - return s -} - -func (p *importer) string() string { - if p.debugFormat { - p.marker('s') - } - // if the string was seen before, i is its index (>= 0) - // (the empty string is at index 0) - i := p.rawInt64() - if i >= 0 { - return p.strList[i] - } - // otherwise, i is the negative string length (< 0) - if n := int(-i); n <= cap(p.buf) { - p.buf = p.buf[:n] - } else { - p.buf = make([]byte, n) - } - for i := range p.buf { - p.buf[i] = p.rawByte() - } - s := string(p.buf) - p.strList = append(p.strList, s) - return s -} - -func (p *importer) marker(want byte) { - if got := p.rawByte(); got != want { - errorf("incorrect marker: got %c; want %c (pos = %d)", got, want, p.read) - } - - pos := p.read - if n := int(p.rawInt64()); n != pos { - errorf("incorrect position: got %d; want %d", n, pos) - } -} - -// rawInt64 should only be used by low-level decoders. -func (p *importer) rawInt64() int64 { - i, err := binary.ReadVarint(p) - if err != nil { - errorf("read error: %v", err) - } - return i -} - -// rawStringln should only be used to read the initial version string. -func (p *importer) rawStringln(b byte) string { - p.buf = p.buf[:0] - for b != '\n' { - p.buf = append(p.buf, b) - b = p.rawByte() - } - return string(p.buf) -} - -// needed for binary.ReadVarint in rawInt64 -func (p *importer) ReadByte() (byte, error) { - return p.rawByte(), nil -} - -// byte is the bottleneck interface for reading p.data. -// It unescapes '|' 'S' to '$' and '|' '|' to '|'. -// rawByte should only be used by low-level decoders. -func (p *importer) rawByte() byte { - b := p.data[0] - r := 1 - if b == '|' { - b = p.data[1] - r = 2 - switch b { - case 'S': - b = '$' - case '|': - // nothing to do - default: - errorf("unexpected escape sequence in export data") - } - } - p.data = p.data[r:] - p.read += r - return b - -} - -// ---------------------------------------------------------------------------- -// Export format - -// Tags. Must be < 0. -const ( - // Objects - packageTag = -(iota + 1) - constTag - typeTag - varTag - funcTag - endTag - - // Types - namedTag - arrayTag - sliceTag - dddTag - structTag - pointerTag - signatureTag - interfaceTag - mapTag - chanTag - - // Values - falseTag - trueTag - int64Tag - floatTag - fractionTag // not used by gc - complexTag - stringTag - nilTag // only used by gc (appears in exported inlined function bodies) - unknownTag // not used by gc (only appears in packages with errors) - - // Type aliases - aliasTag -) - var predeclOnce sync.Once var predecl []types.Type // initialized lazily diff --git a/vendor/golang.org/x/tools/internal/gcimporter/gcimporter.go b/vendor/golang.org/x/tools/internal/gcimporter/gcimporter.go index a973dece..b1223713 100644 --- a/vendor/golang.org/x/tools/internal/gcimporter/gcimporter.go +++ b/vendor/golang.org/x/tools/internal/gcimporter/gcimporter.go @@ -230,20 +230,17 @@ func Import(packages map[string]*types.Package, path, srcDir string, lookup func // Or, define a new standard go/types/gcexportdata package. fset := token.NewFileSet() - // The indexed export format starts with an 'i'; the older - // binary export format starts with a 'c', 'd', or 'v' - // (from "version"). Select appropriate importer. + // Select appropriate importer. if len(data) > 0 { switch data[0] { - case 'i': + case 'v', 'c', 'd': // binary, till go1.10 + return nil, fmt.Errorf("binary (%c) import format is no longer supported", data[0]) + + case 'i': // indexed, till go1.19 _, pkg, err := IImportData(fset, packages, data[1:], id) return pkg, err - case 'v', 'c', 'd': - _, pkg, err := BImportData(fset, packages, data, id) - return pkg, err - - case 'u': + case 'u': // unified, from go1.20 _, pkg, err := UImportData(fset, packages, data[1:size], id) return pkg, err diff --git a/vendor/golang.org/x/tools/internal/gcimporter/iexport.go b/vendor/golang.org/x/tools/internal/gcimporter/iexport.go index a0dc0b5e..3fc7989c 100644 --- a/vendor/golang.org/x/tools/internal/gcimporter/iexport.go +++ b/vendor/golang.org/x/tools/internal/gcimporter/iexport.go @@ -913,6 +913,17 @@ func (w *exportWriter) value(typ types.Type, v constant.Value) { w.int64(int64(v.Kind())) } + if v.Kind() == constant.Unknown { + // golang/go#60605: treat unknown constant values as if they have invalid type + // + // This loses some fidelity over the package type-checked from source, but that + // is acceptable. + // + // TODO(rfindley): we should switch on the recorded constant kind rather + // than the constant type + return + } + switch b := typ.Underlying().(*types.Basic); b.Info() & types.IsConstType { case types.IsBoolean: w.bool(constant.BoolVal(v)) @@ -969,6 +980,16 @@ func constantToFloat(x constant.Value) *big.Float { return &f } +func valueToRat(x constant.Value) *big.Rat { + // Convert little-endian to big-endian. + // I can't believe this is necessary. + bytes := constant.Bytes(x) + for i := 0; i < len(bytes)/2; i++ { + bytes[i], bytes[len(bytes)-1-i] = bytes[len(bytes)-1-i], bytes[i] + } + return new(big.Rat).SetInt(new(big.Int).SetBytes(bytes)) +} + // mpint exports a multi-precision integer. // // For unsigned types, small values are written out as a single @@ -1178,3 +1199,12 @@ func (q *objQueue) popHead() types.Object { q.head++ return obj } + +// internalError represents an error generated inside this package. +type internalError string + +func (e internalError) Error() string { return "gcimporter: " + string(e) } + +func internalErrorf(format string, args ...interface{}) error { + return internalError(fmt.Sprintf(format, args...)) +} diff --git a/vendor/golang.org/x/tools/internal/gcimporter/iimport.go b/vendor/golang.org/x/tools/internal/gcimporter/iimport.go index be6dace1..94a5eba3 100644 --- a/vendor/golang.org/x/tools/internal/gcimporter/iimport.go +++ b/vendor/golang.org/x/tools/internal/gcimporter/iimport.go @@ -131,7 +131,7 @@ func iimportCommon(fset *token.FileSet, getPackage GetPackageFunc, data []byte, } else if version > currentVersion { err = fmt.Errorf("cannot import %q (%v), export data is newer version - update tool", path, e) } else { - err = fmt.Errorf("cannot import %q (%v), possibly version skew - reinstall package", path, e) + err = fmt.Errorf("internal error while importing %q (%v); please report an issue", path, e) } } }() @@ -140,11 +140,8 @@ func iimportCommon(fset *token.FileSet, getPackage GetPackageFunc, data []byte, r := &intReader{bytes.NewReader(data), path} if bundle { - bundleVersion := r.uint64() - switch bundleVersion { - case bundleVersion: - default: - errorf("unknown bundle format version %d", bundleVersion) + if v := r.uint64(); v != bundleVersion { + errorf("unknown bundle format version %d", v) } } diff --git a/vendor/golang.org/x/tools/internal/gcimporter/ureader_yes.go b/vendor/golang.org/x/tools/internal/gcimporter/ureader_yes.go index 34fc783f..b977435f 100644 --- a/vendor/golang.org/x/tools/internal/gcimporter/ureader_yes.go +++ b/vendor/golang.org/x/tools/internal/gcimporter/ureader_yes.go @@ -10,6 +10,7 @@ package gcimporter import ( + "fmt" "go/token" "go/types" "sort" @@ -63,6 +64,14 @@ type typeInfo struct { } func UImportData(fset *token.FileSet, imports map[string]*types.Package, data []byte, path string) (_ int, pkg *types.Package, err error) { + if !debug { + defer func() { + if x := recover(); x != nil { + err = fmt.Errorf("internal error in importing %q (%v); please report an issue", path, x) + } + }() + } + s := string(data) s = s[:strings.LastIndex(s, "\n$$\n")] input := pkgbits.NewPkgDecoder(path, s) diff --git a/vendor/golang.org/x/tools/internal/gocommand/invoke.go b/vendor/golang.org/x/tools/internal/gocommand/invoke.go index 3c0afe72..8d9fc98d 100644 --- a/vendor/golang.org/x/tools/internal/gocommand/invoke.go +++ b/vendor/golang.org/x/tools/internal/gocommand/invoke.go @@ -24,6 +24,9 @@ import ( exec "golang.org/x/sys/execabs" "golang.org/x/tools/internal/event" + "golang.org/x/tools/internal/event/keys" + "golang.org/x/tools/internal/event/label" + "golang.org/x/tools/internal/event/tag" ) // An Runner will run go command invocations and serialize @@ -53,9 +56,19 @@ func (runner *Runner) initialize() { // 1.14: go: updating go.mod: existing contents have changed since last read var modConcurrencyError = regexp.MustCompile(`go:.*go.mod.*contents have changed`) +// verb is an event label for the go command verb. +var verb = keys.NewString("verb", "go command verb") + +func invLabels(inv Invocation) []label.Label { + return []label.Label{verb.Of(inv.Verb), tag.Directory.Of(inv.WorkingDir)} +} + // Run is a convenience wrapper around RunRaw. // It returns only stdout and a "friendly" error. func (runner *Runner) Run(ctx context.Context, inv Invocation) (*bytes.Buffer, error) { + ctx, done := event.Start(ctx, "gocommand.Runner.Run", invLabels(inv)...) + defer done() + stdout, _, friendly, _ := runner.RunRaw(ctx, inv) return stdout, friendly } @@ -63,6 +76,9 @@ func (runner *Runner) Run(ctx context.Context, inv Invocation) (*bytes.Buffer, e // RunPiped runs the invocation serially, always waiting for any concurrent // invocations to complete first. func (runner *Runner) RunPiped(ctx context.Context, inv Invocation, stdout, stderr io.Writer) error { + ctx, done := event.Start(ctx, "gocommand.Runner.RunPiped", invLabels(inv)...) + defer done() + _, err := runner.runPiped(ctx, inv, stdout, stderr) return err } @@ -70,6 +86,8 @@ func (runner *Runner) RunPiped(ctx context.Context, inv Invocation, stdout, stde // RunRaw runs the invocation, serializing requests only if they fight over // go.mod changes. func (runner *Runner) RunRaw(ctx context.Context, inv Invocation) (*bytes.Buffer, *bytes.Buffer, error, error) { + ctx, done := event.Start(ctx, "gocommand.Runner.RunRaw", invLabels(inv)...) + defer done() // Make sure the runner is always initialized. runner.initialize() diff --git a/vendor/golang.org/x/tools/internal/imports/fix.go b/vendor/golang.org/x/tools/internal/imports/fix.go index 6b493525..d4f1b4e8 100644 --- a/vendor/golang.org/x/tools/internal/imports/fix.go +++ b/vendor/golang.org/x/tools/internal/imports/fix.go @@ -26,6 +26,7 @@ import ( "unicode/utf8" "golang.org/x/tools/go/ast/astutil" + "golang.org/x/tools/internal/event" "golang.org/x/tools/internal/gocommand" "golang.org/x/tools/internal/gopathwalk" ) @@ -543,7 +544,7 @@ func (p *pass) addCandidate(imp *ImportInfo, pkg *packageInfo) { var fixImports = fixImportsDefault func fixImportsDefault(fset *token.FileSet, f *ast.File, filename string, env *ProcessEnv) error { - fixes, err := getFixes(fset, f, filename, env) + fixes, err := getFixes(context.Background(), fset, f, filename, env) if err != nil { return err } @@ -553,7 +554,7 @@ func fixImportsDefault(fset *token.FileSet, f *ast.File, filename string, env *P // getFixes gets the import fixes that need to be made to f in order to fix the imports. // It does not modify the ast. -func getFixes(fset *token.FileSet, f *ast.File, filename string, env *ProcessEnv) ([]*ImportFix, error) { +func getFixes(ctx context.Context, fset *token.FileSet, f *ast.File, filename string, env *ProcessEnv) ([]*ImportFix, error) { abs, err := filepath.Abs(filename) if err != nil { return nil, err @@ -607,7 +608,7 @@ func getFixes(fset *token.FileSet, f *ast.File, filename string, env *ProcessEnv // Go look for candidates in $GOPATH, etc. We don't necessarily load // the real exports of sibling imports, so keep assuming their contents. - if err := addExternalCandidates(p, p.missingRefs, filename); err != nil { + if err := addExternalCandidates(ctx, p, p.missingRefs, filename); err != nil { return nil, err } @@ -1055,7 +1056,10 @@ type scanCallback struct { exportsLoaded func(pkg *pkg, exports []string) } -func addExternalCandidates(pass *pass, refs references, filename string) error { +func addExternalCandidates(ctx context.Context, pass *pass, refs references, filename string) error { + ctx, done := event.Start(ctx, "imports.addExternalCandidates") + defer done() + var mu sync.Mutex found := make(map[string][]pkgDistance) callback := &scanCallback{ diff --git a/vendor/golang.org/x/tools/internal/imports/imports.go b/vendor/golang.org/x/tools/internal/imports/imports.go index 95a88383..58e637b9 100644 --- a/vendor/golang.org/x/tools/internal/imports/imports.go +++ b/vendor/golang.org/x/tools/internal/imports/imports.go @@ -11,6 +11,7 @@ package imports import ( "bufio" "bytes" + "context" "fmt" "go/ast" "go/format" @@ -23,6 +24,7 @@ import ( "strings" "golang.org/x/tools/go/ast/astutil" + "golang.org/x/tools/internal/event" ) // Options is golang.org/x/tools/imports.Options with extra internal-only options. @@ -66,14 +68,17 @@ func Process(filename string, src []byte, opt *Options) (formatted []byte, err e // // Note that filename's directory influences which imports can be chosen, // so it is important that filename be accurate. -func FixImports(filename string, src []byte, opt *Options) (fixes []*ImportFix, err error) { +func FixImports(ctx context.Context, filename string, src []byte, opt *Options) (fixes []*ImportFix, err error) { + ctx, done := event.Start(ctx, "imports.FixImports") + defer done() + fileSet := token.NewFileSet() file, _, err := parse(fileSet, filename, src, opt) if err != nil { return nil, err } - return getFixes(fileSet, file, filename, opt.Env) + return getFixes(ctx, fileSet, file, filename, opt.Env) } // ApplyFixes applies all of the fixes to the file and formats it. extraMode diff --git a/vendor/golang.org/x/tools/internal/imports/mod.go b/vendor/golang.org/x/tools/internal/imports/mod.go index 7d99d04c..977d2389 100644 --- a/vendor/golang.org/x/tools/internal/imports/mod.go +++ b/vendor/golang.org/x/tools/internal/imports/mod.go @@ -19,6 +19,7 @@ import ( "strings" "golang.org/x/mod/module" + "golang.org/x/tools/internal/event" "golang.org/x/tools/internal/gocommand" "golang.org/x/tools/internal/gopathwalk" ) @@ -37,7 +38,7 @@ type ModuleResolver struct { mains []*gocommand.ModuleJSON mainByDir map[string]*gocommand.ModuleJSON modsByModPath []*gocommand.ModuleJSON // All modules, ordered by # of path components in module Path... - modsByDir []*gocommand.ModuleJSON // ...or Dir. + modsByDir []*gocommand.ModuleJSON // ...or number of path components in their Dir. // moduleCacheCache stores information about the module cache. moduleCacheCache *dirInfoCache @@ -123,7 +124,7 @@ func (r *ModuleResolver) init() error { }) sort.Slice(r.modsByDir, func(i, j int) bool { count := func(x int) int { - return strings.Count(r.modsByDir[x].Dir, "/") + return strings.Count(r.modsByDir[x].Dir, string(filepath.Separator)) } return count(j) < count(i) // descending order }) @@ -327,6 +328,10 @@ func (r *ModuleResolver) findModuleByDir(dir string) *gocommand.ModuleJSON { // - in /vendor/ in -mod=vendor mode. // - nested module? Dunno. // Rumor has it that replace targets cannot contain other replace targets. + // + // Note that it is critical here that modsByDir is sorted to have deeper dirs + // first. This ensures that findModuleByDir finds the innermost module. + // See also golang/go#56291. for _, m := range r.modsByDir { if !strings.HasPrefix(dir, m.Dir) { continue @@ -424,6 +429,9 @@ func (r *ModuleResolver) loadPackageNames(importPaths []string, srcDir string) ( } func (r *ModuleResolver) scan(ctx context.Context, callback *scanCallback) error { + ctx, done := event.Start(ctx, "imports.ModuleResolver.scan") + defer done() + if err := r.init(); err != nil { return err } diff --git a/vendor/golang.org/x/tools/internal/typeparams/common.go b/vendor/golang.org/x/tools/internal/typeparams/common.go index cfba8189..b9e87c69 100644 --- a/vendor/golang.org/x/tools/internal/typeparams/common.go +++ b/vendor/golang.org/x/tools/internal/typeparams/common.go @@ -105,6 +105,26 @@ func OriginMethod(fn *types.Func) *types.Func { } orig := NamedTypeOrigin(named) gfn, _, _ := types.LookupFieldOrMethod(orig, true, fn.Pkg(), fn.Name()) + + // This is a fix for a gopls crash (#60628) due to a go/types bug (#60634). In: + // package p + // type T *int + // func (*T) f() {} + // LookupFieldOrMethod(T, true, p, f)=nil, but NewMethodSet(*T)={(*T).f}. + // Here we make them consistent by force. + // (The go/types bug is general, but this workaround is reached only + // for generic T thanks to the early return above.) + if gfn == nil { + mset := types.NewMethodSet(types.NewPointer(orig)) + for i := 0; i < mset.Len(); i++ { + m := mset.At(i) + if m.Obj().Id() == fn.Id() { + gfn = m.Obj() + break + } + } + } + return gfn.(*types.Func) } diff --git a/vendor/golang.org/x/tools/internal/typesinternal/types.go b/vendor/golang.org/x/tools/internal/typesinternal/types.go index 3c53fbc6..ce7d4351 100644 --- a/vendor/golang.org/x/tools/internal/typesinternal/types.go +++ b/vendor/golang.org/x/tools/internal/typesinternal/types.go @@ -11,8 +11,6 @@ import ( "go/types" "reflect" "unsafe" - - "golang.org/x/tools/go/types/objectpath" ) func SetUsesCgo(conf *types.Config) bool { @@ -52,10 +50,3 @@ func ReadGo116ErrorData(err types.Error) (code ErrorCode, start, end token.Pos, } var SetGoVersion = func(conf *types.Config, version string) bool { return false } - -// NewObjectpathEncoder returns a function closure equivalent to -// objectpath.For but amortized for multiple (sequential) calls. -// It is a temporary workaround, pending the approval of proposal 58668. -// -//go:linkname NewObjectpathFunc golang.org/x/tools/go/types/objectpath.newEncoderFor -func NewObjectpathFunc() func(types.Object) (objectpath.Path, error) diff --git a/vendor/modules.txt b/vendor/modules.txt index a6a82123..39e94c85 100644 --- a/vendor/modules.txt +++ b/vendor/modules.txt @@ -1,4 +1,4 @@ -# github.com/99designs/gqlgen v0.17.31 +# github.com/99designs/gqlgen v0.17.33 ## explicit; go 1.18 github.com/99designs/gqlgen github.com/99designs/gqlgen/api @@ -33,7 +33,7 @@ github.com/KyleBanks/depth # github.com/Masterminds/semver/v3 v3.2.1 ## explicit; go 1.18 github.com/Masterminds/semver/v3 -# github.com/adhocore/gronx v1.1.2 +# github.com/adhocore/gronx v1.6.3 ## explicit; go 1.13 github.com/adhocore/gronx # github.com/agnivade/levenshtein v1.1.1 @@ -54,10 +54,10 @@ github.com/beorn7/perks/quantile # github.com/boltdb/bolt v1.3.1 ## explicit github.com/boltdb/bolt -# github.com/caddyserver/certmagic v0.17.2 -## explicit; go 1.18 +# github.com/caddyserver/certmagic v0.18.0 +## explicit; go 1.19 github.com/caddyserver/certmagic -# github.com/casbin/casbin/v2 v2.69.1 +# github.com/casbin/casbin/v2 v2.71.0 ## explicit; go 1.13 github.com/casbin/casbin/v2 github.com/casbin/casbin/v2/config @@ -82,7 +82,7 @@ github.com/cpuguy83/go-md2man/v2/md2man ## explicit; go 1.18 github.com/datarhei/core-client-go/v16 github.com/datarhei/core-client-go/v16/api -# github.com/datarhei/gosrt v0.4.1 +# github.com/datarhei/gosrt v0.5.0 ## explicit; go 1.18 github.com/datarhei/gosrt github.com/datarhei/gosrt/internal/circular @@ -145,7 +145,7 @@ github.com/go-openapi/jsonreference/internal # github.com/go-openapi/spec v0.20.9 ## explicit; go 1.13 github.com/go-openapi/spec -# github.com/go-openapi/swag v0.22.3 +# github.com/go-openapi/swag v0.22.4 ## explicit; go 1.18 github.com/go-openapi/swag # github.com/go-playground/locales v0.14.1 @@ -155,7 +155,7 @@ github.com/go-playground/locales/currency # github.com/go-playground/universal-translator v0.18.1 ## explicit; go 1.18 github.com/go-playground/universal-translator -# github.com/go-playground/validator/v10 v10.14.0 +# github.com/go-playground/validator/v10 v10.14.1 ## explicit; go 1.18 github.com/go-playground/validator/v10 # github.com/gobwas/glob v0.2.3 @@ -195,7 +195,7 @@ github.com/hashicorp/go-msgpack/codec # github.com/hashicorp/golang-lru v0.5.4 ## explicit; go 1.12 github.com/hashicorp/golang-lru/simplelru -# github.com/hashicorp/golang-lru/v2 v2.0.2 +# github.com/hashicorp/golang-lru/v2 v2.0.3 ## explicit; go 1.18 github.com/hashicorp/golang-lru/v2 github.com/hashicorp/golang-lru/v2/simplelru @@ -221,10 +221,10 @@ github.com/josharian/intern # github.com/json-iterator/go v1.1.12 ## explicit; go 1.12 github.com/json-iterator/go -# github.com/klauspost/compress v1.16.5 +# github.com/klauspost/compress v1.16.6 ## explicit; go 1.18 github.com/klauspost/compress/s2 -# github.com/klauspost/cpuid/v2 v2.2.4 +# github.com/klauspost/cpuid/v2 v2.2.5 ## explicit; go 1.15 github.com/klauspost/cpuid/v2 # github.com/labstack/echo/v4 v4.10.2 @@ -277,7 +277,7 @@ github.com/miekg/dns # github.com/minio/md5-simd v1.1.2 ## explicit; go 1.14 github.com/minio/md5-simd -# github.com/minio/minio-go/v7 v7.0.55 +# github.com/minio/minio-go/v7 v7.0.57 ## explicit; go 1.17 github.com/minio/minio-go/v7 github.com/minio/minio-go/v7/pkg/credentials @@ -314,7 +314,7 @@ github.com/power-devops/perfstat # github.com/prep/average v0.0.0-20200506183628-d26c465f48c3 ## explicit github.com/prep/average -# github.com/prometheus/client_golang v1.15.1 +# github.com/prometheus/client_golang v1.16.0 ## explicit; go 1.17 github.com/prometheus/client_golang/prometheus github.com/prometheus/client_golang/prometheus/internal @@ -338,7 +338,7 @@ github.com/rs/xid # github.com/russross/blackfriday/v2 v2.1.0 ## explicit github.com/russross/blackfriday/v2 -# github.com/shirou/gopsutil/v3 v3.23.4 +# github.com/shirou/gopsutil/v3 v3.23.5 ## explicit; go 1.15 github.com/shirou/gopsutil/v3/cpu github.com/shirou/gopsutil/v3/disk @@ -349,7 +349,7 @@ github.com/shirou/gopsutil/v3/process # github.com/shoenig/go-m1cpu v0.1.6 ## explicit; go 1.20 github.com/shoenig/go-m1cpu -# github.com/sirupsen/logrus v1.9.2 +# github.com/sirupsen/logrus v1.9.3 ## explicit; go 1.13 github.com/sirupsen/logrus # github.com/stretchr/testify v1.8.4 @@ -368,10 +368,10 @@ github.com/swaggo/swag # github.com/tklauser/go-sysconf v0.3.11 ## explicit; go 1.13 github.com/tklauser/go-sysconf -# github.com/tklauser/numcpus v0.6.0 +# github.com/tklauser/numcpus v0.6.1 ## explicit; go 1.13 github.com/tklauser/numcpus -# github.com/urfave/cli/v2 v2.24.4 +# github.com/urfave/cli/v2 v2.25.5 ## explicit; go 1.18 github.com/urfave/cli/v2 # github.com/valyala/bytebufferpool v1.0.0 @@ -380,7 +380,7 @@ github.com/valyala/bytebufferpool # github.com/valyala/fasttemplate v1.2.2 ## explicit; go 1.12 github.com/valyala/fasttemplate -# github.com/vektah/gqlparser/v2 v2.5.1 +# github.com/vektah/gqlparser/v2 v2.5.3 ## explicit; go 1.16 github.com/vektah/gqlparser/v2 github.com/vektah/gqlparser/v2/ast @@ -429,7 +429,7 @@ go.uber.org/zap/internal/bufferpool go.uber.org/zap/internal/color go.uber.org/zap/internal/exit go.uber.org/zap/zapcore -# golang.org/x/crypto v0.9.0 +# golang.org/x/crypto v0.10.0 ## explicit; go 1.17 golang.org/x/crypto/acme golang.org/x/crypto/acme/autocert @@ -440,12 +440,12 @@ golang.org/x/crypto/cryptobyte/asn1 golang.org/x/crypto/ocsp golang.org/x/crypto/pbkdf2 golang.org/x/crypto/sha3 -# golang.org/x/mod v0.10.0 +# golang.org/x/mod v0.11.0 ## explicit; go 1.17 golang.org/x/mod/internal/lazyregexp golang.org/x/mod/module golang.org/x/mod/semver -# golang.org/x/net v0.10.0 +# golang.org/x/net v0.11.0 ## explicit; go 1.17 golang.org/x/net/bpf golang.org/x/net/html @@ -460,7 +460,7 @@ golang.org/x/net/internal/socket golang.org/x/net/ipv4 golang.org/x/net/ipv6 golang.org/x/net/publicsuffix -# golang.org/x/sys v0.8.0 +# golang.org/x/sys v0.9.0 ## explicit; go 1.17 golang.org/x/sys/cpu golang.org/x/sys/execabs @@ -468,7 +468,7 @@ golang.org/x/sys/internal/unsafeheader golang.org/x/sys/unix golang.org/x/sys/windows golang.org/x/sys/windows/registry -# golang.org/x/text v0.9.0 +# golang.org/x/text v0.10.0 ## explicit; go 1.17 golang.org/x/text/cases golang.org/x/text/internal @@ -483,7 +483,7 @@ golang.org/x/text/unicode/norm # golang.org/x/time v0.3.0 ## explicit golang.org/x/time/rate -# golang.org/x/tools v0.9.1 +# golang.org/x/tools v0.10.0 ## explicit; go 1.18 golang.org/x/tools/go/ast/astutil golang.org/x/tools/go/buildutil @@ -492,12 +492,12 @@ golang.org/x/tools/go/internal/cgo golang.org/x/tools/go/internal/packagesdriver golang.org/x/tools/go/loader golang.org/x/tools/go/packages -golang.org/x/tools/go/types/objectpath golang.org/x/tools/imports golang.org/x/tools/internal/event golang.org/x/tools/internal/event/core golang.org/x/tools/internal/event/keys golang.org/x/tools/internal/event/label +golang.org/x/tools/internal/event/tag golang.org/x/tools/internal/fastwalk golang.org/x/tools/internal/gcimporter golang.org/x/tools/internal/gocommand