diff --git a/go.mod b/go.mod index bd4bed8a..50d07e7f 100644 --- a/go.mod +++ b/go.mod @@ -5,48 +5,48 @@ go 1.22.5 toolchain go1.23.1 require ( - github.com/99designs/gqlgen v0.17.55 - github.com/Masterminds/semver/v3 v3.3.0 - github.com/adhocore/gronx v1.19.3 + github.com/99designs/gqlgen v0.17.63 + github.com/Masterminds/semver/v3 v3.3.1 + github.com/adhocore/gronx v1.19.5 github.com/andybalholm/brotli v1.1.1 github.com/atrox/haikunatorgo/v2 v2.0.1 - github.com/caddyserver/certmagic v0.21.4 - github.com/datarhei/gosrt v0.7.0 + github.com/caddyserver/certmagic v0.21.7 + github.com/datarhei/gosrt v0.8.0 github.com/datarhei/joy4 v0.0.0-20240603190808-b1407345907e github.com/dolthub/swiss v0.2.1 github.com/fujiwara/shapeio v1.0.0 - github.com/go-playground/validator/v10 v10.22.1 + github.com/go-playground/validator/v10 v10.24.0 github.com/gobwas/glob v0.2.3 - github.com/golang-jwt/jwt/v4 v4.5.0 + github.com/golang-jwt/jwt/v4 v4.5.1 github.com/golang-jwt/jwt/v5 v5.2.1 github.com/google/gops v0.3.28 github.com/google/uuid v1.6.0 github.com/hashicorp/go-hclog v1.6.3 - github.com/hashicorp/raft v1.7.1 - github.com/hashicorp/raft-boltdb/v2 v2.3.0 + github.com/hashicorp/raft v1.7.2 + github.com/hashicorp/raft-boltdb/v2 v2.3.1 github.com/invopop/jsonschema v0.4.0 github.com/joho/godotenv v1.5.1 github.com/klauspost/compress v1.17.11 - github.com/klauspost/cpuid/v2 v2.2.8 - github.com/labstack/echo/v4 v4.12.0 + github.com/klauspost/cpuid/v2 v2.2.9 + github.com/labstack/echo/v4 v4.13.3 github.com/lestrrat-go/strftime v1.1.0 - github.com/lithammer/shortuuid/v4 v4.0.0 + github.com/lithammer/shortuuid/v4 v4.2.0 github.com/mattn/go-isatty v0.0.20 - github.com/minio/minio-go/v7 v7.0.80 + github.com/minio/minio-go/v7 v7.0.84 github.com/prometheus/client_golang v1.20.5 - github.com/puzpuzpuz/xsync/v3 v3.4.0 + github.com/puzpuzpuz/xsync/v3 v3.4.1 github.com/shirou/gopsutil/v3 v3.24.5 - github.com/stretchr/testify v1.9.0 + github.com/stretchr/testify v1.10.0 github.com/swaggo/echo-swagger v1.4.1 github.com/swaggo/swag v1.16.4 github.com/tklauser/go-sysconf v0.3.14 - github.com/vektah/gqlparser/v2 v2.5.18 + github.com/vektah/gqlparser/v2 v2.5.21 github.com/xeipuuv/gojsonschema v1.2.0 go.etcd.io/bbolt v1.3.11 go.uber.org/automaxprocs v1.6.0 go.uber.org/zap v1.27.0 - golang.org/x/crypto v0.28.0 - golang.org/x/mod v0.21.0 + golang.org/x/crypto v0.32.0 + golang.org/x/mod v0.22.0 ) require ( @@ -58,12 +58,12 @@ require ( github.com/boltdb/bolt v1.3.1 // indirect github.com/caddyserver/zerossl v0.1.3 // indirect github.com/cespare/xxhash/v2 v2.3.0 // indirect - github.com/cpuguy83/go-md2man/v2 v2.0.4 // indirect + github.com/cpuguy83/go-md2man/v2 v2.0.5 // indirect github.com/davecgh/go-spew v1.1.1 // indirect github.com/dolthub/maphash v0.1.0 // indirect github.com/dustin/go-humanize v1.0.1 // indirect github.com/fatih/color v1.18.0 // indirect - github.com/gabriel-vasile/mimetype v1.4.6 // indirect + github.com/gabriel-vasile/mimetype v1.4.8 // indirect github.com/ghodss/yaml v1.0.0 // indirect github.com/go-ini/ini v1.67.0 // indirect github.com/go-ole/go-ole v1.3.0 // indirect @@ -73,10 +73,11 @@ require ( github.com/go-openapi/swag v0.23.0 // indirect github.com/go-playground/locales v0.14.1 // indirect github.com/go-playground/universal-translator v0.18.1 // indirect - github.com/goccy/go-json v0.10.3 // indirect - github.com/golang-jwt/jwt v3.2.2+incompatible // indirect + github.com/go-viper/mapstructure/v2 v2.2.1 // indirect + github.com/goccy/go-json v0.10.4 // indirect github.com/gorilla/websocket v1.5.3 // indirect github.com/hashicorp/go-immutable-radix v1.3.1 // indirect + github.com/hashicorp/go-metrics v0.5.4 // indirect github.com/hashicorp/go-msgpack/v2 v2.1.2 // indirect github.com/hashicorp/golang-lru v1.0.2 // indirect github.com/hashicorp/golang-lru/v2 v2.0.7 // indirect @@ -86,25 +87,24 @@ require ( github.com/leodido/go-urn v1.4.0 // indirect github.com/libdns/libdns v0.2.2 // indirect github.com/lufia/plan9stats v0.0.0-20240909124753-873cd0166683 // indirect - github.com/mailru/easyjson v0.7.7 // indirect - github.com/mattn/go-colorable v0.1.13 // indirect - github.com/mholt/acmez/v2 v2.0.3 // indirect + github.com/mailru/easyjson v0.9.0 // indirect + github.com/mattn/go-colorable v0.1.14 // indirect + github.com/mholt/acmez/v3 v3.0.1 // indirect github.com/miekg/dns v1.1.62 // indirect github.com/minio/md5-simd v1.1.2 // indirect - github.com/mitchellh/mapstructure v1.5.0 // indirect github.com/munnerz/goautoneg v0.0.0-20191010083416-a7dc8b61c822 // indirect github.com/pmezard/go-difflib v1.0.1-0.20181226105442-5d4384ee4fb2 // indirect github.com/power-devops/perfstat v0.0.0-20240221224432-82ca36839d55 // indirect github.com/prometheus/client_model v0.6.1 // indirect - github.com/prometheus/common v0.60.1 // indirect + github.com/prometheus/common v0.62.0 // indirect github.com/prometheus/procfs v0.15.1 // indirect github.com/rs/xid v1.6.0 // indirect github.com/russross/blackfriday/v2 v2.1.0 // indirect github.com/shoenig/go-m1cpu v0.1.6 // indirect github.com/sosodev/duration v1.3.1 // indirect - github.com/swaggo/files/v2 v2.0.1 // indirect + github.com/swaggo/files/v2 v2.0.2 // indirect github.com/tklauser/numcpus v0.9.0 // indirect - github.com/urfave/cli/v2 v2.27.4 // indirect + github.com/urfave/cli/v2 v2.27.5 // indirect github.com/valyala/bytebufferpool v1.0.0 // indirect github.com/valyala/fasttemplate v1.2.2 // indirect github.com/xeipuuv/gojsonpointer v0.0.0-20190905194746-02993c407bfb // indirect @@ -113,13 +113,14 @@ require ( github.com/yusufpapurcu/wmi v1.2.4 // indirect github.com/zeebo/blake3 v0.2.4 // indirect go.uber.org/multierr v1.11.0 // indirect - golang.org/x/net v0.30.0 // indirect - golang.org/x/sync v0.8.0 // indirect - golang.org/x/sys v0.26.0 // indirect - golang.org/x/text v0.19.0 // indirect - golang.org/x/time v0.7.0 // indirect - golang.org/x/tools v0.26.0 // indirect - google.golang.org/protobuf v1.35.1 // indirect + go.uber.org/zap/exp v0.3.0 // indirect + golang.org/x/net v0.34.0 // indirect + golang.org/x/sync v0.10.0 // indirect + golang.org/x/sys v0.29.0 // indirect + golang.org/x/text v0.21.0 // indirect + golang.org/x/time v0.9.0 // indirect + golang.org/x/tools v0.29.0 // indirect + google.golang.org/protobuf v1.36.3 // indirect gopkg.in/yaml.v2 v2.4.0 // indirect gopkg.in/yaml.v3 v3.0.1 // indirect ) diff --git a/go.sum b/go.sum index 002f356e..2350c395 100644 --- a/go.sum +++ b/go.sum @@ -1,20 +1,22 @@ -github.com/99designs/gqlgen v0.17.55 h1:3vzrNWYyzSZjGDFo68e5j9sSauLxfKvLp+6ioRokVtM= -github.com/99designs/gqlgen v0.17.55/go.mod h1:3Bq768f8hgVPGZxL8aY9MaYmbxa6llPM/qu1IGH1EJo= +cloud.google.com/go v0.34.0/go.mod h1:aQUYkXzVsufM+DwF1aE+0xfcU+56JwCaLick0ClmMTw= +github.com/99designs/gqlgen v0.17.63 h1:HCdaYDPd9HqUXRchEvmE3EFzELRwLlaJ8DBuyC8Cqto= +github.com/99designs/gqlgen v0.17.63/go.mod h1:sVCM2iwIZisJjTI/DEC3fpH+HFgxY1496ZJ+jbT9IjA= github.com/DataDog/datadog-go v3.2.0+incompatible/go.mod h1:LButxg5PwREeZtORoXG3tL4fMGNddJ+vMq1mwgfaqoQ= github.com/KyleBanks/depth v1.2.1 h1:5h8fQADFrWtarTdtDudMmGsC7GPbOAu6RVB3ffsVFHc= github.com/KyleBanks/depth v1.2.1/go.mod h1:jzSb9d0L43HxTQfT+oSA1EEp2q+ne2uh6XgeJcm8brE= -github.com/Masterminds/semver/v3 v3.3.0 h1:B8LGeaivUe71a5qox1ICM/JLl0NqZSW5CHyL+hmvYS0= -github.com/Masterminds/semver/v3 v3.3.0/go.mod h1:4V+yj/TJE1HU9XfppCwVMZq3I84lprf4nC11bSS5beM= +github.com/Masterminds/semver/v3 v3.3.1 h1:QtNSWtVZ3nBfk8mAOu/B6v7FMJ+NHTIgUPi7rj+4nv4= +github.com/Masterminds/semver/v3 v3.3.1/go.mod h1:4V+yj/TJE1HU9XfppCwVMZq3I84lprf4nC11bSS5beM= github.com/PuerkitoBio/goquery v1.9.3 h1:mpJr/ikUA9/GNJB/DBZcGeFDXUtosHRyRrwh7KGdTG0= github.com/PuerkitoBio/goquery v1.9.3/go.mod h1:1ndLHPdTz+DyQPICCWYlYQMPl0oXZj0G6D4LCYA6u4U= -github.com/adhocore/gronx v1.19.3 h1:BNl3pGgiKy12Tt1dNIhzEGL2l+KikeV6NN3A/B2AJLg= -github.com/adhocore/gronx v1.19.3/go.mod h1:7oUY1WAU8rEJWmAxXR2DN0JaO4gi9khSgKjiRypqteg= +github.com/adhocore/gronx v1.19.5 h1:cwIG4nT1v9DvadxtHBe6MzE+FZ1JDvAUC45U2fl4eSQ= +github.com/adhocore/gronx v1.19.5/go.mod h1:7oUY1WAU8rEJWmAxXR2DN0JaO4gi9khSgKjiRypqteg= github.com/agnivade/levenshtein v1.2.0 h1:U9L4IOT0Y3i0TIlUIDJ7rVUziKi/zPbrJGaFrtYH3SY= github.com/agnivade/levenshtein v1.2.0/go.mod h1:QVVI16kDrtSuwcpd0p1+xMC6Z/VfhtCyDIjcwga4/DU= github.com/alecthomas/template v0.0.0-20160405071501-a0175ee3bccc/go.mod h1:LOuyumcjzFXgccqObfd/Ljyb9UuFJ6TxHnclSeseNhc= github.com/alecthomas/template v0.0.0-20190718012654-fb15b899a751/go.mod h1:LOuyumcjzFXgccqObfd/Ljyb9UuFJ6TxHnclSeseNhc= github.com/alecthomas/units v0.0.0-20151022065526-2efee857e7cf/go.mod h1:ybxpYRFXyAe+OPACYpWeL0wqObRcbAqCMya13uyzqw0= github.com/alecthomas/units v0.0.0-20190717042225-c3de453c63f4/go.mod h1:ybxpYRFXyAe+OPACYpWeL0wqObRcbAqCMya13uyzqw0= +github.com/alecthomas/units v0.0.0-20190924025748-f65c72e2690d/go.mod h1:rBZYJk541a8SKzHPHnH3zbiI+7dagKZ0cgpgrD7Fyho= github.com/andreyvit/diff v0.0.0-20170406064948-c7f18ee00883 h1:bvNMNQO63//z+xNgfBlViaCIJKLlCJ6/fmUseuG0wVQ= github.com/andreyvit/diff v0.0.0-20170406064948-c7f18ee00883/go.mod h1:rCTlJbsFo29Kk6CurOXKm700vrz8f0KW0JNfpkRJY/8= github.com/andybalholm/brotli v1.1.1 h1:PR2pgnyFznKEugtsUo0xLdDop5SKXd5Qf5ysW+7XdTA= @@ -35,8 +37,8 @@ github.com/beorn7/perks v1.0.1 h1:VlbKKnNfV8bJzeqoa4cOKqO6bYr3WgKZxO8Z16+hsOM= github.com/beorn7/perks v1.0.1/go.mod h1:G2ZrVWU2WbWT9wwq4/hrbKbnv/1ERSJQ0ibhJ6rlkpw= github.com/boltdb/bolt v1.3.1 h1:JQmyP4ZBrce+ZQu0dY660FMfatumYDLun9hBCUVIkF4= github.com/boltdb/bolt v1.3.1/go.mod h1:clJnj/oiGkjum5o1McbSZDSLxVThjynRyGBgiAx27Ps= -github.com/caddyserver/certmagic v0.21.4 h1:e7VobB8rffHv8ZZpSiZtEwnLDHUwLVYLWzWSa1FfKI0= -github.com/caddyserver/certmagic v0.21.4/go.mod h1:swUXjQ1T9ZtMv95qj7/InJvWLXURU85r+CfG0T+ZbDE= +github.com/caddyserver/certmagic v0.21.7 h1:66KJioPFJwttL43KYSWk7ErSmE6LfaJgCQuhm8Sg6fg= +github.com/caddyserver/certmagic v0.21.7/go.mod h1:LCPG3WLxcnjVKl/xpjzM0gqh0knrKKKiO5WVttX2eEI= github.com/caddyserver/zerossl v0.1.3 h1:onS+pxp3M8HnHpN5MMbOMyNjmTheJyWRaZYwn+YTAyA= github.com/caddyserver/zerossl v0.1.3/go.mod h1:CxA0acn7oEGO6//4rtrRjYgEoa4MFw/XofZnrYwGqG4= github.com/cespare/xxhash/v2 v2.1.1/go.mod h1:VGX0DQ3Q6kWi7AoAeZDth3/j3BFtOZR5XLFGgcrjCOs= @@ -44,10 +46,10 @@ github.com/cespare/xxhash/v2 v2.3.0 h1:UL815xU9SqsFlibzuggzjXhog7bL6oX9BbNZnL2UF github.com/cespare/xxhash/v2 v2.3.0/go.mod h1:VGX0DQ3Q6kWi7AoAeZDth3/j3BFtOZR5XLFGgcrjCOs= github.com/circonus-labs/circonus-gometrics v2.3.1+incompatible/go.mod h1:nmEj6Dob7S7YxXgwXpfOuvO54S+tGdZdw9fuRZt25Ag= github.com/circonus-labs/circonusllhist v0.1.3/go.mod h1:kMXHVDlOchFAehlya5ePtbp5jckzBHf4XRpQvBOLI+I= -github.com/cpuguy83/go-md2man/v2 v2.0.4 h1:wfIWP927BUkWJb2NmU/kNDYIBTh/ziUX91+lVfRxZq4= -github.com/cpuguy83/go-md2man/v2 v2.0.4/go.mod h1:tgQtvFlXSQOSOSIRvRPT7W67SCa46tRHOmNcaadrF8o= -github.com/datarhei/gosrt v0.7.0 h1:1/IY66HVVgqGA9zkmL5l6jUFuI8t/76WkuamSkJqHqs= -github.com/datarhei/gosrt v0.7.0/go.mod h1:wTDoyog1z4au8Fd/QJBQAndzvccuxjqUL/qMm0EyJxE= +github.com/cpuguy83/go-md2man/v2 v2.0.5 h1:ZtcqGrnekaHpVLArFSe4HK5DoKx1T0rq2DwVB0alcyc= +github.com/cpuguy83/go-md2man/v2 v2.0.5/go.mod h1:tgQtvFlXSQOSOSIRvRPT7W67SCa46tRHOmNcaadrF8o= +github.com/datarhei/gosrt v0.8.0 h1:fna/FFRbVN7LvwAt2cR6pxwFz7rm979vdRzGfh9zbNM= +github.com/datarhei/gosrt v0.8.0/go.mod h1:ab1q3G0/DxsEU5iH/OCMaqYOWAqUI0SAbJ2sRKeQblA= github.com/datarhei/joy4 v0.0.0-20240603190808-b1407345907e h1:Qc/0D4xvXrazFkoi/4UGqO15yQ1JN5I8h7RwdzCLgTY= github.com/datarhei/joy4 v0.0.0-20240603190808-b1407345907e/go.mod h1:Jcw/6jZDQQmPx8A7INEkXmuEF7E9jjBbSTfVSLwmiQw= github.com/davecgh/go-spew v1.1.0/go.mod h1:J7Y8YcW2NihsgmVo/mv3lAwl/skON4iLHjSsI+c5H38= @@ -67,16 +69,18 @@ github.com/fatih/color v1.18.0 h1:S8gINlzdQ840/4pfAwic/ZE0djQEH3wM94VfqLTZcOM= github.com/fatih/color v1.18.0/go.mod h1:4FelSpRwEGDpQ12mAdzqdOukCy4u8WUtOY6lkT/6HfU= github.com/fujiwara/shapeio v1.0.0 h1:xG5D9oNqCSUUbryZ/jQV3cqe1v2suEjwPIcEg1gKM8M= github.com/fujiwara/shapeio v1.0.0/go.mod h1:LmEmu6L/8jetyj1oewewFb7bZCNRwE7wLCUNzDLaLVA= -github.com/gabriel-vasile/mimetype v1.4.6 h1:3+PzJTKLkvgjeTbts6msPJt4DixhT4YtFNf1gtGe3zc= -github.com/gabriel-vasile/mimetype v1.4.6/go.mod h1:JX1qVKqZd40hUPpAfiNTe0Sne7hdfKSbOqqmkq8GCXc= +github.com/gabriel-vasile/mimetype v1.4.8 h1:FfZ3gj38NjllZIeJAmMhr+qKL8Wu+nOoI3GqacKw1NM= +github.com/gabriel-vasile/mimetype v1.4.8/go.mod h1:ByKUIKGjh1ODkGM1asKUbQZOLGrPjydw3hYPU2YU9t8= github.com/ghodss/yaml v1.0.0 h1:wQHKEahhL6wmXdzwWG11gIVCkOv05bNOh+Rxn0yngAk= github.com/ghodss/yaml v1.0.0/go.mod h1:4dBDuWmgqj2HViK6kFavaiC9ZROes6MMH2rRYeMEF04= github.com/go-ini/ini v1.67.0 h1:z6ZrTEZqSWOTyH2FlglNbNgARyHG8oLW9gMELqKr06A= github.com/go-ini/ini v1.67.0/go.mod h1:ByCAeIL28uOIIG0E3PJtZPDL8WnHpFKFOtgjp+3Ies8= github.com/go-kit/kit v0.8.0/go.mod h1:xBxKIO96dXMWWy0MnWVtmwkA9/13aqxPnvrjFYMA2as= github.com/go-kit/kit v0.9.0/go.mod h1:xBxKIO96dXMWWy0MnWVtmwkA9/13aqxPnvrjFYMA2as= +github.com/go-kit/log v0.1.0/go.mod h1:zbhenjAZHb184qTLMA9ZjW7ThYL0H2mk7Q6pNt4vbaY= github.com/go-logfmt/logfmt v0.3.0/go.mod h1:Qt1PoO58o5twSAckw1HlFXLmHsOX5/0LbT9GBnD5lWE= github.com/go-logfmt/logfmt v0.4.0/go.mod h1:3RMwSq7FuexP4Kalkev3ejPJsZTpXXBr9+V4qmtdjCk= +github.com/go-logfmt/logfmt v0.5.0/go.mod h1:wCYkCAKZfumFQihp8CzCvQ3paCTfi41vtzG1KdI/P7A= github.com/go-ole/go-ole v1.2.6/go.mod h1:pprOEPIfldk/42T2oK7lQ4v4JSDwmV0As9GaiUsvbm0= github.com/go-ole/go-ole v1.3.0 h1:Dt6ye7+vXGIKZ7Xtk4s6/xVdGDQynvom7xCFEdWr6uE= github.com/go-ole/go-ole v1.3.0/go.mod h1:5LS6F96DhAwUc7C+1HLexzMXY1xGRSryjyPPKW6zv78= @@ -94,31 +98,40 @@ github.com/go-playground/locales v0.14.1 h1:EWaQ/wswjilfKLTECiXz7Rh+3BjFhfDFKv/o github.com/go-playground/locales v0.14.1/go.mod h1:hxrqLVvrK65+Rwrd5Fc6F2O76J/NuW9t0sjnWqG1slY= github.com/go-playground/universal-translator v0.18.1 h1:Bcnm0ZwsGyWbCzImXv+pAJnYK9S473LQFuzCbDbfSFY= github.com/go-playground/universal-translator v0.18.1/go.mod h1:xekY+UJKNuX9WP91TpwSH2VMlDf28Uj24BCp08ZFTUY= -github.com/go-playground/validator/v10 v10.22.1 h1:40JcKH+bBNGFczGuoBYgX4I6m/i27HYW8P9FDk5PbgA= -github.com/go-playground/validator/v10 v10.22.1/go.mod h1:dbuPbCMFw/DrkbEynArYaCwl3amGuJotoKCe95atGMM= +github.com/go-playground/validator/v10 v10.24.0 h1:KHQckvo8G6hlWnrPX4NJJ+aBfWNAE/HH+qdL2cBpCmg= +github.com/go-playground/validator/v10 v10.24.0/go.mod h1:GGzBIJMuE98Ic/kJsBXbz1x/7cByt++cQ+YOuDM5wus= github.com/go-stack/stack v1.8.0/go.mod h1:v0f6uXyyMGvRgIKkXu+yp6POWl0qKG85gN/melR3HDY= +github.com/go-viper/mapstructure/v2 v2.2.1 h1:ZAaOCxANMuZx5RCeg0mBdEZk7DZasvvZIxtHqx8aGss= +github.com/go-viper/mapstructure/v2 v2.2.1/go.mod h1:oJDH3BJKyqBA2TXFhDsKDGDTlndYOZ6rGS0BRZIxGhM= github.com/gobwas/glob v0.2.3 h1:A4xDbljILXROh+kObIiy5kIaPYD8e96x1tgBhUI5J+Y= github.com/gobwas/glob v0.2.3/go.mod h1:d3Ez4x06l9bZtSvzIay5+Yzi0fmZzPgnTbPcKjJAkT8= -github.com/goccy/go-json v0.10.3 h1:KZ5WoDbxAIgm2HNbYckL0se1fHD6rz5j4ywS6ebzDqA= -github.com/goccy/go-json v0.10.3/go.mod h1:oq7eo15ShAhp70Anwd5lgX2pLfOS3QCiwU/PULtXL6M= +github.com/goccy/go-json v0.10.4 h1:JSwxQzIqKfmFX1swYPpUThQZp/Ka4wzJdK0LWVytLPM= +github.com/goccy/go-json v0.10.4/go.mod h1:oq7eo15ShAhp70Anwd5lgX2pLfOS3QCiwU/PULtXL6M= github.com/gogo/protobuf v1.1.1/go.mod h1:r8qH/GZQm5c6nD/R0oafs1akxWv10x8SbQlK7atdtwQ= -github.com/golang-jwt/jwt v3.2.2+incompatible h1:IfV12K8xAKAnZqdXVzCZ+TOjboZ2keLg81eXfW3O+oY= -github.com/golang-jwt/jwt v3.2.2+incompatible/go.mod h1:8pz2t5EyA70fFQQSrl6XZXzqecmYZeUEB8OUGHkxJ+I= -github.com/golang-jwt/jwt/v4 v4.5.0 h1:7cYmW1XlMY7h7ii7UhUyChSgS5wUJEnm9uZVTGqOWzg= -github.com/golang-jwt/jwt/v4 v4.5.0/go.mod h1:m21LjoU+eqJr34lmDMbreY2eSTRJ1cv77w39/MY0Ch0= +github.com/golang-jwt/jwt/v4 v4.5.1 h1:JdqV9zKUdtaa9gdPlywC3aeoEsR681PlKC+4F5gQgeo= +github.com/golang-jwt/jwt/v4 v4.5.1/go.mod h1:m21LjoU+eqJr34lmDMbreY2eSTRJ1cv77w39/MY0Ch0= github.com/golang-jwt/jwt/v5 v5.2.1 h1:OuVbFODueb089Lh128TAcimifWaLhJwVflnrgM17wHk= github.com/golang-jwt/jwt/v5 v5.2.1/go.mod h1:pqrtFR0X4osieyHYxtmOUWsAWrfe1Q5UVIyoH402zdk= github.com/golang/protobuf v1.2.0/go.mod h1:6lQm79b+lXiMfvg/cZm0SGofjICqVBUtrP5yJMmIC1U= github.com/golang/protobuf v1.3.1/go.mod h1:6lQm79b+lXiMfvg/cZm0SGofjICqVBUtrP5yJMmIC1U= github.com/golang/protobuf v1.3.2/go.mod h1:6lQm79b+lXiMfvg/cZm0SGofjICqVBUtrP5yJMmIC1U= +github.com/golang/protobuf v1.4.0-rc.1/go.mod h1:ceaxUfeHdC40wWswd/P6IGgMaK3YpKi5j83Wpe3EHw8= +github.com/golang/protobuf v1.4.0-rc.1.0.20200221234624-67d41d38c208/go.mod h1:xKAWHe0F5eneWXFV3EuXVDTCmh+JuBKY0li0aMyXATA= +github.com/golang/protobuf v1.4.0-rc.2/go.mod h1:LlEzMj4AhA7rCAGe4KMBDvJI+AwstrUpVNzEA03Pprs= +github.com/golang/protobuf v1.4.0-rc.4.0.20200313231945-b860323f09d0/go.mod h1:WU3c8KckQ9AFe+yFwt9sWVRKCVIyN9cPHBJSNnbL67w= +github.com/golang/protobuf v1.4.0/go.mod h1:jodUvKwWbYaEsadDk5Fwe5c77LiNKVO9IDvqG2KuDX0= +github.com/golang/protobuf v1.4.2/go.mod h1:oDoupMAO8OvCJWAcko0GGGIgR6R6ocIYbsSw735rRwI= +github.com/golang/protobuf v1.4.3/go.mod h1:oDoupMAO8OvCJWAcko0GGGIgR6R6ocIYbsSw735rRwI= +github.com/google/go-cmp v0.3.0/go.mod h1:8QqcDgzrUqlUb/G2PQTWiueGozuR1884gddMywk6iLU= github.com/google/go-cmp v0.3.1/go.mod h1:8QqcDgzrUqlUb/G2PQTWiueGozuR1884gddMywk6iLU= github.com/google/go-cmp v0.4.0/go.mod h1:v8dTdLbMG2kIc/vJvl+f65V22dbkXbowE6jgT/gNBxE= +github.com/google/go-cmp v0.5.4/go.mod h1:v8dTdLbMG2kIc/vJvl+f65V22dbkXbowE6jgT/gNBxE= +github.com/google/go-cmp v0.5.5/go.mod h1:v8dTdLbMG2kIc/vJvl+f65V22dbkXbowE6jgT/gNBxE= github.com/google/go-cmp v0.6.0 h1:ofyhxvXcZhMsU5ulbFiLKl/XBFqE1GSq7atu8tAmTRI= github.com/google/go-cmp v0.6.0/go.mod h1:17dUlkBOakJ0+DkrSSNjCkIjxS6bF9zb3elmeNGIjoY= github.com/google/gofuzz v1.0.0/go.mod h1:dBl0BpW6vV/+mYPU4Po3pmUjxk6FQPldtuIdl/M65Eg= github.com/google/gops v0.3.28 h1:2Xr57tqKAmQYRAfG12E+yLcoa2Y42UJo2lOrUFL9ark= github.com/google/gops v0.3.28/go.mod h1:6f6+Nl8LcHrzJwi8+p0ii+vmBFSlB4f8cOOkTJ7sk4c= -github.com/google/uuid v1.3.0/go.mod h1:TIyPZe4MgqvfeYDBFedMoGGpEw/LqOeaOT+nhxU+yHo= github.com/google/uuid v1.6.0 h1:NIvaJDMOsjHA8n1jAhLSgzrAzy1Hgr+hNrb57e+94F0= github.com/google/uuid v1.6.0/go.mod h1:TIyPZe4MgqvfeYDBFedMoGGpEw/LqOeaOT+nhxU+yHo= github.com/gorilla/websocket v1.5.3 h1:saDtZ6Pbx/0u+bgYQ3q96pZgCzfhKXGPqt7kZ72aNNg= @@ -129,6 +142,8 @@ github.com/hashicorp/go-hclog v1.6.3/go.mod h1:W4Qnvbt70Wk/zYJryRzDRU/4r0kIg0PVH github.com/hashicorp/go-immutable-radix v1.0.0/go.mod h1:0y9vanUI8NX6FsYoO3zeMjhV/C5i9g4Q3DwcSNZ4P60= github.com/hashicorp/go-immutable-radix v1.3.1 h1:DKHmCUm2hRBK510BaiZlwvpD40f8bJFeZnpfm2KLowc= github.com/hashicorp/go-immutable-radix v1.3.1/go.mod h1:0y9vanUI8NX6FsYoO3zeMjhV/C5i9g4Q3DwcSNZ4P60= +github.com/hashicorp/go-metrics v0.5.4 h1:8mmPiIJkTPPEbAiV97IxdAGNdRdaWwVap1BU6elejKY= +github.com/hashicorp/go-metrics v0.5.4/go.mod h1:CG5yz4NZ/AI/aQt9Ucm/vdBnbh7fvmv4lxZ350i+QQI= github.com/hashicorp/go-msgpack v0.5.5 h1:i9R9JSrqIz0QVLz3sz+i3YJdT7TTSLcfLLzJi9aZTuI= github.com/hashicorp/go-msgpack v0.5.5/go.mod h1:ahLV/dePpqEmjfWmKiqvPkv/twdG7iPBM1vqhUKIvfM= github.com/hashicorp/go-msgpack/v2 v2.1.2 h1:4Ee8FTp834e+ewB71RDrQ0VKpyFdrKOjvYtnQ/ltVj0= @@ -141,12 +156,12 @@ github.com/hashicorp/golang-lru v1.0.2 h1:dV3g9Z/unq5DpblPpw+Oqcv4dU/1omnb4Ok8iP github.com/hashicorp/golang-lru v1.0.2/go.mod h1:iADmTwqILo4mZ8BN3D2Q6+9jd8WM5uGBxy+E8yxSoD4= github.com/hashicorp/golang-lru/v2 v2.0.7 h1:a+bsQ5rvGLjzHuww6tVxozPZFVghXaHOwFs4luLUK2k= github.com/hashicorp/golang-lru/v2 v2.0.7/go.mod h1:QeFd9opnmA6QUJc5vARoKUSoFhyfM2/ZepoAG6RGpeM= -github.com/hashicorp/raft v1.7.1 h1:ytxsNx4baHsRZrhUcbt3+79zc4ly8qm7pi0393pSchY= -github.com/hashicorp/raft v1.7.1/go.mod h1:hUeiEwQQR/Nk2iKDD0dkEhklSsu3jcAcqvPzPoZSAEM= +github.com/hashicorp/raft v1.7.2 h1:pyvxhfJ4R8VIAlHKvLoKQWElZspsCVT6YWuxVxsPAgc= +github.com/hashicorp/raft v1.7.2/go.mod h1:DfvCGFxpAUPE0L4Uc8JLlTPtc3GzSbdH0MTJCLgnmJQ= github.com/hashicorp/raft-boltdb v0.0.0-20230125174641-2a8082862702 h1:RLKEcCuKcZ+qp2VlaaZsYZfLOmIiuJNpEi48Rl8u9cQ= github.com/hashicorp/raft-boltdb v0.0.0-20230125174641-2a8082862702/go.mod h1:nTakvJ4XYq45UXtn0DbwR4aU9ZdjlnIenpbs6Cd+FM0= -github.com/hashicorp/raft-boltdb/v2 v2.3.0 h1:fPpQR1iGEVYjZ2OELvUHX600VAK5qmdnDEv3eXOwZUA= -github.com/hashicorp/raft-boltdb/v2 v2.3.0/go.mod h1:YHukhB04ChJsLHLJEUD6vjFyLX2L3dsX3wPBZcX4tmc= +github.com/hashicorp/raft-boltdb/v2 v2.3.1 h1:ackhdCNPKblmOhjEU9+4lHSJYFkJd6Jqyvj6eW9pwkc= +github.com/hashicorp/raft-boltdb/v2 v2.3.1/go.mod h1:n4S+g43dXF1tqDT+yzcXHhXM6y7MrlUd3TTwGRcUvQE= github.com/iancoleman/orderedmap v0.0.0-20190318233801-ac98e3ecb4b0/go.mod h1:N0Wam8K1arqPXNWjMo21EXnBPOPp36vB07FNRdD2geA= github.com/iancoleman/orderedmap v0.2.0 h1:sq1N/TFpYH++aViPcaKjys3bDClUEU7s5B+z6jq8pNA= github.com/iancoleman/orderedmap v0.2.0/go.mod h1:N0Wam8K1arqPXNWjMo21EXnBPOPp36vB07FNRdD2geA= @@ -156,15 +171,20 @@ github.com/joho/godotenv v1.5.1 h1:7eLL/+HRGLY0ldzfGMeQkb7vMd0as4CfYvUVzLqw0N0= github.com/joho/godotenv v1.5.1/go.mod h1:f4LDr5Voq0i2e/R5DDNOoa2zzDfwtkZa6DnEwAbqwq4= github.com/josharian/intern v1.0.0 h1:vlS4z54oSdjm0bgjRigI+G1HpF+tI+9rE5LLzOg8HmY= github.com/josharian/intern v1.0.0/go.mod h1:5DoeVV0s6jJacbCEi61lwdGj/aVlrQvzHFFd8Hwg//Y= +github.com/jpillora/backoff v1.0.0/go.mod h1:J/6gKK9jxlEcS3zixgDgUAsiuZ7yrSoa/FX5e0EB2j4= github.com/json-iterator/go v1.1.6/go.mod h1:+SdeFBvtyEkXs7REEP0seUULqWtbJapLOCVDaaPEHmU= github.com/json-iterator/go v1.1.9/go.mod h1:KdQUCv79m/52Kvf8AW2vK1V8akMuk1QjK/uOdHXbAo4= +github.com/json-iterator/go v1.1.10/go.mod h1:KdQUCv79m/52Kvf8AW2vK1V8akMuk1QjK/uOdHXbAo4= +github.com/json-iterator/go v1.1.11/go.mod h1:KdQUCv79m/52Kvf8AW2vK1V8akMuk1QjK/uOdHXbAo4= github.com/julienschmidt/httprouter v1.2.0/go.mod h1:SYymIcj16QtmaHHD7aYtjjsJG7VTCxuUUipMqKk8s4w= +github.com/julienschmidt/httprouter v1.3.0/go.mod h1:JR6WtHb+2LUe8TCKY3cZOxFyyO8IZAc4RVcycCCAKdM= github.com/klauspost/compress v1.17.11 h1:In6xLpyWOi1+C7tXUUWv2ot1QvBjxevKAaI6IXrJmUc= github.com/klauspost/compress v1.17.11/go.mod h1:pMDklpSncoRMuLFrf1W9Ss9KT+0rH90U12bZKk7uwG0= github.com/klauspost/cpuid/v2 v2.0.1/go.mod h1:FInQzS24/EEf25PyTYn52gqo7WaD8xa0213Md/qVLRg= -github.com/klauspost/cpuid/v2 v2.2.8 h1:+StwCXwm9PdpiEkPyzBXIy+M9KUb4ODm0Zarf1kS5BM= -github.com/klauspost/cpuid/v2 v2.2.8/go.mod h1:Lcz8mBdAVJIBVzewtcLocK12l3Y+JytZYpaMropDUws= +github.com/klauspost/cpuid/v2 v2.2.9 h1:66ze0taIn2H33fBvCkXuv9BmCwDfafmiIVpKV9kKGuY= +github.com/klauspost/cpuid/v2 v2.2.9/go.mod h1:rqkxqrZ1EhYM9G+hXH7YdowN5R5RGN6NK4QwQ3WMXF8= github.com/konsorten/go-windows-terminal-sequences v1.0.1/go.mod h1:T0+1ngSBFLxvqU3pZ+m/2kptfBszLMUkC4ZK/EgS/cQ= +github.com/konsorten/go-windows-terminal-sequences v1.0.3/go.mod h1:T0+1ngSBFLxvqU3pZ+m/2kptfBszLMUkC4ZK/EgS/cQ= github.com/kr/logfmt v0.0.0-20140226030751-b84e30acd515/go.mod h1:+0opPa2QZZtGFBFZlji/RkVcI2GknAs/DXo4wKdlNEc= github.com/kr/pretty v0.1.0/go.mod h1:dAy3ld7l9f0ibDNOQOHHMYYIIbhfbHSm3C4ZsoJORNo= github.com/kr/pretty v0.3.1 h1:flRD4NNwYAUpkphVc1HcthR4KEIFJ65n8Mw5qdRn3LE= @@ -175,8 +195,8 @@ github.com/kr/text v0.2.0 h1:5Nx0Ya0ZqY2ygV366QzturHI13Jq95ApcVaJBhpS+AY= github.com/kr/text v0.2.0/go.mod h1:eLer722TekiGuMkidMxC/pM04lWEeraHUUmBw8l2grE= github.com/kylelemons/godebug v1.1.0 h1:RPNrshWIDI6G2gRW9EHilWtl7Z6Sb1BR0xunSBf0SNc= github.com/kylelemons/godebug v1.1.0/go.mod h1:9/0rRGxNHcop5bhtWyNeEfOS8JIWk580+fNqagV/RAw= -github.com/labstack/echo/v4 v4.12.0 h1:IKpw49IMryVB2p1a4dzwlhP1O2Tf2E0Ir/450lH+kI0= -github.com/labstack/echo/v4 v4.12.0/go.mod h1:UP9Cr2DJXbOK3Kr9ONYzNowSh7HP0aG0ShAyycHSJvM= +github.com/labstack/echo/v4 v4.13.3 h1:pwhpCPrTl5qry5HRdM5FwdXnhXSLSY+WE+YQSeCaafY= +github.com/labstack/echo/v4 v4.13.3/go.mod h1:o90YNEeQWjDozo584l7AwhJMHN0bOC4tAfg+Xox9q5g= github.com/labstack/gommon v0.4.2 h1:F8qTUNXgG1+6WQmqoUWnz8WiEU60mXVVw0P4ht1WRA0= github.com/labstack/gommon v0.4.2/go.mod h1:QlUFxVM+SNXhDL/Z7YhocGIBYOiwB0mXm1+1bAPHPyU= github.com/leodido/go-urn v1.4.0 h1:WT9HwE9SGECu3lg4d/dIA+jxlljEa1/ffXKmRjqdmIQ= @@ -187,32 +207,29 @@ github.com/lestrrat-go/strftime v1.1.0 h1:gMESpZy44/4pXLO/m+sL0yBd1W6LjgjrrD4a68 github.com/lestrrat-go/strftime v1.1.0/go.mod h1:uzeIB52CeUJenCo1syghlugshMysrqUT51HlxphXVeI= github.com/libdns/libdns v0.2.2 h1:O6ws7bAfRPaBsgAYt8MDe2HcNBGC29hkZ9MX2eUSX3s= github.com/libdns/libdns v0.2.2/go.mod h1:4Bj9+5CQiNMVGf87wjX4CY3HQJypUHRuLvlsfsZqLWQ= -github.com/lithammer/shortuuid/v4 v4.0.0 h1:QRbbVkfgNippHOS8PXDkti4NaWeyYfcBTHtw7k08o4c= -github.com/lithammer/shortuuid/v4 v4.0.0/go.mod h1:Zs8puNcrvf2rV9rTH51ZLLcj7ZXqQI3lv67aw4KiB1Y= +github.com/lithammer/shortuuid/v4 v4.2.0 h1:LMFOzVB3996a7b8aBuEXxqOBflbfPQAiVzkIcHO0h8c= +github.com/lithammer/shortuuid/v4 v4.2.0/go.mod h1:D5noHZ2oFw/YaKCfGy0YxyE7M0wMbezmMjPdhyEFe6Y= github.com/lufia/plan9stats v0.0.0-20240909124753-873cd0166683 h1:7UMa6KCCMjZEMDtTVdcGu0B1GmmC7QJKiCCjyTAWQy0= github.com/lufia/plan9stats v0.0.0-20240909124753-873cd0166683/go.mod h1:ilwx/Dta8jXAgpFYFvSWEMwxmbWXyiUHkd5FwyKhb5k= -github.com/mailru/easyjson v0.7.7 h1:UGYAvKxe3sBsEDzO8ZeWOSlIQfWFlxbzLZe7hwFURr0= -github.com/mailru/easyjson v0.7.7/go.mod h1:xzfreul335JAWq5oZzymOObrkdz5UnU4kGfJJLY9Nlc= +github.com/mailru/easyjson v0.9.0 h1:PrnmzHw7262yW8sTBwxi1PdJA3Iw/EKBa8psRf7d9a4= +github.com/mailru/easyjson v0.9.0/go.mod h1:1+xMtQp2MRNVL/V1bOzuP3aP8VNwRW55fQUto+XFtTU= github.com/mattn/go-colorable v0.1.9/go.mod h1:u6P/XSegPjTcexA+o6vUJrdnUu04hMope9wVRipJSqc= github.com/mattn/go-colorable v0.1.12/go.mod h1:u5H1YNBxpqRaxsYJYSkiCWKzEfiAb1Gb520KVy5xxl4= -github.com/mattn/go-colorable v0.1.13 h1:fFA4WZxdEF4tXPZVKMLwD8oUnCTTo08duU7wxecdEvA= -github.com/mattn/go-colorable v0.1.13/go.mod h1:7S9/ev0klgBDR4GtXTXX8a3vIGJpMovkB8vQcUbaXHg= +github.com/mattn/go-colorable v0.1.14 h1:9A9LHSqF/7dyVVX6g0U9cwm9pG3kP9gSzcuIPHPsaIE= +github.com/mattn/go-colorable v0.1.14/go.mod h1:6LmQG8QLFO4G5z1gPvYEzlUgJ2wF+stgPZH1UqBm1s8= github.com/mattn/go-isatty v0.0.12/go.mod h1:cbi8OIDigv2wuxKPP5vlRcQ1OAZbq2CE4Kysco4FUpU= github.com/mattn/go-isatty v0.0.14/go.mod h1:7GGIvUiUoEMVVmxf/4nioHXj79iQHKdU27kJ6hsGG94= -github.com/mattn/go-isatty v0.0.16/go.mod h1:kYGgaQfpe5nmfYZH+SKPsOc2e4SrIfOl2e/yFXSvRLM= github.com/mattn/go-isatty v0.0.20 h1:xfD0iDuEKnDkl03q4limB+vH+GxLEtL/jb4xVJSWWEY= github.com/mattn/go-isatty v0.0.20/go.mod h1:W+V8PltTTMOvKvAeJH7IuucS94S2C6jfK/D7dTCTo3Y= github.com/matttproud/golang_protobuf_extensions v1.0.1/go.mod h1:D8He9yQNgCq6Z5Ld7szi9bcBfOoFv/3dc6xSMkL2PC0= -github.com/mholt/acmez/v2 v2.0.3 h1:CgDBlEwg3QBp6s45tPQmFIBrkRIkBT4rW4orMM6p4sw= -github.com/mholt/acmez/v2 v2.0.3/go.mod h1:pQ1ysaDeGrIMvJ9dfJMk5kJNkn7L2sb3UhyrX6Q91cw= +github.com/mholt/acmez/v3 v3.0.1 h1:4PcjKjaySlgXK857aTfDuRbmnM5gb3Ruz3tvoSJAUp8= +github.com/mholt/acmez/v3 v3.0.1/go.mod h1:L1wOU06KKvq7tswuMDwKdcHeKpFFgkppZy/y0DFxagQ= github.com/miekg/dns v1.1.62 h1:cN8OuEF1/x5Rq6Np+h1epln8OiyPWV+lROx9LxcGgIQ= github.com/miekg/dns v1.1.62/go.mod h1:mvDlcItzm+br7MToIKqkglaGhlFMHJ9DTNNWONWXbNQ= github.com/minio/md5-simd v1.1.2 h1:Gdi1DZK69+ZVMoNHRXJyNcxrMA4dSxoYHZSQbirFg34= github.com/minio/md5-simd v1.1.2/go.mod h1:MzdKDxYpY2BT9XQFocsiZf/NKVtR7nkE4RoEpN+20RM= -github.com/minio/minio-go/v7 v7.0.80 h1:2mdUHXEykRdY/BigLt3Iuu1otL0JTogT0Nmltg0wujk= -github.com/minio/minio-go/v7 v7.0.80/go.mod h1:84gmIilaX4zcvAWWzJ5Z1WI5axN+hAbM5w25xf8xvC0= -github.com/mitchellh/mapstructure v1.5.0 h1:jeMsZIYE/09sWLaz43PL7Gy6RuMjD2eJVyuac5Z2hdY= -github.com/mitchellh/mapstructure v1.5.0/go.mod h1:bFUtVrKA4DC2yAKiSyO/QUcy7e+RRV2QTWOzhPopBRo= +github.com/minio/minio-go/v7 v7.0.84 h1:D1HVmAF8JF8Bpi6IU4V9vIEj+8pc+xU88EWMs2yed0E= +github.com/minio/minio-go/v7 v7.0.84/go.mod h1:57YXpvc5l3rjPdhqNrDsvVlY0qPI6UTk1bflAe+9doY= github.com/modern-go/concurrent v0.0.0-20180228061459-e0a39a4cb421/go.mod h1:6dJC0mAP4ikYIbvyc7fijjWJddQyLn8Ig3JB5CqoB9Q= github.com/modern-go/concurrent v0.0.0-20180306012644-bacd9c7ef1dd/go.mod h1:6dJC0mAP4ikYIbvyc7fijjWJddQyLn8Ig3JB5CqoB9Q= github.com/modern-go/reflect2 v0.0.0-20180701023420-4b7aa43c6742/go.mod h1:bx2lNnkwVCuqBIxFjflWJWanXIb3RllmbCylyMrvgv0= @@ -220,10 +237,12 @@ github.com/modern-go/reflect2 v1.0.1/go.mod h1:bx2lNnkwVCuqBIxFjflWJWanXIb3Rllmb github.com/munnerz/goautoneg v0.0.0-20191010083416-a7dc8b61c822 h1:C3w9PqII01/Oq1c1nUAm88MOHcQC9l5mIlSMApZMrHA= github.com/munnerz/goautoneg v0.0.0-20191010083416-a7dc8b61c822/go.mod h1:+n7T8mK8HuQTcFwEeznm/DIxMOiR9yIdICNftLE1DvQ= github.com/mwitkow/go-conntrack v0.0.0-20161129095857-cc309e4a2223/go.mod h1:qRWi+5nqEBWmkhHvq77mSJWrCKwh8bxhgT7d/eI7P4U= +github.com/mwitkow/go-conntrack v0.0.0-20190716064945-2f068394615f/go.mod h1:qRWi+5nqEBWmkhHvq77mSJWrCKwh8bxhgT7d/eI7P4U= github.com/pascaldekloe/goe v0.1.0 h1:cBOtyMzM9HTpWjXfbbunk26uA6nG3a8n06Wieeh0MwY= github.com/pascaldekloe/goe v0.1.0/go.mod h1:lzWF7FIEvWOWxwDKqyGYQf6ZUaNfKdP144TG7ZOy1lc= github.com/pkg/errors v0.8.0/go.mod h1:bwawxfHBFNV+L2hUp1rHADufV3IMtnDRdf1r5NINEl0= github.com/pkg/errors v0.8.1/go.mod h1:bwawxfHBFNV+L2hUp1rHADufV3IMtnDRdf1r5NINEl0= +github.com/pkg/errors v0.9.1/go.mod h1:bwawxfHBFNV+L2hUp1rHADufV3IMtnDRdf1r5NINEl0= github.com/pmezard/go-difflib v1.0.0/go.mod h1:iKH77koFhYxTK1pcRnkKkqfTogsbg7gZNVY4sRDYZ/4= github.com/pmezard/go-difflib v1.0.1-0.20181226105442-5d4384ee4fb2 h1:Jamvg5psRIccs7FGNTlIRMkT8wgtp5eCXdBlqhYGL6U= github.com/pmezard/go-difflib v1.0.1-0.20181226105442-5d4384ee4fb2/go.mod h1:iKH77koFhYxTK1pcRnkKkqfTogsbg7gZNVY4sRDYZ/4= @@ -234,6 +253,8 @@ github.com/prashantv/gostub v1.1.0/go.mod h1:A5zLQHz7ieHGG7is6LLXLz7I8+3LZzsrV0P github.com/prometheus/client_golang v0.9.1/go.mod h1:7SWBe2y4D6OKWSNQJUaRYU/AaXPKyh/dDVn+NZz0KFw= github.com/prometheus/client_golang v1.0.0/go.mod h1:db9x61etRT2tGnBNRi70OPL5FsnadC4Ky3P0J6CfImo= github.com/prometheus/client_golang v1.4.0/go.mod h1:e9GMxYsXl05ICDXkRhurwBS4Q3OK1iX/F2sw+iXX5zU= +github.com/prometheus/client_golang v1.7.1/go.mod h1:PY5Wy2awLA44sXw4AOSfFBetzPP4j5+D6mVACh+pe2M= +github.com/prometheus/client_golang v1.11.1/go.mod h1:Z6t4BnS23TR94PD6BsDNk8yVqroYurpAkEiz0P2BEV0= github.com/prometheus/client_golang v1.20.5 h1:cxppBPuYhUnsO6yo/aoRol4L7q7UFfdm+bR9r+8l63Y= github.com/prometheus/client_golang v1.20.5/go.mod h1:PIEt8X02hGcP8JWbeHyeZ53Y/jReSnHgO035n//V5WE= github.com/prometheus/client_model v0.0.0-20180712105110-5c3871d89910/go.mod h1:MbSGuTsp3dbXC40dX6PRTWyKYBIrTGTE9sqQNg2J8bo= @@ -243,15 +264,19 @@ github.com/prometheus/client_model v0.6.1 h1:ZKSh/rekM+n3CeS952MLRAdFwIKqeY8b62p github.com/prometheus/client_model v0.6.1/go.mod h1:OrxVMOVHjw3lKMa8+x6HeMGkHMQyHDk9E3jmP2AmGiY= github.com/prometheus/common v0.4.1/go.mod h1:TNfzLD0ON7rHzMJeJkieUDPYmFC7Snx/y86RQel1bk4= github.com/prometheus/common v0.9.1/go.mod h1:yhUN8i9wzaXS3w1O07YhxHEBxD+W35wd8bs7vj7HSQ4= -github.com/prometheus/common v0.60.1 h1:FUas6GcOw66yB/73KC+BOZoFJmbo/1pojoILArPAaSc= -github.com/prometheus/common v0.60.1/go.mod h1:h0LYf1R1deLSKtD4Vdg8gy4RuOvENW2J/h19V5NADQw= +github.com/prometheus/common v0.10.0/go.mod h1:Tlit/dnDKsSWFlCLTWaA1cyBgKHSMdTB80sz/V91rCo= +github.com/prometheus/common v0.26.0/go.mod h1:M7rCNAaPfAosfx8veZJCuw84e35h3Cfd9VFqTh1DIvc= +github.com/prometheus/common v0.62.0 h1:xasJaQlnWAeyHdUBeGjXmutelfJHWMRr+Fg4QszZ2Io= +github.com/prometheus/common v0.62.0/go.mod h1:vyBcEuLSvWos9B1+CyL7JZ2up+uFzXhkqml0W5zIY1I= github.com/prometheus/procfs v0.0.0-20181005140218-185b4288413d/go.mod h1:c3At6R/oaqEKCNdg8wHV1ftS6bRYblBhIjjI8uT2IGk= github.com/prometheus/procfs v0.0.2/go.mod h1:TjEm7ze935MbeOT/UhFTIMYKhuLP4wbCsTZCD3I8kEA= github.com/prometheus/procfs v0.0.8/go.mod h1:7Qr8sr6344vo1JqZ6HhLceV9o3AJ1Ff+GxbHq6oeK9A= +github.com/prometheus/procfs v0.1.3/go.mod h1:lV6e/gmhEcM9IjHGsFOCxxuZ+z1YqCvr4OA4YeYWdaU= +github.com/prometheus/procfs v0.6.0/go.mod h1:cz+aTbrPOrUb4q7XlbU9ygM+/jj0fzG6c1xBZuNvfVA= github.com/prometheus/procfs v0.15.1 h1:YagwOFzUgYfKKHX6Dr+sHT7km/hxC76UB0learggepc= github.com/prometheus/procfs v0.15.1/go.mod h1:fB45yRUv8NstnjriLhBQLuOUt+WW4BsoGhij/e3PBqk= -github.com/puzpuzpuz/xsync/v3 v3.4.0 h1:DuVBAdXuGFHv8adVXjWWZ63pJq+NRXOWVXlKDBZ+mJ4= -github.com/puzpuzpuz/xsync/v3 v3.4.0/go.mod h1:VjzYrABPabuM4KyBh1Ftq6u8nhwY5tBPKP9jpmh0nnA= +github.com/puzpuzpuz/xsync/v3 v3.4.1 h1:wWXLKXwzpsduC3kUSahiL45MWxkGb+AQG0dsri4iftA= +github.com/puzpuzpuz/xsync/v3 v3.4.1/go.mod h1:VjzYrABPabuM4KyBh1Ftq6u8nhwY5tBPKP9jpmh0nnA= github.com/rogpeppe/go-internal v1.11.0 h1:cWPaGQEPrBb5/AsnsZesgZZ9yb1OQ+GOISoDNXVBh4M= github.com/rogpeppe/go-internal v1.11.0/go.mod h1:ddIwULY96R17DhadqLgMfk9H9tvdUzkipdSkR5nkCZA= github.com/rs/xid v1.6.0 h1:fV591PaemRlL6JfRxGDEPl69wICngIQ3shQtzfy2gxU= @@ -268,6 +293,7 @@ github.com/shoenig/test v0.6.4 h1:kVTaSd7WLz5WZ2IaoM0RSzRsUD+m8wRR+5qvntpn4LU= github.com/shoenig/test v0.6.4/go.mod h1:byHiCGXqrVaflBLAMq/srcZIHynQPQgeyvkvXnjqq0k= github.com/sirupsen/logrus v1.2.0/go.mod h1:LxeOpSwHxABJmUn/MG1IvRgCAasNZTLOkJPxbbu5VWo= github.com/sirupsen/logrus v1.4.2/go.mod h1:tLMulIdttU9McNUspp0xgXVQah82FyeX6MwdIuYE2rE= +github.com/sirupsen/logrus v1.6.0/go.mod h1:7uNnSEd1DgxDLC74fIahvMZmmYsHGZGEOFrfsX/uA88= github.com/sosodev/duration v1.3.1 h1:qtHBDMQ6lvMQsL15g4aopM4HEfOaYuhWBw3NPTtlqq4= github.com/sosodev/duration v1.3.1/go.mod h1:RQIBBX0+fMLc/D9+Jb/fwvVmo0eZvDDEERAikUR6SDg= github.com/stretchr/objx v0.1.0/go.mod h1:HFkY916IF+rwdDfMAkV7OtwuqBVzrE8GR6GFx+wExME= @@ -277,12 +303,12 @@ github.com/stretchr/testify v1.3.0/go.mod h1:M5WIy9Dh21IEIfnGCwXGc5bZfKNJtfHm1UV github.com/stretchr/testify v1.3.1-0.20190311161405-34c6fa2dc709/go.mod h1:M5WIy9Dh21IEIfnGCwXGc5bZfKNJtfHm1UVUgZn+9EI= github.com/stretchr/testify v1.4.0/go.mod h1:j7eGeouHqKxXV5pUuKE4zz7dFj8WfuZ+81PSLYec5m4= github.com/stretchr/testify v1.7.2/go.mod h1:R6va5+xMeoiuVRoj+gSkQ7d3FALtqAAGI1FQKckRals= -github.com/stretchr/testify v1.9.0 h1:HtqpIVDClZ4nwg75+f6Lvsy/wHu+3BoSGCbBAcpTsTg= -github.com/stretchr/testify v1.9.0/go.mod h1:r2ic/lqez/lEtzL7wO/rwa5dbSLXVDPFyf8C91i36aY= +github.com/stretchr/testify v1.10.0 h1:Xv5erBjTwe/5IxqUQTdXv5kgmIvbHo3QQyRwhJsOfJA= +github.com/stretchr/testify v1.10.0/go.mod h1:r2ic/lqez/lEtzL7wO/rwa5dbSLXVDPFyf8C91i36aY= github.com/swaggo/echo-swagger v1.4.1 h1:Yf0uPaJWp1uRtDloZALyLnvdBeoEL5Kc7DtnjzO/TUk= github.com/swaggo/echo-swagger v1.4.1/go.mod h1:C8bSi+9yH2FLZsnhqMZLIZddpUxZdBYuNHbtaS1Hljc= -github.com/swaggo/files/v2 v2.0.1 h1:XCVJO/i/VosCDsJu1YLpdejGsGnBE9deRMpjN4pJLHk= -github.com/swaggo/files/v2 v2.0.1/go.mod h1:24kk2Y9NYEJ5lHuCra6iVwkMjIekMCaFq/0JQj66kyM= +github.com/swaggo/files/v2 v2.0.2 h1:Bq4tgS/yxLB/3nwOMcul5oLEUKa877Ykgz3CJMVbQKU= +github.com/swaggo/files/v2 v2.0.2/go.mod h1:TVqetIzZsO9OhHX1Am9sRf9LdrFZqoK49N37KON/jr0= github.com/swaggo/swag v1.16.4 h1:clWJtd9LStiG3VeijiCfOVODP6VpHtKdQy9ELFG3s1A= github.com/swaggo/swag v1.16.4/go.mod h1:VBsHJRsDvfYvqoiMKnsdwhNV9LEMHgEDZcyVYX0sxPg= github.com/tklauser/go-sysconf v0.3.14 h1:g5vzr9iPFFz24v2KZXs/pvpvh8/V9Fw6vQK5ZZb78yU= @@ -290,14 +316,14 @@ github.com/tklauser/go-sysconf v0.3.14/go.mod h1:1ym4lWMLUOhuBOPGtRcJm7tEGX4SCYN github.com/tklauser/numcpus v0.9.0 h1:lmyCHtANi8aRUgkckBgoDk1nHCux3n2cgkJLXdQGPDo= github.com/tklauser/numcpus v0.9.0/go.mod h1:SN6Nq1O3VychhC1npsWostA+oW+VOQTxZrS604NSRyI= github.com/tv42/httpunix v0.0.0-20150427012821-b75d8614f926/go.mod h1:9ESjWnEqriFuLhtthL60Sar/7RFoluCcXsuvEwTV5KM= -github.com/urfave/cli/v2 v2.27.4 h1:o1owoI+02Eb+K107p27wEX9Bb8eqIoZCfLXloLUSWJ8= -github.com/urfave/cli/v2 v2.27.4/go.mod h1:m4QzxcD2qpra4z7WhzEGn74WZLViBnMpb1ToCAKdGRQ= +github.com/urfave/cli/v2 v2.27.5 h1:WoHEJLdsXr6dDWoJgMq/CboDmyY/8HMMH1fTECbih+w= +github.com/urfave/cli/v2 v2.27.5/go.mod h1:3Sevf16NykTbInEnD0yKkjDAeZDS0A6bzhBH5hrMvTQ= github.com/valyala/bytebufferpool v1.0.0 h1:GqA5TC/0021Y/b9FG4Oi9Mr3q7XYx6KllzawFIhcdPw= github.com/valyala/bytebufferpool v1.0.0/go.mod h1:6bBcMArwyJ5K/AmCkWv1jt77kVWyCJ6HpOuEn7z0Csc= github.com/valyala/fasttemplate v1.2.2 h1:lxLXG0uE3Qnshl9QyaK6XJxMXlQZELvChBOCmQD0Loo= github.com/valyala/fasttemplate v1.2.2/go.mod h1:KHLXt3tVN2HBp8eijSv/kGJopbvo7S+qRAEEKiv+SiQ= -github.com/vektah/gqlparser/v2 v2.5.18 h1:zSND3GtutylAQ1JpWnTHcqtaRZjl+y3NROeW8vuNo6Y= -github.com/vektah/gqlparser/v2 v2.5.18/go.mod h1:6HLzf7JKv9Fi3APymudztFQNmLXR5qJeEo6BOFcXVfc= +github.com/vektah/gqlparser/v2 v2.5.21 h1:Zw1rG2dr1pRR4wqwbVq4d6+xk2f4ut/yo+hwr4QjE08= +github.com/vektah/gqlparser/v2 v2.5.21/go.mod h1:xMl+ta8a5M1Yo1A1Iwt/k7gSpscwSnHZdw7tfhEGfTM= github.com/xeipuuv/gojsonpointer v0.0.0-20180127040702-4e3ac2762d5f/go.mod h1:N2zxlSyiKSe5eX1tZViRH5QA0qijqEDrYZiPEAiq3wU= github.com/xeipuuv/gojsonpointer v0.0.0-20190905194746-02993c407bfb h1:zGWFAtiMcyryUHoUjUJX0/lt1H2+i2Ka2n+D3DImSNo= github.com/xeipuuv/gojsonpointer v0.0.0-20190905194746-02993c407bfb/go.mod h1:N2zxlSyiKSe5eX1tZViRH5QA0qijqEDrYZiPEAiq3wU= @@ -327,50 +353,74 @@ go.uber.org/multierr v1.11.0 h1:blXXJkSxSSfBVBlC76pxqeO+LN3aDfLQo+309xJstO0= go.uber.org/multierr v1.11.0/go.mod h1:20+QtiLqy0Nd6FdQB9TLXag12DsQkrbs3htMFfDN80Y= go.uber.org/zap v1.27.0 h1:aJMhYGrd5QSmlpLMr2MftRKl7t8J8PTZPA732ud/XR8= go.uber.org/zap v1.27.0/go.mod h1:GB2qFLM7cTU87MWRP2mPIjqfIDnGu+VIO4V/SdhGo2E= +go.uber.org/zap/exp v0.3.0 h1:6JYzdifzYkGmTdRR59oYH+Ng7k49H9qVpWwNSsGJj3U= +go.uber.org/zap/exp v0.3.0/go.mod h1:5I384qq7XGxYyByIhHm6jg5CHkGY0nsTfbDLgDDlgJQ= golang.org/x/crypto v0.0.0-20180904163835-0709b304e793/go.mod h1:6SG95UA2DQfeDnfUPMdvaQW0Q7yPrPDi9nlGo2tz2b4= golang.org/x/crypto v0.0.0-20190308221718-c2843e01d9a2/go.mod h1:djNgcEr1/C05ACkg1iLfiJU5Ep61QUkGW8qpdssI0+w= -golang.org/x/crypto v0.28.0 h1:GBDwsMXVQi34v5CCYUm2jkJvu4cbtru2U4TN2PSyQnw= -golang.org/x/crypto v0.28.0/go.mod h1:rmgy+3RHxRZMyY0jjAJShp2zgEdOqj2AO7U0pYmeQ7U= -golang.org/x/mod v0.21.0 h1:vvrHzRwRfVKSiLrG+d4FMl/Qi4ukBCE6kZlTUkDYRT0= -golang.org/x/mod v0.21.0/go.mod h1:6SkKJ3Xj0I0BrPOZoBy3bdMptDDU9oJrpohJ3eWZ1fY= +golang.org/x/crypto v0.0.0-20200622213623-75b288015ac9/go.mod h1:LzIPMQfyMNhhGPhUkYOs5KpL4U8rLKemX1yGLhDgUto= +golang.org/x/crypto v0.32.0 h1:euUpcYgM8WcP71gNpTqQCn6rC2t6ULUPiOzfWaXVVfc= +golang.org/x/crypto v0.32.0/go.mod h1:ZnnJkOaASj8g0AjIduWNlq2NRxL0PlBrbKVyZ6V/Ugc= +golang.org/x/mod v0.22.0 h1:D4nJWe9zXqHOmWqj4VMOJhvzj7bEZg4wEYa759z1pH4= +golang.org/x/mod v0.22.0/go.mod h1:6SkKJ3Xj0I0BrPOZoBy3bdMptDDU9oJrpohJ3eWZ1fY= +golang.org/x/net v0.0.0-20180724234803-3673e40ba225/go.mod h1:mL1N/T3taQHkDXs73rZJwtUhF3w3ftmwwsq0BUmARs4= golang.org/x/net v0.0.0-20181114220301-adae6a3d119a/go.mod h1:mL1N/T3taQHkDXs73rZJwtUhF3w3ftmwwsq0BUmARs4= +golang.org/x/net v0.0.0-20190108225652-1e06a53dbb7e/go.mod h1:mL1N/T3taQHkDXs73rZJwtUhF3w3ftmwwsq0BUmARs4= +golang.org/x/net v0.0.0-20190404232315-eb5bcb51f2a3/go.mod h1:t9HGtf8HONx5eT2rtn7q6eTqICYqUVnKs3thJo3Qplg= golang.org/x/net v0.0.0-20190613194153-d28f0bde5980/go.mod h1:z5CRVTTTmAJ677TzLLGU+0bjPO0LkuOLi4/5GtJWs/s= -golang.org/x/net v0.30.0 h1:AcW1SDZMkb8IpzCdQUaIq2sP4sZ4zw+55h6ynffypl4= -golang.org/x/net v0.30.0/go.mod h1:2wGyMJ5iFasEhkwi13ChkO/t1ECNC4X4eBKkVFyYFlU= +golang.org/x/net v0.0.0-20200625001655-4c5254603344/go.mod h1:/O7V0waA8r7cgGh81Ro3o1hOxt32SMVPicZroKQ2sZA= +golang.org/x/net v0.34.0 h1:Mb7Mrk043xzHgnRM88suvJFwzVrRfHEHJEl5/71CKw0= +golang.org/x/net v0.34.0/go.mod h1:di0qlW3YNM5oh6GqDGQr92MyTozJPmybPK4Ev/Gm31k= +golang.org/x/oauth2 v0.0.0-20190226205417-e64efc72b421/go.mod h1:gOpvHmFTYa4IltrdGE7lF6nIHvwfUNPOp7c8zoXwtLw= golang.org/x/sync v0.0.0-20181108010431-42b317875d0f/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM= golang.org/x/sync v0.0.0-20181221193216-37e7f081c4d4/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM= golang.org/x/sync v0.0.0-20190911185100-cd5d95a43a6e/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM= -golang.org/x/sync v0.8.0 h1:3NFvSEYkUoMifnESzZl15y791HH1qU2xm6eCJU5ZPXQ= -golang.org/x/sync v0.8.0/go.mod h1:Czt+wKu1gCyEFDUtn0jG5QVvpJ6rzVqr5aXyt9drQfk= +golang.org/x/sync v0.0.0-20201207232520-09787c993a3a/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM= +golang.org/x/sync v0.10.0 h1:3NQrjDixjgGwUOCaF8w2+VYHv0Ve/vGYSbdkTa98gmQ= +golang.org/x/sync v0.10.0/go.mod h1:Czt+wKu1gCyEFDUtn0jG5QVvpJ6rzVqr5aXyt9drQfk= golang.org/x/sys v0.0.0-20180905080454-ebe1bf3edb33/go.mod h1:STP8DvDyc/dI5b8T5hshtkjS+E42TnysNCUPdjciGhY= golang.org/x/sys v0.0.0-20181116152217-5ac8a444bdc5/go.mod h1:STP8DvDyc/dI5b8T5hshtkjS+E42TnysNCUPdjciGhY= golang.org/x/sys v0.0.0-20190215142949-d0b11bdaac8a/go.mod h1:STP8DvDyc/dI5b8T5hshtkjS+E42TnysNCUPdjciGhY= +golang.org/x/sys v0.0.0-20190412213103-97732733099d/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs= golang.org/x/sys v0.0.0-20190422165155-953cdadca894/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs= golang.org/x/sys v0.0.0-20190916202348-b4ddaad3f8a3/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs= +golang.org/x/sys v0.0.0-20200106162015-b016eb3dc98e/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs= golang.org/x/sys v0.0.0-20200116001909-b77594299b42/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs= golang.org/x/sys v0.0.0-20200122134326-e047566fdf82/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs= golang.org/x/sys v0.0.0-20200223170610-d5e6a3e2c0ae/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs= +golang.org/x/sys v0.0.0-20200323222414-85ca7c5b95cd/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs= +golang.org/x/sys v0.0.0-20200615200032-f1bc736245b1/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs= +golang.org/x/sys v0.0.0-20200625212154-ddb9806d33ae/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs= golang.org/x/sys v0.0.0-20201204225414-ed752295db88/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs= +golang.org/x/sys v0.0.0-20210124154548-22da62e12c0c/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs= +golang.org/x/sys v0.0.0-20210603081109-ebe580a85c40/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= golang.org/x/sys v0.0.0-20210630005230-0f9fa26af87c/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= golang.org/x/sys v0.0.0-20210927094055-39ccf1dd6fa6/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= golang.org/x/sys v0.0.0-20220503163025-988cb79eb6c6/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= -golang.org/x/sys v0.0.0-20220811171246-fbc7d0a398ab/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= golang.org/x/sys v0.1.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= -golang.org/x/sys v0.5.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= golang.org/x/sys v0.6.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= -golang.org/x/sys v0.26.0 h1:KHjCJyddX0LoSTb3J+vWpupP9p0oznkqVk/IfjymZbo= -golang.org/x/sys v0.26.0/go.mod h1:/VUhepiaJMQUp4+oa/7Zr1D23ma6VTLIYjOOTFZPUcA= +golang.org/x/sys v0.29.0 h1:TPYlXGxvx1MGTn2GiZDhnjPA9wZzZeGKHHmKhHYvgaU= +golang.org/x/sys v0.29.0/go.mod h1:/VUhepiaJMQUp4+oa/7Zr1D23ma6VTLIYjOOTFZPUcA= golang.org/x/text v0.3.0/go.mod h1:NqM8EUOU14njkJ3fqMW+pc6Ldnwhi/IjpwHt7yyuwOQ= -golang.org/x/text v0.19.0 h1:kTxAhCbGbxhK0IwgSKiMO5awPoDQ0RpfiVYBfK860YM= -golang.org/x/text v0.19.0/go.mod h1:BuEKDfySbSR4drPmRPG/7iBdf8hvFMuRexcpahXilzY= +golang.org/x/text v0.3.2/go.mod h1:bEr9sfX3Q8Zfm5fL9x+3itogRgK3+ptLWKqgva+5dAk= +golang.org/x/text v0.21.0 h1:zyQAAkrwaneQ066sspRyJaG9VNi/YJ1NfzcGB3hZ/qo= +golang.org/x/text v0.21.0/go.mod h1:4IBbMaMmOPCJ8SecivzSH54+73PCFmPWxNTLm+vZkEQ= golang.org/x/time v0.0.0-20210220033141-f8bda1e9f3ba/go.mod h1:tRJNPiyCQ0inRvYxbN9jk5I+vvW/OXSQhTDSoE431IQ= -golang.org/x/time v0.7.0 h1:ntUhktv3OPE6TgYxXWv9vKvUSJyIFJlyohwbkEwPrKQ= -golang.org/x/time v0.7.0/go.mod h1:3BpzKBy/shNhVucY/MWOyx10tF3SFh9QdLuxbVysPQM= -golang.org/x/tools v0.26.0 h1:v/60pFQmzmT9ExmjDv2gGIfi3OqfKoEP6I5+umXlbnQ= -golang.org/x/tools v0.26.0/go.mod h1:TPVVj70c7JJ3WCazhD8OdXcZg/og+b9+tH/KxylGwH0= +golang.org/x/time v0.9.0 h1:EsRrnYcQiGH+5FfbgvV4AP7qEZstoyrHB0DzarOQ4ZY= +golang.org/x/time v0.9.0/go.mod h1:3BpzKBy/shNhVucY/MWOyx10tF3SFh9QdLuxbVysPQM= +golang.org/x/tools v0.0.0-20180917221912-90fa682c2a6e/go.mod h1:n7NCudcB/nEzxVGmLbDWY5pfWTLqBcC2KZ6jyYvM4mQ= +golang.org/x/tools v0.29.0 h1:Xx0h3TtM9rzQpQuR4dKLrdglAmCEN5Oi+P74JdhdzXE= +golang.org/x/tools v0.29.0/go.mod h1:KMQVMRsVxU6nHCFXrBPhDB8XncLNLM0lIy/F14RP588= golang.org/x/xerrors v0.0.0-20191204190536-9bdfabe68543/go.mod h1:I/5z698sn9Ka8TeJc9MKroUUfqBBauWjQqLJ2OPfmY0= -google.golang.org/protobuf v1.35.1 h1:m3LfL6/Ca+fqnjnlqQXNpFPABW1UD7mjh8KO2mKFytA= -google.golang.org/protobuf v1.35.1/go.mod h1:9fA7Ob0pmnwhb644+1+CVWFRbNajQ6iRojtC/QF5bRE= +google.golang.org/appengine v1.4.0/go.mod h1:xpcJRLb0r/rnEns0DIKYYv+WjYCduHsrkT7/EB5XEv4= +google.golang.org/protobuf v0.0.0-20200109180630-ec00e32a8dfd/go.mod h1:DFci5gLYBciE7Vtevhsrf46CRTquxDuWsQurQQe4oz8= +google.golang.org/protobuf v0.0.0-20200221191635-4d8936d0db64/go.mod h1:kwYJMbMJ01Woi6D6+Kah6886xMZcty6N08ah7+eCXa0= +google.golang.org/protobuf v0.0.0-20200228230310-ab0ca4ff8a60/go.mod h1:cfTl7dwQJ+fmap5saPgwCLgHXTUD7jkjRqWcaiX5VyM= +google.golang.org/protobuf v1.20.1-0.20200309200217-e05f789c0967/go.mod h1:A+miEFZTKqfCUM6K7xSMQL9OKL/b6hQv+e19PK+JZNE= +google.golang.org/protobuf v1.21.0/go.mod h1:47Nbq4nVaFHyn7ilMalzfO3qCViNmqZ2kzikPIcrTAo= +google.golang.org/protobuf v1.23.0/go.mod h1:EGpADcykh3NcUnDUJcl1+ZksZNG86OlYog2l/sGQquU= +google.golang.org/protobuf v1.26.0-rc.1/go.mod h1:jlhhOSvTdKEhbULTjvd4ARK9grFBp09yW+WbY/TyQbw= +google.golang.org/protobuf v1.36.3 h1:82DV7MYdb8anAVi3qge1wSnMDrnKK7ebr+I0hHRN1BU= +google.golang.org/protobuf v1.36.3/go.mod h1:9fA7Ob0pmnwhb644+1+CVWFRbNajQ6iRojtC/QF5bRE= gopkg.in/alecthomas/kingpin.v2 v2.2.6/go.mod h1:FMv+mEhP44yOT+4EoQTLFTRgOQ1FBLkstjWtayDeSgw= gopkg.in/check.v1 v0.0.0-20161208181325-20d25e280405/go.mod h1:Co6ibVJAznAaIkqp8huTwlJQCZ016jof/cbN4VW5Yz0= gopkg.in/check.v1 v1.0.0-20190902080502-41f04d3bba15/go.mod h1:Co6ibVJAznAaIkqp8huTwlJQCZ016jof/cbN4VW5Yz0= @@ -380,6 +430,7 @@ gopkg.in/yaml.v2 v2.2.1/go.mod h1:hI93XBmqTisBFMUTm0b8Fm+jr3Dg1NNxqwp+5A1VGuI= gopkg.in/yaml.v2 v2.2.2/go.mod h1:hI93XBmqTisBFMUTm0b8Fm+jr3Dg1NNxqwp+5A1VGuI= gopkg.in/yaml.v2 v2.2.4/go.mod h1:hI93XBmqTisBFMUTm0b8Fm+jr3Dg1NNxqwp+5A1VGuI= gopkg.in/yaml.v2 v2.2.5/go.mod h1:hI93XBmqTisBFMUTm0b8Fm+jr3Dg1NNxqwp+5A1VGuI= +gopkg.in/yaml.v2 v2.3.0/go.mod h1:hI93XBmqTisBFMUTm0b8Fm+jr3Dg1NNxqwp+5A1VGuI= gopkg.in/yaml.v2 v2.4.0 h1:D8xgwECY7CYvx+Y2n4sBz93Jn9JRvxdiyyo8CTfuKaY= gopkg.in/yaml.v2 v2.4.0/go.mod h1:RDklbk79AGWmwhnvt/jBztapEOGDOx6ZbXqjP6csGnQ= gopkg.in/yaml.v3 v3.0.1 h1:fxVm/GzAzEWqLHuvctI91KS9hhNmmWOoWu0XTYJS7CA= diff --git a/vendor/github.com/99designs/gqlgen/.golangci.yml b/vendor/github.com/99designs/gqlgen/.golangci.yml index 79d6627e..3c19e0fc 100644 --- a/vendor/github.com/99designs/gqlgen/.golangci.yml +++ b/vendor/github.com/99designs/gqlgen/.golangci.yml @@ -12,6 +12,12 @@ linters-settings: - paramTypeCombine - preferFprint - yodaStyleExpr + govet: + enable-all: true + disable: + - fieldalignment + - shadow + - unusedwrite # TODO: fix and enable errcheck: exclude-functions: - (io.Writer).Write @@ -59,6 +65,7 @@ linters-settings: - bool-compare - compares - empty + - encoded-compare - error-is-as - error-nil - expected-actual @@ -74,7 +81,9 @@ linters: disable-all: true enable: - bodyclose + - copyloopvar - dupl + - dupword - errcheck - gocritic - gofmt @@ -84,6 +93,7 @@ linters: - ineffassign - misspell - nakedret + - nolintlint - perfsprint - prealloc - revive diff --git a/vendor/github.com/99designs/gqlgen/LICENSE b/vendor/github.com/99designs/gqlgen/LICENSE index 10bb21c0..2287a8db 100644 --- a/vendor/github.com/99designs/gqlgen/LICENSE +++ b/vendor/github.com/99designs/gqlgen/LICENSE @@ -1,4 +1,4 @@ -Copyright (c) 2020 gqlgen authors +Copyright (c) 2025 gqlgen authors Permission is hereby granted, free of charge, to any person obtaining a copy of this software and associated documentation files (the "Software"), to deal diff --git a/vendor/github.com/99designs/gqlgen/README.md b/vendor/github.com/99designs/gqlgen/README.md index 898b658b..425f43bb 100644 --- a/vendor/github.com/99designs/gqlgen/README.md +++ b/vendor/github.com/99designs/gqlgen/README.md @@ -62,9 +62,9 @@ type User { } ``` -You need to tell gqlgen that it should only fetch friends if the user requested it. There are two ways to do this; +You need to tell gqlgen that it should only fetch friends if the user requested it. There are two ways to do this: -- #### Using Custom Models +### Using Custom Models Write a custom model that omits the friends field: @@ -84,7 +84,7 @@ models: model: github.com/you/pkg/model.User # go import path to the User struct above ``` -- #### Using Explicit Resolvers +### Using Explicit Resolvers If you want to keep using the generated model, mark the field as requiring a resolver explicitly in `gqlgen.yml` like this: diff --git a/vendor/github.com/99designs/gqlgen/TESTING.md b/vendor/github.com/99designs/gqlgen/TESTING.md index 2677b33e..bdb56f40 100644 --- a/vendor/github.com/99designs/gqlgen/TESTING.md +++ b/vendor/github.com/99designs/gqlgen/TESTING.md @@ -1,7 +1,7 @@ How to write tests for gqlgen === -Testing generated code is a little tricky, heres how its currently set up. +Testing generated code is a little tricky, here's how its currently set up. ### Testing responses from a server diff --git a/vendor/github.com/99designs/gqlgen/api/generate.go b/vendor/github.com/99designs/gqlgen/api/generate.go index 7b83be50..cca65d8f 100644 --- a/vendor/github.com/99designs/gqlgen/api/generate.go +++ b/vendor/github.com/99designs/gqlgen/api/generate.go @@ -117,16 +117,6 @@ func Generate(cfg *config.Config, option ...Option) error { return fmt.Errorf("merging type systems failed: %w", err) } - if err = codegen.GenerateCode(data); err != nil { - return fmt.Errorf("generating core failed: %w", err) - } - - if !cfg.SkipModTidy { - if err = cfg.Packages.ModTidy(); err != nil { - return fmt.Errorf("tidy failed: %w", err) - } - } - for _, p := range plugins { if mut, ok := p.(plugin.CodeGenerator); ok { err := mut.GenerateCode(data) @@ -140,6 +130,11 @@ func Generate(cfg *config.Config, option ...Option) error { return fmt.Errorf("generating core failed: %w", err) } + if !cfg.SkipModTidy { + if err = cfg.Packages.ModTidy(); err != nil { + return fmt.Errorf("tidy failed: %w", err) + } + } if !cfg.SkipValidation { if err := validate(cfg); err != nil { return fmt.Errorf("validation failed: %w", err) diff --git a/vendor/github.com/99designs/gqlgen/codegen/args.gotpl b/vendor/github.com/99designs/gqlgen/codegen/args.gotpl index 2f3afdf0..a81ea24f 100644 --- a/vendor/github.com/99designs/gqlgen/codegen/args.gotpl +++ b/vendor/github.com/99designs/gqlgen/codegen/args.gotpl @@ -1,10 +1,20 @@ +{{ $useFunctionSyntaxForExecutionContext := .Config.UseFunctionSyntaxForExecutionContext }} + {{ range $name, $args := .Args }} -func (ec *executionContext) {{ $name }}(ctx context.Context, rawArgs map[string]interface{}) (map[string]interface{}, error) { +{{ if $useFunctionSyntaxForExecutionContext -}} +func {{ $name }}(ctx context.Context, ec *executionContext, rawArgs map[string]any) (map[string]any, error) { +{{- else -}} +func (ec *executionContext) {{ $name }}(ctx context.Context, rawArgs map[string]any) (map[string]any, error) { +{{- end }} var err error - args := map[string]interface{}{} + args := map[string]any{} {{- range $i, $arg := . }} + {{ if $useFunctionSyntaxForExecutionContext -}} + arg{{$i}}, err := {{ $name }}{{$arg.Name | go}}(ctx, ec, rawArgs) + {{- else -}} arg{{$i}}, err := ec.{{ $name }}{{$arg.Name | go}}(ctx, rawArgs) + {{- end }} if err != nil { return nil, err } @@ -14,31 +24,44 @@ func (ec *executionContext) {{ $name }}(ctx context.Context, rawArgs map[string] } {{- range $i, $arg := . }} + {{ if $useFunctionSyntaxForExecutionContext -}} + func {{ $name }}{{$arg.Name | go}}( + ctx context.Context, + ec *executionContext, + rawArgs map[string]any, + ) ({{ $arg.TypeReference.GO | ref}}, error) { + {{- else -}} func (ec *executionContext) {{ $name }}{{$arg.Name | go}}( ctx context.Context, - rawArgs map[string]interface{}, + rawArgs map[string]any, ) ({{ $arg.TypeReference.GO | ref}}, error) { + {{- end }} {{- if not .CallArgumentDirectivesWithNull}} - // We won't call the directive if the argument is null. - // Set call_argument_directives_with_null to true to call directives - // even if the argument is null. - _, ok := rawArgs[{{$arg.Name|quote}}] - if !ok { + {{- /* + We won't call the directive if the argument is null. + Set call_argument_directives_with_null to true to call directives + even if the argument is null. + */ -}} + if _, ok := rawArgs[{{$arg.Name|quote}}]; !ok { var zeroVal {{ $arg.TypeReference.GO | ref}} return zeroVal, nil } {{end}} ctx = graphql.WithPathContext(ctx, graphql.NewPathWithField({{$arg.Name|quote}})) {{- if $arg.ImplDirectives }} - directive0 := func(ctx context.Context) (interface{}, error) { + directive0 := func(ctx context.Context) (any, error) { tmp, ok := rawArgs[{{$arg.Name|quote}}] if !ok { var zeroVal {{ $arg.TypeReference.GO | ref}} return zeroVal, nil } + {{ if $useFunctionSyntaxForExecutionContext -}} + return {{ $arg.TypeReference.UnmarshalFunc }}(ctx, ec, tmp) + {{- else -}} return ec.{{ $arg.TypeReference.UnmarshalFunc }}(ctx, tmp) + {{- end }} } - {{ template "implDirectives" $arg }} + {{ template "implDirectives" (dict "Field" $arg "UseFunctionSyntaxForExecutionContext" $useFunctionSyntaxForExecutionContext) }} tmp, err := directive{{$arg.ImplDirectives|len}}(ctx) if err != nil { var zeroVal {{ $arg.TypeReference.GO | ref}} @@ -57,7 +80,11 @@ func (ec *executionContext) {{ $name }}(ctx context.Context, rawArgs map[string] } {{- else }} if tmp, ok := rawArgs[{{$arg.Name|quote}}]; ok { + {{ if $useFunctionSyntaxForExecutionContext -}} + return {{ $arg.TypeReference.UnmarshalFunc }}(ctx, ec, tmp) + {{- else -}} return ec.{{ $arg.TypeReference.UnmarshalFunc }}(ctx, tmp) + {{- end }} } var zeroVal {{ $arg.TypeReference.GO | ref}} diff --git a/vendor/github.com/99designs/gqlgen/codegen/config/binder.go b/vendor/github.com/99designs/gqlgen/codegen/config/binder.go index fc7b2edc..1a0b395e 100644 --- a/vendor/github.com/99designs/gqlgen/codegen/config/binder.go +++ b/vendor/github.com/99designs/gqlgen/codegen/config/binder.go @@ -63,11 +63,11 @@ func (b *Binder) FindTypeFromName(name string) (types.Type, error) { func (b *Binder) FindType(pkgName, typeName string) (types.Type, error) { if pkgName == "" { - if typeName == "map[string]interface{}" { + if typeName == "map[string]any" || typeName == "map[string]interface{}" { return MapType, nil } - if typeName == "interface{}" { + if typeName == "any" || typeName == "interface{}" { return InterfaceType, nil } } @@ -103,11 +103,11 @@ func (b *Binder) DefaultUserObject(name string) (types.Type, error) { return nil, fmt.Errorf("%s not found in typemap", name) } - if models[0] == "map[string]interface{}" { + if models[0] == "map[string]any" || models[0] == "map[string]interface{}" { return MapType, nil } - if models[0] == "interface{}" { + if models[0] == "any" || models[0] == "interface{}" { return InterfaceType, nil } @@ -126,7 +126,7 @@ func (b *Binder) DefaultUserObject(name string) (types.Type, error) { func (b *Binder) FindObject(pkgName, typeName string) (types.Object, error) { if pkgName == "" { - return nil, errors.New("package cannot be nil") + return nil, fmt.Errorf("package cannot be nil in FindObject for type: %s", typeName) } pkg := b.pkgs.LoadWithTypes(pkgName) @@ -258,7 +258,7 @@ func (ref *TypeReference) IsPtrToSlice() bool { func (ref *TypeReference) IsPtrToIntf() bool { if ref.IsPtr() { - _, isPointerToInterface := ref.GO.(*types.Pointer).Elem().(*types.Interface) + _, isPointerToInterface := types.Unalias(ref.GO.(*types.Pointer).Elem()).(*types.Interface) return isPointerToInterface } return false @@ -344,7 +344,7 @@ func isIntf(t types.Type) bool { if t == nil { return true } - _, ok := t.(*types.Interface) + _, ok := types.Unalias(t).(*types.Interface) return ok } @@ -398,7 +398,7 @@ func (b *Binder) TypeReference(schemaType *ast.Type, bindTarget types.Type) (ret } for _, model := range b.cfg.Models[schemaType.Name()].Model { - if model == "map[string]interface{}" { + if model == "map[string]any" || model == "map[string]interface{}" { if !isMap(bindTarget) { continue } @@ -410,7 +410,7 @@ func (b *Binder) TypeReference(schemaType *ast.Type, bindTarget types.Type) (ret }, nil } - if model == "interface{}" { + if model == "any" || model == "interface{}" { if !isIntf(bindTarget) { continue } @@ -499,6 +499,7 @@ func isValid(t types.Type) bool { } func (b *Binder) CopyModifiersFromAst(t *ast.Type, base types.Type) types.Type { + base = types.Unalias(base) if t.Elem != nil { child := b.CopyModifiersFromAst(t.Elem, base) if _, isStruct := child.Underlying().(*types.Struct); isStruct && !b.cfg.OmitSliceElementPointers { @@ -528,11 +529,11 @@ func IsNilable(t types.Type) bool { return IsNilable(namedType.Underlying()) } _, isPtr := t.(*types.Pointer) - _, isMap := t.(*types.Map) + _, isNilableMap := t.(*types.Map) _, isInterface := t.(*types.Interface) _, isSlice := t.(*types.Slice) _, isChan := t.(*types.Chan) - return isPtr || isMap || isInterface || isSlice || isChan + return isPtr || isNilableMap || isInterface || isSlice || isChan } func hasMethod(it types.Type, name string) bool { @@ -553,8 +554,9 @@ func hasMethod(it types.Type, name string) bool { } func basicUnderlying(it types.Type) *types.Basic { + it = types.Unalias(it) if ptr, isPtr := it.(*types.Pointer); isPtr { - it = ptr.Elem() + it = types.Unalias(ptr.Elem()) } namedType, ok := it.(*types.Named) if !ok { diff --git a/vendor/github.com/99designs/gqlgen/codegen/config/config.go b/vendor/github.com/99designs/gqlgen/codegen/config/config.go index 761e3524..f02fb24b 100644 --- a/vendor/github.com/99designs/gqlgen/codegen/config/config.go +++ b/vendor/github.com/99designs/gqlgen/codegen/config/config.go @@ -22,30 +22,31 @@ import ( ) type Config struct { - SchemaFilename StringList `yaml:"schema,omitempty"` - Exec ExecConfig `yaml:"exec"` - Model PackageConfig `yaml:"model,omitempty"` - Federation PackageConfig `yaml:"federation,omitempty"` - Resolver ResolverConfig `yaml:"resolver,omitempty"` - AutoBind []string `yaml:"autobind"` - Models TypeMap `yaml:"models,omitempty"` - StructTag string `yaml:"struct_tag,omitempty"` - Directives map[string]DirectiveConfig `yaml:"directives,omitempty"` - GoBuildTags StringList `yaml:"go_build_tags,omitempty"` - GoInitialisms GoInitialismsConfig `yaml:"go_initialisms,omitempty"` - OmitSliceElementPointers bool `yaml:"omit_slice_element_pointers,omitempty"` - OmitGetters bool `yaml:"omit_getters,omitempty"` - OmitInterfaceChecks bool `yaml:"omit_interface_checks,omitempty"` - OmitComplexity bool `yaml:"omit_complexity,omitempty"` - OmitGQLGenFileNotice bool `yaml:"omit_gqlgen_file_notice,omitempty"` - OmitGQLGenVersionInFileNotice bool `yaml:"omit_gqlgen_version_in_file_notice,omitempty"` - OmitRootModels bool `yaml:"omit_root_models,omitempty"` - OmitResolverFields bool `yaml:"omit_resolver_fields,omitempty"` - OmitPanicHandler bool `yaml:"omit_panic_handler,omitempty"` + SchemaFilename StringList `yaml:"schema,omitempty"` + Exec ExecConfig `yaml:"exec"` + Model PackageConfig `yaml:"model,omitempty"` + Federation PackageConfig `yaml:"federation,omitempty"` + Resolver ResolverConfig `yaml:"resolver,omitempty"` + AutoBind []string `yaml:"autobind"` + Models TypeMap `yaml:"models,omitempty"` + StructTag string `yaml:"struct_tag,omitempty"` + Directives map[string]DirectiveConfig `yaml:"directives,omitempty"` + GoBuildTags StringList `yaml:"go_build_tags,omitempty"` + GoInitialisms GoInitialismsConfig `yaml:"go_initialisms,omitempty"` + OmitSliceElementPointers bool `yaml:"omit_slice_element_pointers,omitempty"` + OmitGetters bool `yaml:"omit_getters,omitempty"` + OmitInterfaceChecks bool `yaml:"omit_interface_checks,omitempty"` + OmitComplexity bool `yaml:"omit_complexity,omitempty"` + OmitGQLGenFileNotice bool `yaml:"omit_gqlgen_file_notice,omitempty"` + OmitGQLGenVersionInFileNotice bool `yaml:"omit_gqlgen_version_in_file_notice,omitempty"` + OmitRootModels bool `yaml:"omit_root_models,omitempty"` + OmitResolverFields bool `yaml:"omit_resolver_fields,omitempty"` + OmitPanicHandler bool `yaml:"omit_panic_handler,omitempty"` + UseFunctionSyntaxForExecutionContext bool `yaml:"use_function_syntax_for_execution_context,omitempty"` // If this is set to true, argument directives that // decorate a field with a null value will still be called. // - // This enables argumment directives to not just mutate + // This enables argument directives to not just mutate // argument values but to set them even if they're null. CallArgumentDirectivesWithNull bool `yaml:"call_argument_directives_with_null,omitempty"` StructFieldsAlwaysPointers bool `yaml:"struct_fields_always_pointers,omitempty"` @@ -228,6 +229,7 @@ func (c *Config) Init() error { if c.Packages == nil { c.Packages = code.NewPackages( code.WithBuildTags(c.GoBuildTags...), + code.PackagePrefixToCache("github.com/99designs/gqlgen/graphql"), ) } @@ -645,7 +647,10 @@ func (tm TypeMap) ReferencedPackages() []string { for _, typ := range tm { for _, model := range typ.Model { - if model == "map[string]interface{}" || model == "interface{}" { + if model == "map[string]any" || + model == "map[string]interface{}" || + model == "any" || + model == "interface{}" { continue } pkg, _ := code.PkgAndType(model) @@ -807,11 +812,15 @@ func (c *Config) injectBuiltins() { "Float": {Model: StringList{"github.com/99designs/gqlgen/graphql.FloatContext"}}, "String": {Model: StringList{"github.com/99designs/gqlgen/graphql.String"}}, "Boolean": {Model: StringList{"github.com/99designs/gqlgen/graphql.Boolean"}}, - "Int": {Model: StringList{ - "github.com/99designs/gqlgen/graphql.Int", - "github.com/99designs/gqlgen/graphql.Int32", - "github.com/99designs/gqlgen/graphql.Int64", - }}, + "Int": { + // FIXME: using int / int64 for Int is not spec compliant and introduces + // security risks. We should default to int32. + Model: StringList{ + "github.com/99designs/gqlgen/graphql.Int", + "github.com/99designs/gqlgen/graphql.Int32", + "github.com/99designs/gqlgen/graphql.Int64", + }, + }, "ID": { Model: StringList{ "github.com/99designs/gqlgen/graphql.ID", @@ -828,6 +837,12 @@ func (c *Config) injectBuiltins() { // These are additional types that are injected if defined in the schema as scalars. extraBuiltins := TypeMap{ + "Int64": { + Model: StringList{ + "github.com/99designs/gqlgen/graphql.Int", + "github.com/99designs/gqlgen/graphql.Int64", + }, + }, "Time": {Model: StringList{"github.com/99designs/gqlgen/graphql.Time"}}, "Map": {Model: StringList{"github.com/99designs/gqlgen/graphql.Map"}}, "Upload": {Model: StringList{"github.com/99designs/gqlgen/graphql.Upload"}}, @@ -845,6 +860,7 @@ func (c *Config) LoadSchema() error { if c.Packages != nil { c.Packages = code.NewPackages( code.WithBuildTags(c.GoBuildTags...), + code.PackagePrefixToCache("github.com/99designs/gqlgen/graphql"), ) } diff --git a/vendor/github.com/99designs/gqlgen/codegen/config/exec.go b/vendor/github.com/99designs/gqlgen/codegen/config/exec.go index 838e17b2..37ec2c30 100644 --- a/vendor/github.com/99designs/gqlgen/codegen/config/exec.go +++ b/vendor/github.com/99designs/gqlgen/codegen/config/exec.go @@ -20,6 +20,12 @@ type ExecConfig struct { // Only for follow-schema layout: FilenameTemplate string `yaml:"filename_template,omitempty"` // String template with {name} as placeholder for base name. DirName string `yaml:"dir"` + + // Maximum number of goroutines in concurrency to use when running multiple child resolvers + // Suppressing the number of goroutines generated can reduce memory consumption per request, + // but processing time may increase due to the reduced number of concurrences + // Default: 0 (unlimited) + WorkerLimit uint `yaml:"worker_limit"` } type ExecLayout string diff --git a/vendor/github.com/99designs/gqlgen/codegen/config/resolver.go b/vendor/github.com/99designs/gqlgen/codegen/config/resolver.go index 1901fd2d..fa0744e1 100644 --- a/vendor/github.com/99designs/gqlgen/codegen/config/resolver.go +++ b/vendor/github.com/99designs/gqlgen/codegen/config/resolver.go @@ -19,6 +19,7 @@ type ResolverConfig struct { DirName string `yaml:"dir"` OmitTemplateComment bool `yaml:"omit_template_comment,omitempty"` ResolverTemplate string `yaml:"resolver_template,omitempty"` + PreserveResolver bool `yaml:"preserve_resolver,omitempty"` } type ResolverLayout string diff --git a/vendor/github.com/99designs/gqlgen/codegen/directive.go b/vendor/github.com/99designs/gqlgen/codegen/directive.go index 077bd9f7..f7a7c1c8 100644 --- a/vendor/github.com/99designs/gqlgen/codegen/directive.go +++ b/vendor/github.com/99designs/gqlgen/codegen/directive.go @@ -2,7 +2,6 @@ package codegen import ( "fmt" - "strconv" "strings" "github.com/vektah/gqlparser/v2/ast" @@ -143,7 +142,7 @@ func (d *Directive) CallArgs() string { args := []string{"ctx", "obj", "n"} for _, arg := range d.Args { - args = append(args, "args["+strconv.Quote(arg.Name)+"].("+templates.CurrentImports.LookupType(arg.TypeReference.GO)+")") + args = append(args, fmt.Sprintf("args[%q].(%s)", arg.Name, templates.CurrentImports.LookupType(arg.TypeReference.GO))) } return strings.Join(args, ", ") @@ -169,13 +168,13 @@ func (d *Directive) CallName() string { } func (d *Directive) Declaration() string { - res := d.CallName() + " func(ctx context.Context, obj interface{}, next graphql.Resolver" + res := d.CallName() + " func(ctx context.Context, obj any, next graphql.Resolver" for _, arg := range d.Args { res += fmt.Sprintf(", %s %s", templates.ToGoPrivate(arg.Name), templates.CurrentImports.LookupType(arg.TypeReference.GO)) } - res += ") (res interface{}, err error)" + res += ") (res any, err error)" return res } diff --git a/vendor/github.com/99designs/gqlgen/codegen/directives.gotpl b/vendor/github.com/99designs/gqlgen/codegen/directives.gotpl index c3fa8abe..e575c3d6 100644 --- a/vendor/github.com/99designs/gqlgen/codegen/directives.gotpl +++ b/vendor/github.com/99designs/gqlgen/codegen/directives.gotpl @@ -1,16 +1,28 @@ -{{ define "implDirectives" }}{{ $in := .DirectiveObjName }} - {{ $zeroVal := .TypeReference.GO | ref}} - {{- range $i, $directive := .ImplDirectives -}} - directive{{add $i 1}} := func(ctx context.Context) (interface{}, error) { +{{ $useFunctionSyntaxForExecutionContext := .Config.UseFunctionSyntaxForExecutionContext }} + +{{ define "implDirectives" }} + {{ $in := .Field.DirectiveObjName }} + {{ $useFunctionSyntaxForExecutionContext := .UseFunctionSyntaxForExecutionContext }} + {{ $zeroVal := .Field.TypeReference.GO | ref}} + {{- range $i, $directive := .Field.ImplDirectives -}} + directive{{add $i 1}} := func(ctx context.Context) (any, error) { {{- range $arg := $directive.Args }} {{- if notNil "Value" $arg }} + {{ if $useFunctionSyntaxForExecutionContext -}} + {{ $arg.VarName }}, err := {{ $arg.TypeReference.UnmarshalFunc }}(ctx, ec, {{ $arg.Value | dump }}) + {{- else -}} {{ $arg.VarName }}, err := ec.{{ $arg.TypeReference.UnmarshalFunc }}(ctx, {{ $arg.Value | dump }}) + {{- end }} if err != nil{ var zeroVal {{$zeroVal}} return zeroVal, err } {{- else if notNil "Default" $arg }} + {{ if $useFunctionSyntaxForExecutionContext -}} + {{ $arg.VarName }}, err := {{ $arg.TypeReference.UnmarshalFunc }}(ctx, ec, {{ $arg.Default | dump }}) + {{- else -}} {{ $arg.VarName }}, err := ec.{{ $arg.TypeReference.UnmarshalFunc }}(ctx, {{ $arg.Default | dump }}) + {{- end }} if err != nil{ var zeroVal {{$zeroVal}} return zeroVal, err @@ -29,20 +41,25 @@ {{ end }} {{define "queryDirectives"}} + {{ $useFunctionSyntaxForExecutionContext := .UseFunctionSyntaxForExecutionContext }} for _, d := range obj.Directives { switch d.Name { - {{- range $directive := . }} + {{- range $directive := .DirectiveList }} case "{{$directive.Name}}": {{- if $directive.Args }} rawArgs := d.ArgumentMap(ec.Variables) + {{ if $useFunctionSyntaxForExecutionContext -}} + args, err := {{ $directive.ArgsFunc }}(ctx,ec,rawArgs) + {{- else -}} args, err := ec.{{ $directive.ArgsFunc }}(ctx,rawArgs) + {{- end }} if err != nil { ec.Error(ctx, err) return graphql.Null } {{- end }} n := next - next = func(ctx context.Context) (interface{}, error) { + next = func(ctx context.Context) (any, error) { {{- template "callDirective" $directive -}} } {{- end }} @@ -70,26 +87,42 @@ {{end}} {{ if .Directives.LocationDirectives "QUERY" }} -func (ec *executionContext) _queryMiddleware(ctx context.Context, obj *ast.OperationDefinition, next func(ctx context.Context) (interface{}, error)) graphql.Marshaler { - {{ template "queryDirectives" .Directives.LocationDirectives "QUERY" }} +{{ if $useFunctionSyntaxForExecutionContext -}} +func _queryMiddleware(ctx context.Context, ec *executionContext, obj *ast.OperationDefinition, next func(ctx context.Context) (any, error)) graphql.Marshaler { +{{- else -}} +func (ec *executionContext) _queryMiddleware(ctx context.Context, obj *ast.OperationDefinition, next func(ctx context.Context) (any, error)) graphql.Marshaler { +{{- end }} + {{ template "queryDirectives" (dict "DirectiveList" (.Directives.LocationDirectives "QUERY") "UseFunctionSyntaxForExecutionContext" $useFunctionSyntaxForExecutionContext) }} } {{ end }} {{ if .Directives.LocationDirectives "MUTATION" }} -func (ec *executionContext) _mutationMiddleware(ctx context.Context, obj *ast.OperationDefinition, next func(ctx context.Context) (interface{}, error)) graphql.Marshaler { - {{ template "queryDirectives" .Directives.LocationDirectives "MUTATION" }} +{{ if $useFunctionSyntaxForExecutionContext -}} +func _mutationMiddleware(ctx context.Context, ec *executionContext, obj *ast.OperationDefinition, next func(ctx context.Context) (any, error)) graphql.Marshaler { +{{- else -}} +func (ec *executionContext) _mutationMiddleware(ctx context.Context, obj *ast.OperationDefinition, next func(ctx context.Context) (any, error)) graphql.Marshaler { +{{- end }} + {{ template "queryDirectives" (dict "DirectiveList" (.Directives.LocationDirectives "MUTATION") "UseFunctionSyntaxForExecutionContext" $useFunctionSyntaxForExecutionContext) }} } {{ end }} {{ if .Directives.LocationDirectives "SUBSCRIPTION" }} -func (ec *executionContext) _subscriptionMiddleware(ctx context.Context, obj *ast.OperationDefinition, next func(ctx context.Context) (interface{}, error)) func(ctx context.Context) graphql.Marshaler { +{{ if $useFunctionSyntaxForExecutionContext -}} +func _subscriptionMiddleware(ctx context.Context, ec *executionContext, obj *ast.OperationDefinition, next func(ctx context.Context) (any, error)) func(ctx context.Context) graphql.Marshaler { +{{- else -}} +func (ec *executionContext) _subscriptionMiddleware(ctx context.Context, obj *ast.OperationDefinition, next func(ctx context.Context) (any, error)) func(ctx context.Context) graphql.Marshaler { +{{- end }} for _, d := range obj.Directives { switch d.Name { {{- range $directive := .Directives.LocationDirectives "SUBSCRIPTION" }} case "{{$directive.Name}}": {{- if $directive.Args }} rawArgs := d.ArgumentMap(ec.Variables) + {{ if $useFunctionSyntaxForExecutionContext -}} + args, err := {{ $directive.ArgsFunc }}(ctx,ec,rawArgs) + {{- else -}} args, err := ec.{{ $directive.ArgsFunc }}(ctx,rawArgs) + {{- end }} if err != nil { ec.Error(ctx, err) return func(ctx context.Context) graphql.Marshaler { @@ -98,7 +131,7 @@ func (ec *executionContext) _subscriptionMiddleware(ctx context.Context, obj *as } {{- end }} n := next - next = func(ctx context.Context) (interface{}, error) { + next = func(ctx context.Context) (any, error) { {{- template "callDirective" $directive -}} } {{- end }} @@ -122,7 +155,11 @@ func (ec *executionContext) _subscriptionMiddleware(ctx context.Context, obj *as {{ end }} {{ if .Directives.LocationDirectives "FIELD" }} - func (ec *executionContext) _fieldMiddleware(ctx context.Context, obj interface{}, next graphql.Resolver) interface{} { + {{ if $useFunctionSyntaxForExecutionContext -}} + func _fieldMiddleware(ctx context.Context, ec *executionContext, obj any, next graphql.Resolver) any { + {{- else -}} + func (ec *executionContext) _fieldMiddleware(ctx context.Context, obj any, next graphql.Resolver) any { + {{- end }} {{- if .Directives.LocationDirectives "FIELD" }} fc := graphql.GetFieldContext(ctx) for _, d := range fc.Field.Directives { @@ -131,14 +168,18 @@ func (ec *executionContext) _subscriptionMiddleware(ctx context.Context, obj *as case "{{$directive.Name}}": {{- if $directive.Args }} rawArgs := d.ArgumentMap(ec.Variables) + {{ if $useFunctionSyntaxForExecutionContext -}} + args, err := {{ $directive.ArgsFunc }}(ctx,ec,rawArgs) + {{- else -}} args, err := ec.{{ $directive.ArgsFunc }}(ctx,rawArgs) + {{- end }} if err != nil { ec.Error(ctx, err) return nil } {{- end }} n := next - next = func(ctx context.Context) (interface{}, error) { + next = func(ctx context.Context) (any, error) { {{- template "callDirective" $directive -}} } {{- end }} diff --git a/vendor/github.com/99designs/gqlgen/codegen/field.go b/vendor/github.com/99designs/gqlgen/codegen/field.go index 7f4a5ad1..c3870592 100644 --- a/vendor/github.com/99designs/gqlgen/codegen/field.go +++ b/vendor/github.com/99designs/gqlgen/codegen/field.go @@ -30,7 +30,7 @@ type Field struct { Args []*FieldArgument // A list of arguments to be passed to this field MethodHasContext bool // If this is bound to a go method, does the method also take a context NoErr bool // If this is bound to a go method, does that method have an error as the second argument - VOkFunc bool // If this is bound to a go method, is it of shape (interface{}, bool) + VOkFunc bool // If this is bound to a go method, is it of shape (any, bool) Object *Object // A link back to the parent object Default any // The default value Stream bool // does this field return a channel? @@ -602,11 +602,11 @@ func (f *Field) CallArgs() string { if iface, ok := arg.TypeReference.GO.(*types.Interface); ok && iface.Empty() { tmp = fmt.Sprintf(` - func () interface{} { + func () any { if fc.Args["%s"] == nil { return nil } - return fc.Args["%s"].(interface{}) + return fc.Args["%s"].(any) }()`, arg.Name, arg.Name, ) } diff --git a/vendor/github.com/99designs/gqlgen/codegen/field.gotpl b/vendor/github.com/99designs/gqlgen/codegen/field.gotpl index 4bf5c13d..1c7ba70a 100644 --- a/vendor/github.com/99designs/gqlgen/codegen/field.gotpl +++ b/vendor/github.com/99designs/gqlgen/codegen/field.gotpl @@ -1,11 +1,21 @@ +{{ $useFunctionSyntaxForExecutionContext := .Config.UseFunctionSyntaxForExecutionContext }} + {{- range $object := .Objects }}{{- range $field := $object.Fields }} +{{ if $useFunctionSyntaxForExecutionContext -}} +func _{{$object.Name}}_{{$field.Name}}(ctx context.Context, ec *executionContext, field graphql.CollectedField{{ if not $object.Root }}, obj {{$object.Reference | ref}}{{end}}) (ret {{ if $object.Stream }}func(ctx context.Context){{ end }}graphql.Marshaler) { +{{- else -}} func (ec *executionContext) _{{$object.Name}}_{{$field.Name}}(ctx context.Context, field graphql.CollectedField{{ if not $object.Root }}, obj {{$object.Reference | ref}}{{end}}) (ret {{ if $object.Stream }}func(ctx context.Context){{ end }}graphql.Marshaler) { +{{- end }} {{- $null := "graphql.Null" }} {{- if $object.Stream }} {{- $null = "nil" }} {{- end }} + {{ if $useFunctionSyntaxForExecutionContext -}} + fc, err := {{ $field.FieldContextFunc }}(ctx, ec, field) + {{- else -}} fc, err := ec.{{ $field.FieldContextFunc }}(ctx, field) + {{- end }} if err != nil { return {{ $null }} } @@ -25,15 +35,23 @@ func (ec *executionContext) _{{$object.Name}}_{{$field.Name}}(ctx context.Contex res := {{ $field.TypeReference.GO | ref }}{} {{- end }} fc.Result = res + {{ if $useFunctionSyntaxForExecutionContext -}} + return {{ $field.TypeReference.MarshalFunc }}(ctx, ec, field.Selections, res) + {{- else -}} return ec.{{ $field.TypeReference.MarshalFunc }}(ctx, field.Selections, res) + {{- end }} {{- else}} {{- if $.AllDirectives.LocationDirectives "FIELD" }} - resTmp := ec._fieldMiddleware(ctx, {{if $object.Root}}nil{{else}}obj{{end}}, func(rctx context.Context) (interface{}, error) { - {{ template "field" $field }} + {{ if $useFunctionSyntaxForExecutionContext -}} + resTmp := _fieldMiddleware(ctx, ec, {{if $object.Root}}nil{{else}}obj{{end}}, func(rctx context.Context) (any, error) { + {{- else -}} + resTmp := ec._fieldMiddleware(ctx, {{if $object.Root}}nil{{else}}obj{{end}}, func(rctx context.Context) (any, error) { + {{- end }} + {{ template "field" (dict "Field" $field "UseFunctionSyntaxForExecutionContext" $useFunctionSyntaxForExecutionContext) }} }) {{ else }} - resTmp, err := ec.ResolverMiddleware(ctx, func(rctx context.Context) (interface{}, error) { - {{ template "field" $field }} + resTmp, err := ec.ResolverMiddleware(ctx, func(rctx context.Context) (any, error) { + {{ template "field" (dict "Field" $field "UseFunctionSyntaxForExecutionContext" $useFunctionSyntaxForExecutionContext) }} }) if err != nil { ec.Error(ctx, err) @@ -59,7 +77,11 @@ func (ec *executionContext) _{{$object.Name}}_{{$field.Name}}(ctx context.Contex w.Write([]byte{'{'}) graphql.MarshalString(field.Alias).MarshalGQL(w) w.Write([]byte{':'}) + {{ if $useFunctionSyntaxForExecutionContext -}} + {{ $field.TypeReference.MarshalFunc }}(ctx, ec, field.Selections, res).MarshalGQL(w) + {{- else -}} ec.{{ $field.TypeReference.MarshalFunc }}(ctx, field.Selections, res).MarshalGQL(w) + {{- end }} w.Write([]byte{'}'}) }) case <-ctx.Done(): @@ -69,12 +91,20 @@ func (ec *executionContext) _{{$object.Name}}_{{$field.Name}}(ctx context.Contex {{- else }} res := resTmp.({{$field.TypeReference.GO | ref}}) fc.Result = res + {{ if $useFunctionSyntaxForExecutionContext -}} + return {{ $field.TypeReference.MarshalFunc }}(ctx, ec, field.Selections, res) + {{- else -}} return ec.{{ $field.TypeReference.MarshalFunc }}(ctx, field.Selections, res) + {{- end }} {{- end }} {{- end }} } +{{ if $useFunctionSyntaxForExecutionContext -}} +func {{ $field.FieldContextFunc }}({{ if not $field.Args }}_{{ else }}ctx{{ end }} context.Context, ec *executionContext, field graphql.CollectedField) (fc *graphql.FieldContext, err error) { +{{- else -}} func (ec *executionContext) {{ $field.FieldContextFunc }}({{ if not $field.Args }}_{{ else }}ctx{{ end }} context.Context, field graphql.CollectedField) (fc *graphql.FieldContext, err error) { +{{- end }} fc = &graphql.FieldContext{ Object: {{quote $field.Object.Name}}, Field: field, @@ -89,7 +119,11 @@ func (ec *executionContext) {{ $field.FieldContextFunc }}({{ if not $field.Args switch field.Name { {{- range $f := $field.TypeReference.Definition.Fields }} case "{{ $f.Name }}": + {{ if $useFunctionSyntaxForExecutionContext -}} + return {{ $field.ChildFieldContextFunc $f.Name }}(ctx, ec, field) + {{- else -}} return ec.{{ $field.ChildFieldContextFunc $f.Name }}(ctx, field) + {{- end }} {{- end }} } return nil, fmt.Errorf("no field named %q was found under type {{ $field.TypeReference.Definition.Name }}", field.Name) @@ -106,7 +140,11 @@ func (ec *executionContext) {{ $field.FieldContextFunc }}({{ if not $field.Args }() {{- end }} ctx = graphql.WithFieldContext(ctx, fc) + {{ if $useFunctionSyntaxForExecutionContext -}} + if fc.Args, err = {{ $field.ArgsFunc }}(ctx, ec, field.ArgumentMap(ec.Variables)); err != nil { + {{- else -}} if fc.Args, err = ec.{{ $field.ArgsFunc }}(ctx, field.ArgumentMap(ec.Variables)); err != nil { + {{- end }} ec.Error(ctx, err) return fc, err } @@ -117,26 +155,27 @@ func (ec *executionContext) {{ $field.FieldContextFunc }}({{ if not $field.Args {{- end }}{{- end}} {{ define "field" }} - {{- if .HasDirectives -}} - directive0 := func(rctx context.Context) (interface{}, error) { + {{- $useFunctionSyntaxForExecutionContext := .UseFunctionSyntaxForExecutionContext -}} + {{- if .Field.HasDirectives -}} + directive0 := func(rctx context.Context) (any, error) { ctx = rctx // use context from middleware stack in children - {{ template "fieldDefinition" . }} + {{ template "fieldDefinition" .Field }} } - {{ template "implDirectives" . }} - tmp, err := directive{{.ImplDirectives|len}}(rctx) + {{ template "implDirectives" (dict "Field" .Field "UseFunctionSyntaxForExecutionContext" $useFunctionSyntaxForExecutionContext) }} + tmp, err := directive{{.Field.ImplDirectives|len}}(rctx) if err != nil { return nil, graphql.ErrorOnPath(ctx, err) } if tmp == nil { return nil, nil } - if data, ok := tmp.({{if .Stream}}<-chan {{end}}{{ .TypeReference.GO | ref }}) ; ok { + if data, ok := tmp.({{if .Field.Stream}}<-chan {{end}}{{ .Field.TypeReference.GO | ref }}) ; ok { return data, nil } - return nil, fmt.Errorf(`unexpected type %T from directive, should be {{if .Stream}}<-chan {{end}}{{ .TypeReference.GO }}`, tmp) + return nil, fmt.Errorf(`unexpected type %T from directive, should be {{if .Field.Stream}}<-chan {{end}}{{ .Field.TypeReference.GO }}`, tmp) {{- else -}} ctx = rctx // use context from middleware stack in children - {{ template "fieldDefinition" . }} + {{ template "fieldDefinition" .Field }} {{- end -}} {{ end }} diff --git a/vendor/github.com/99designs/gqlgen/codegen/generate.go b/vendor/github.com/99designs/gqlgen/codegen/generate.go index bbd4d947..3d88b045 100644 --- a/vendor/github.com/99designs/gqlgen/codegen/generate.go +++ b/vendor/github.com/99designs/gqlgen/codegen/generate.go @@ -4,9 +4,7 @@ import ( "embed" "errors" "fmt" - "os" "path/filepath" - "runtime" "strings" "github.com/vektah/gqlparser/v2/ast" @@ -129,24 +127,18 @@ func addBuild(filename string, p *ast.Position, data *Data, builds *map[string]* } } +//go:embed root_.gotpl +var rootTemplate string + // Root file contains top-level definitions that should not be duplicated across the generated // files for each schema file. func generateRootFile(data *Data) error { dir := data.Config.Exec.DirName path := filepath.Join(dir, "root_.generated.go") - _, thisFile, _, _ := runtime.Caller(0) - rootDir := filepath.Dir(thisFile) - templatePath := filepath.Join(rootDir, "root_.gotpl") - templateBytes, err := os.ReadFile(templatePath) - if err != nil { - return err - } - template := string(templateBytes) - return templates.Render(templates.Options{ PackageName: data.Config.Exec.Package, - Template: template, + Template: rootTemplate, Filename: path, Data: data, RegionTags: false, diff --git a/vendor/github.com/99designs/gqlgen/codegen/generated!.gotpl b/vendor/github.com/99designs/gqlgen/codegen/generated!.gotpl index 1e5bfbfc..8a31d2b5 100644 --- a/vendor/github.com/99designs/gqlgen/codegen/generated!.gotpl +++ b/vendor/github.com/99designs/gqlgen/codegen/generated!.gotpl @@ -10,11 +10,14 @@ {{ reserveImport "bytes" }} {{ reserveImport "embed" }} +{{ reserveImport "golang.org/x/sync/semaphore"}} {{ reserveImport "github.com/vektah/gqlparser/v2" "gqlparser" }} {{ reserveImport "github.com/vektah/gqlparser/v2/ast" }} {{ reserveImport "github.com/99designs/gqlgen/graphql" }} {{ reserveImport "github.com/99designs/gqlgen/graphql/introspection" }} +{{ $useFunctionSyntaxForExecutionContext := .Config.UseFunctionSyntaxForExecutionContext }} + {{ if eq .Config.Exec.Layout "single-file" }} // NewExecutableSchema creates an ExecutableSchema from the ResolverRoot interface. func NewExecutableSchema(cfg Config) graphql.ExecutableSchema { @@ -115,7 +118,7 @@ return parsedSchema } - func (e *executableSchema) Complexity(typeName, field string, childComplexity int, rawArgs map[string]interface{}) (int, bool) { + func (e *executableSchema) Complexity(typeName, field string, childComplexity int, rawArgs map[string]any) (int, bool) { ec := executionContext{nil, e, 0, 0, nil} _ = ec {{ if not .Config.OmitComplexity -}} @@ -132,7 +135,11 @@ break } {{ if $field.Args }} + {{ if $useFunctionSyntaxForExecutionContext -}} + args, err := {{ $field.ArgsFunc }}(context.TODO(), &ec, rawArgs) + {{- else -}} args, err := ec.{{ $field.ArgsFunc }}(context.TODO(),rawArgs) + {{- end }} if err != nil { return 0, false } @@ -150,18 +157,22 @@ } func (e *executableSchema) Exec(ctx context.Context) graphql.ResponseHandler { - rc := graphql.GetOperationContext(ctx) - ec := executionContext{rc, e, 0, 0, make(chan graphql.DeferredResult)} + opCtx := graphql.GetOperationContext(ctx) + ec := executionContext{opCtx, e, 0, 0, make(chan graphql.DeferredResult)} inputUnmarshalMap := graphql.BuildUnmarshalerMap( {{- range $input := .Inputs -}} {{ if not $input.HasUnmarshal }} + {{ if $useFunctionSyntaxForExecutionContext -}} + unmarshalInput{{ $input.Name }}, + {{- else -}} ec.unmarshalInput{{ $input.Name }}, + {{- end }} {{- end }} {{- end }} ) first := true - switch rc.Operation.Operation { + switch opCtx.Operation.Operation { {{- if .QueryRoot }} case ast.Query: return func(ctx context.Context) *graphql.Response { var response graphql.Response @@ -170,11 +181,20 @@ first = false ctx = graphql.WithUnmarshalerMap(ctx, inputUnmarshalMap) {{ if .Directives.LocationDirectives "QUERY" -}} - data = ec._queryMiddleware(ctx, rc.Operation, func(ctx context.Context) (interface{}, error){ - return ec._{{.QueryRoot.Name}}(ctx, rc.Operation.SelectionSet), nil + {{ if $useFunctionSyntaxForExecutionContext -}} + data = _queryMiddleware(ctx, &ec, opCtx.Operation, func(ctx context.Context) (any, error){ + return _{{.QueryRoot.Name}}(ctx, ec, opCtx.Operation.SelectionSet), nil + {{- else -}} + data = ec._queryMiddleware(ctx, opCtx.Operation, func(ctx context.Context) (any, error){ + return ec._{{.QueryRoot.Name}}(ctx, opCtx.Operation.SelectionSet), nil + {{- end }} }) {{- else -}} - data = ec._{{.QueryRoot.Name}}(ctx, rc.Operation.SelectionSet) + {{ if $useFunctionSyntaxForExecutionContext -}} + data = _{{.QueryRoot.Name}}(ctx, &ec, opCtx.Operation.SelectionSet) + {{- else -}} + data = ec._{{.QueryRoot.Name}}(ctx, opCtx.Operation.SelectionSet) + {{- end }} {{- end }} } else { if atomic.LoadInt32(&ec.pendingDeferred) > 0 { @@ -206,11 +226,20 @@ first = false ctx = graphql.WithUnmarshalerMap(ctx, inputUnmarshalMap) {{ if .Directives.LocationDirectives "MUTATION" -}} - data := ec._mutationMiddleware(ctx, rc.Operation, func(ctx context.Context) (interface{}, error){ - return ec._{{.MutationRoot.Name}}(ctx, rc.Operation.SelectionSet), nil + {{ if $useFunctionSyntaxForExecutionContext -}} + data := _mutationMiddleware(ctx, &ec, opCtx.Operation, func(ctx context.Context) (any, error){ + return _{{.MutationRoot.Name}}(ctx, ec, opCtx.Operation.SelectionSet), nil + {{- else -}} + data := ec._mutationMiddleware(ctx, opCtx.Operation, func(ctx context.Context) (any, error){ + return ec._{{.MutationRoot.Name}}(ctx, opCtx.Operation.SelectionSet), nil + {{- end }} }) {{- else -}} - data := ec._{{.MutationRoot.Name}}(ctx, rc.Operation.SelectionSet) + {{ if $useFunctionSyntaxForExecutionContext -}} + data := _{{.MutationRoot.Name}}(ctx, &ec, opCtx.Operation.SelectionSet) + {{- else -}} + data := ec._{{.MutationRoot.Name}}(ctx, opCtx.Operation.SelectionSet) + {{- end }} {{- end }} var buf bytes.Buffer data.MarshalGQL(&buf) @@ -223,11 +252,20 @@ {{- if .SubscriptionRoot }} case ast.Subscription: {{ if .Directives.LocationDirectives "SUBSCRIPTION" -}} - next := ec._subscriptionMiddleware(ctx, rc.Operation, func(ctx context.Context) (interface{}, error){ - return ec._{{.SubscriptionRoot.Name}}(ctx, rc.Operation.SelectionSet),nil + {{ if $useFunctionSyntaxForExecutionContext -}} + next := _subscriptionMiddleware(ctx, &ec, opCtx.Operation, func(ctx context.Context) (any, error){ + return _{{.SubscriptionRoot.Name}}(ctx, ec, opCtx.Operation.SelectionSet),nil + {{- else -}} + next := ec._subscriptionMiddleware(ctx, opCtx.Operation, func(ctx context.Context) (any, error){ + return ec._{{.SubscriptionRoot.Name}}(ctx, opCtx.Operation.SelectionSet),nil + {{- end }} }) {{- else -}} - next := ec._{{.SubscriptionRoot.Name}}(ctx, rc.Operation.SelectionSet) + {{ if $useFunctionSyntaxForExecutionContext -}} + next := _{{.SubscriptionRoot.Name}}(ctx, &ec, opCtx.Operation.SelectionSet) + {{- else -}} + next := ec._{{.SubscriptionRoot.Name}}(ctx, opCtx.Operation.SelectionSet) + {{- end }} {{- end }} var buf bytes.Buffer diff --git a/vendor/github.com/99designs/gqlgen/codegen/input.gotpl b/vendor/github.com/99designs/gqlgen/codegen/input.gotpl index 1b91d8db..6b674b6f 100644 --- a/vendor/github.com/99designs/gqlgen/codegen/input.gotpl +++ b/vendor/github.com/99designs/gqlgen/codegen/input.gotpl @@ -1,17 +1,23 @@ +{{ $useFunctionSyntaxForExecutionContext := .Config.UseFunctionSyntaxForExecutionContext }} + {{- range $input := .Inputs }} {{- if not .HasUnmarshal }} {{- $it := "it" }} {{- if .PointersInUnmarshalInput }} {{- $it = "&it" }} {{- end }} - func (ec *executionContext) unmarshalInput{{ .Name }}(ctx context.Context, obj interface{}) ({{ if .PointersInUnmarshalInput }}*{{ end }}{{.Type | ref}}, error) { + {{ if $useFunctionSyntaxForExecutionContext -}} + func unmarshalInput{{ .Name }}(ctx context.Context, ec *executionContext, obj any) ({{ if .PointersInUnmarshalInput }}*{{ end }}{{.Type | ref}}, error) { + {{- else -}} + func (ec *executionContext) unmarshalInput{{ .Name }}(ctx context.Context, obj any) ({{ if .PointersInUnmarshalInput }}*{{ end }}{{.Type | ref}}, error) { + {{- end }} {{- if $input.IsMap }} - it := make(map[string]interface{}, len(obj.(map[string]interface{}))) + it := make(map[string]any, len(obj.(map[string]any))) {{- else }} var it {{.Type | ref}} {{- end }} - asMap := map[string]interface{}{} - for k, v := range obj.(map[string]interface{}) { + asMap := map[string]any{} + for k, v := range obj.(map[string]any) { asMap[k] = v } {{ range $field := .Fields}} @@ -37,8 +43,12 @@ {{- end }} ctx := graphql.WithPathContext(ctx, graphql.NewPathWithField({{$field.Name|quote}})) {{- if $field.ImplDirectives }} - directive0 := func(ctx context.Context) (interface{}, error) { return ec.{{ $field.TypeReference.UnmarshalFunc }}(ctx, v) } - {{ template "implDirectives" $field }} + {{ if $useFunctionSyntaxForExecutionContext -}} + directive0 := func(ctx context.Context) (any, error) { return {{ $field.TypeReference.UnmarshalFunc }}(ctx, ec, v) } + {{- else -}} + directive0 := func(ctx context.Context) (any, error) { return ec.{{ $field.TypeReference.UnmarshalFunc }}(ctx, v) } + {{- end }} + {{ template "implDirectives" (dict "Field" $field "UseFunctionSyntaxForExecutionContext" $useFunctionSyntaxForExecutionContext) }} tmp, err := directive{{$field.ImplDirectives|len}}(ctx) if err != nil { return {{$it}}, graphql.ErrorOnPath(ctx, err) @@ -71,7 +81,11 @@ } {{- else }} {{- if $field.IsResolver }} + {{ if $useFunctionSyntaxForExecutionContext -}} + data, err := {{ $field.TypeReference.UnmarshalFunc }}(ctx, ec, v) + {{- else -}} data, err := ec.{{ $field.TypeReference.UnmarshalFunc }}(ctx, v) + {{- end }} if err != nil { return {{$it}}, err } @@ -79,7 +93,11 @@ return {{$it}}, err } {{- else }} + {{ if $useFunctionSyntaxForExecutionContext -}} + data, err := {{ $field.TypeReference.UnmarshalFunc }}(ctx, ec, v) + {{- else -}} data, err := ec.{{ $field.TypeReference.UnmarshalFunc }}(ctx, v) + {{- end }} if err != nil { return {{$it}}, err } diff --git a/vendor/github.com/99designs/gqlgen/codegen/interface.gotpl b/vendor/github.com/99designs/gqlgen/codegen/interface.gotpl index e9d560c8..ee975a51 100644 --- a/vendor/github.com/99designs/gqlgen/codegen/interface.gotpl +++ b/vendor/github.com/99designs/gqlgen/codegen/interface.gotpl @@ -1,6 +1,12 @@ +{{ $useFunctionSyntaxForExecutionContext := .Config.UseFunctionSyntaxForExecutionContext }} + {{- range $interface := .Interfaces }} +{{ if $useFunctionSyntaxForExecutionContext -}} +func _{{$interface.Name}}(ctx context.Context, ec *executionContext, sel ast.SelectionSet, obj {{$interface.Type | ref}}) graphql.Marshaler { +{{- else -}} func (ec *executionContext) _{{$interface.Name}}(ctx context.Context, sel ast.SelectionSet, obj {{$interface.Type | ref}}) graphql.Marshaler { +{{- end }} switch obj := (obj).(type) { case nil: return graphql.Null @@ -11,7 +17,11 @@ func (ec *executionContext) _{{$interface.Name}}(ctx context.Context, sel ast.Se return graphql.Null } {{- end }} + {{ if $useFunctionSyntaxForExecutionContext -}} + return _{{$implementor.Name}}(ctx, ec, sel, {{ if $implementor.TakeRef }}&{{ end }}obj) + {{- else -}} return ec._{{$implementor.Name}}(ctx, sel, {{ if $implementor.TakeRef }}&{{ end }}obj) + {{- end }} {{- end }} default: panic(fmt.Errorf("unexpected type %T", obj)) diff --git a/vendor/github.com/99designs/gqlgen/codegen/object.gotpl b/vendor/github.com/99designs/gqlgen/codegen/object.gotpl index 09689a27..f42d3574 100644 --- a/vendor/github.com/99designs/gqlgen/codegen/object.gotpl +++ b/vendor/github.com/99designs/gqlgen/codegen/object.gotpl @@ -1,9 +1,15 @@ +{{ $useFunctionSyntaxForExecutionContext := .Config.UseFunctionSyntaxForExecutionContext }} + {{- range $object := .Objects }} var {{ $object.Name|lcFirst}}Implementors = {{$object.Implementors}} {{- if .Stream }} +{{ if $useFunctionSyntaxForExecutionContext -}} +func _{{$object.Name}}(ctx context.Context, ec *executionContext, sel ast.SelectionSet) func(ctx context.Context) graphql.Marshaler { +{{- else -}} func (ec *executionContext) _{{$object.Name}}(ctx context.Context, sel ast.SelectionSet) func(ctx context.Context) graphql.Marshaler { +{{- end }} fields := graphql.CollectFields(ec.OperationContext, sel, {{$object.Name|lcFirst}}Implementors) ctx = graphql.WithFieldContext(ctx, &graphql.FieldContext{ Object: {{$object.Name|quote}}, @@ -16,14 +22,23 @@ func (ec *executionContext) _{{$object.Name}}(ctx context.Context, sel ast.Selec switch fields[0].Name { {{- range $field := $object.Fields }} case "{{$field.Name}}": + {{ if $useFunctionSyntaxForExecutionContext -}} + return _{{$object.Name}}_{{$field.Name}}(ctx, ec, fields[0]) + {{- else -}} return ec._{{$object.Name}}_{{$field.Name}}(ctx, fields[0]) + {{- end }} {{- end }} default: panic("unknown field " + strconv.Quote(fields[0].Name)) } } {{- else }} + +{{ if $useFunctionSyntaxForExecutionContext -}} +func _{{$object.Name}}(ctx context.Context, ec *executionContext, sel ast.SelectionSet{{ if not $object.Root }},obj {{$object.Reference | ref }}{{ end }}) graphql.Marshaler { +{{- else -}} func (ec *executionContext) _{{$object.Name}}(ctx context.Context, sel ast.SelectionSet{{ if not $object.Root }},obj {{$object.Reference | ref }}{{ end }}) graphql.Marshaler { +{{- end }} fields := graphql.CollectFields(ec.OperationContext, sel, {{$object.Name|lcFirst}}Implementors) {{- if $object.Root }} ctx = graphql.WithFieldContext(ctx, &graphql.FieldContext{ @@ -56,7 +71,11 @@ func (ec *executionContext) _{{$object.Name}}(ctx context.Context, sel ast.Selec } }() {{- end }} + {{ if $useFunctionSyntaxForExecutionContext -}} + res = _{{$object.Name}}_{{$field.Name}}(ctx, ec, field{{if not $object.Root}}, obj{{end}}) + {{- else -}} res = ec._{{$object.Name}}_{{$field.Name}}(ctx, field{{if not $object.Root}}, obj{{end}}) + {{- end }} {{- if $field.TypeReference.GQL.NonNull }} if res == graphql.Null { {{- if $object.IsConcurrent }} @@ -107,10 +126,18 @@ func (ec *executionContext) _{{$object.Name}}(ctx context.Context, sel ast.Selec {{- else }} {{- if $object.Root -}} out.Values[i] = ec.OperationContext.RootResolverMiddleware(innerCtx, func(ctx context.Context) (res graphql.Marshaler) { + {{ if $useFunctionSyntaxForExecutionContext -}} + return _{{$object.Name}}_{{$field.Name}}(ctx, ec, field) + {{- else -}} return ec._{{$object.Name}}_{{$field.Name}}(ctx, field) + {{- end }} }) {{- else -}} + {{ if $useFunctionSyntaxForExecutionContext -}} + out.Values[i] = _{{$object.Name}}_{{$field.Name}}(ctx, ec, field, obj) + {{- else -}} out.Values[i] = ec._{{$object.Name}}_{{$field.Name}}(ctx, field, obj) + {{- end }} {{- end -}} {{- if $field.TypeReference.GQL.NonNull }} diff --git a/vendor/github.com/99designs/gqlgen/codegen/root_.gotpl b/vendor/github.com/99designs/gqlgen/codegen/root_.gotpl index d392ef53..3988a695 100644 --- a/vendor/github.com/99designs/gqlgen/codegen/root_.gotpl +++ b/vendor/github.com/99designs/gqlgen/codegen/root_.gotpl @@ -15,6 +15,8 @@ {{ reserveImport "github.com/99designs/gqlgen/graphql" }} {{ reserveImport "github.com/99designs/gqlgen/graphql/introspection" }} +{{ $useFunctionSyntaxForExecutionContext := .Config.UseFunctionSyntaxForExecutionContext }} + // NewExecutableSchema creates an ExecutableSchema from the ResolverRoot interface. func NewExecutableSchema(cfg Config) graphql.ExecutableSchema { return &executableSchema{ @@ -88,7 +90,7 @@ func (e *executableSchema) Schema() *ast.Schema { return parsedSchema } -func (e *executableSchema) Complexity(typeName, field string, childComplexity int, rawArgs map[string]interface{}) (int, bool) { +func (e *executableSchema) Complexity(typeName, field string, childComplexity int, rawArgs map[string]any) (int, bool) { ec := executionContext{nil, e, 0, 0, nil} _ = ec {{- if not .Config.OmitComplexity }} @@ -105,7 +107,11 @@ func (e *executableSchema) Complexity(typeName, field string, childComplexity in break } {{ if $field.Args }} + {{ if $useFunctionSyntaxForExecutionContext -}} + args, err := {{ $field.ArgsFunc }}(context.TODO(), &ec, rawArgs) + {{- else -}} args, err := ec.{{ $field.ArgsFunc }}(context.TODO(),rawArgs) + {{- end }} if err != nil { return 0, false } @@ -123,18 +129,22 @@ func (e *executableSchema) Complexity(typeName, field string, childComplexity in } func (e *executableSchema) Exec(ctx context.Context) graphql.ResponseHandler { - rc := graphql.GetOperationContext(ctx) - ec := executionContext{rc, e, 0, 0, make(chan graphql.DeferredResult)} + opCtx := graphql.GetOperationContext(ctx) + ec := executionContext{opCtx, e, 0, 0, make(chan graphql.DeferredResult)} inputUnmarshalMap := graphql.BuildUnmarshalerMap( {{- range $input := .Inputs -}} {{ if not $input.HasUnmarshal }} + {{ if $useFunctionSyntaxForExecutionContext -}} + unmarshalInput{{ $input.Name }}, + {{- else -}} ec.unmarshalInput{{ $input.Name }}, + {{- end }} {{- end }} {{- end }} ) first := true - switch rc.Operation.Operation { + switch opCtx.Operation.Operation { {{- if .QueryRoot }} case ast.Query: return func(ctx context.Context) *graphql.Response { var response graphql.Response @@ -143,11 +153,20 @@ func (e *executableSchema) Exec(ctx context.Context) graphql.ResponseHandler { first = false ctx = graphql.WithUnmarshalerMap(ctx, inputUnmarshalMap) {{ if .Directives.LocationDirectives "QUERY" -}} - data = ec._queryMiddleware(ctx, rc.Operation, func(ctx context.Context) (interface{}, error){ - return ec._{{.QueryRoot.Name}}(ctx, rc.Operation.SelectionSet), nil + {{ if $useFunctionSyntaxForExecutionContext -}} + data = _queryMiddleware(ctx, ec, opCtx.Operation, func(ctx context.Context) (any, error){ + return _{{.QueryRoot.Name}}(ctx, &ec, opCtx.Operation.SelectionSet), nil + {{- else -}} + data = ec._queryMiddleware(ctx, opCtx.Operation, func(ctx context.Context) (any, error){ + return ec._{{.QueryRoot.Name}}(ctx, opCtx.Operation.SelectionSet), nil + {{- end }} }) {{- else -}} - data = ec._{{.QueryRoot.Name}}(ctx, rc.Operation.SelectionSet) + {{ if $useFunctionSyntaxForExecutionContext -}} + data = _{{.QueryRoot.Name}}(ctx, &ec, opCtx.Operation.SelectionSet) + {{- else -}} + data = ec._{{.QueryRoot.Name}}(ctx, opCtx.Operation.SelectionSet) + {{- end }} {{- end }} } else { if atomic.LoadInt32(&ec.pendingDeferred) > 0 { @@ -179,11 +198,20 @@ func (e *executableSchema) Exec(ctx context.Context) graphql.ResponseHandler { first = false ctx = graphql.WithUnmarshalerMap(ctx, inputUnmarshalMap) {{ if .Directives.LocationDirectives "MUTATION" -}} - data := ec._mutationMiddleware(ctx, rc.Operation, func(ctx context.Context) (interface{}, error){ - return ec._{{.MutationRoot.Name}}(ctx, rc.Operation.SelectionSet), nil + {{ if $useFunctionSyntaxForExecutionContext -}} + data := _mutationMiddleware(ctx, &ec, opCtx.Operation, func(ctx context.Context) (any, error){ + return _{{.MutationRoot.Name}}(ctx, ec, opCtx.Operation.SelectionSet), nil + {{- else -}} + data := ec._mutationMiddleware(ctx, opCtx.Operation, func(ctx context.Context) (any, error){ + return ec._{{.MutationRoot.Name}}(ctx, opCtx.Operation.SelectionSet), nil + {{- end }} }) {{- else -}} - data := ec._{{.MutationRoot.Name}}(ctx, rc.Operation.SelectionSet) + {{ if $useFunctionSyntaxForExecutionContext -}} + data := _{{.MutationRoot.Name}}(ctx, &ec, opCtx.Operation.SelectionSet) + {{- else -}} + data := ec._{{.MutationRoot.Name}}(ctx, opCtx.Operation.SelectionSet) + {{- end }} {{- end }} var buf bytes.Buffer data.MarshalGQL(&buf) @@ -196,11 +224,20 @@ func (e *executableSchema) Exec(ctx context.Context) graphql.ResponseHandler { {{- if .SubscriptionRoot }} case ast.Subscription: {{ if .Directives.LocationDirectives "SUBSCRIPTION" -}} - next := ec._subscriptionMiddleware(ctx, rc.Operation, func(ctx context.Context) (interface{}, error){ - return ec._{{.SubscriptionRoot.Name}}(ctx, rc.Operation.SelectionSet),nil + {{ if $useFunctionSyntaxForExecutionContext -}} + next := _subscriptionMiddleware(ctx, &ec, opCtx.Operation, func(ctx context.Context) (any, error){ + return _{{.SubscriptionRoot.Name}}(ctx, ec, opCtx.Operation.SelectionSet),nil + {{- else -}} + next := ec._subscriptionMiddleware(ctx, opCtx.Operation, func(ctx context.Context) (any, error){ + return ec._{{.SubscriptionRoot.Name}}(ctx, opCtx.Operation.SelectionSet),nil + {{- end }} }) {{- else -}} - next := ec._{{.SubscriptionRoot.Name}}(ctx, rc.Operation.SelectionSet) + {{ if $useFunctionSyntaxForExecutionContext -}} + next := _{{.SubscriptionRoot.Name}}(ctx, &ec, opCtx.Operation.SelectionSet) + {{- else -}} + next := ec._{{.SubscriptionRoot.Name}}(ctx, opCtx.Operation.SelectionSet) + {{- end }} {{- end }} var buf bytes.Buffer diff --git a/vendor/github.com/99designs/gqlgen/codegen/templates/templates.go b/vendor/github.com/99designs/gqlgen/codegen/templates/templates.go index 9b6e4cfb..ec30256b 100644 --- a/vendor/github.com/99designs/gqlgen/codegen/templates/templates.go +++ b/vendor/github.com/99designs/gqlgen/codegen/templates/templates.go @@ -205,6 +205,7 @@ func Funcs() template.FuncMap { "obj": obj, "ts": TypeIdentifier, "call": Call, + "dict": dict, "prefixLines": prefixLines, "notNil": notNil, "strSplit": StrSplit, @@ -247,7 +248,13 @@ func isDelimiter(c rune) bool { } func ref(p types.Type) string { - return CurrentImports.LookupType(p) + typeString := CurrentImports.LookupType(p) + // TODO(steve): figure out why this is needed + // otherwise inconsistent sometimes + if typeString == "interface{}" { + return "any" + } + return typeString } func obj(obj types.Object) string { @@ -274,6 +281,21 @@ func Call(p *types.Func) string { return pkg + p.Name() } +func dict(values ...any) (map[string]any, error) { + if len(values)%2 != 0 { + return nil, errors.New("invalid dict call: arguments must be key-value pairs") + } + m := make(map[string]any, len(values)/2) + for i := 0; i < len(values); i += 2 { + key, ok := values[i].(string) + if !ok { + return nil, errors.New("dict keys must be strings") + } + m[key] = values[i+1] + } + return m, nil +} + func resetModelNames() { modelNamesMu.Lock() defer modelNamesMu.Unlock() @@ -606,10 +628,10 @@ func Dump(val any) string { for _, part := range val { parts = append(parts, Dump(part)) } - return "[]interface{}{" + strings.Join(parts, ",") + "}" + return "[]any{" + strings.Join(parts, ",") + "}" case map[string]any: buf := bytes.Buffer{} - buf.WriteString("map[string]interface{}{") + buf.WriteString("map[string]any{") var keys []string for key := range val { keys = append(keys, key) diff --git a/vendor/github.com/99designs/gqlgen/codegen/type.gotpl b/vendor/github.com/99designs/gqlgen/codegen/type.gotpl index 1898d444..d69a7ef2 100644 --- a/vendor/github.com/99designs/gqlgen/codegen/type.gotpl +++ b/vendor/github.com/99designs/gqlgen/codegen/type.gotpl @@ -1,14 +1,23 @@ +{{ $useFunctionSyntaxForExecutionContext := .Config.UseFunctionSyntaxForExecutionContext }} {{- range $type := .ReferencedTypes }} {{ with $type.UnmarshalFunc }} - func (ec *executionContext) {{ . }}(ctx context.Context, v interface{}) ({{ $type.GO | ref }}, error) { + {{ if $useFunctionSyntaxForExecutionContext -}} + func {{ . }}(ctx context.Context, ec *executionContext, v any) ({{ $type.GO | ref }}, error) { + {{- else -}} + func (ec *executionContext) {{ . }}(ctx context.Context, v any) ({{ $type.GO | ref }}, error) { + {{- end -}} {{- if and $type.IsNilable (not $type.GQL.NonNull) (not $type.IsPtrToPtr) }} if v == nil { return nil, nil } {{- end }} {{- if or $type.IsPtrToSlice $type.IsPtrToIntf }} + {{ if $useFunctionSyntaxForExecutionContext -}} + res, err := {{ $type.Elem.UnmarshalFunc }}(ctx, ec, v) + {{- else -}} res, err := ec.{{ $type.Elem.UnmarshalFunc }}(ctx, v) + {{- end }} return &res, graphql.ErrorOnPath(ctx, err) {{- else if $type.IsSlice }} - var vSlice []interface{} + var vSlice []any if v != nil { vSlice = graphql.CoerceList(v) } @@ -16,7 +25,11 @@ res := make([]{{$type.GO.Elem | ref}}, len(vSlice)) for i := range vSlice { ctx := graphql.WithPathContext(ctx, graphql.NewPathWithIndex(i)) + {{ if $useFunctionSyntaxForExecutionContext -}} + res[i], err = {{ $type.Elem.UnmarshalFunc }}(ctx, ec, vSlice[i]) + {{- else -}} res[i], err = ec.{{ $type.Elem.UnmarshalFunc }}(ctx, vSlice[i]) + {{- end }} if err != nil { return nil, err } @@ -25,7 +38,11 @@ {{- else if and $type.IsPtrToPtr (not $type.Unmarshaler) (not $type.IsMarshaler) }} var pres {{ $type.Elem.GO | ref }} if v != nil { + {{ if $useFunctionSyntaxForExecutionContext -}} + res, err := {{ $type.Elem.UnmarshalFunc }}(ctx, ec, v) + {{- else -}} res, err := ec.{{ $type.Elem.UnmarshalFunc }}(ctx, v) + {{- end }} if err != nil { return nil, graphql.ErrorOnPath(ctx, err) } @@ -75,7 +92,11 @@ {{- end }} return res, graphql.ErrorOnPath(ctx, err) {{- else }} + {{ if $useFunctionSyntaxForExecutionContext -}} + res, err := unmarshalInput{{ $type.GQL.Name }}(ctx, ec, v) + {{- else -}} res, err := ec.unmarshalInput{{ $type.GQL.Name }}(ctx, v) + {{- end }} {{- if and $type.IsNilable (not $type.IsMap) (not $type.PointersInUnmarshalInput) }} return &res, graphql.ErrorOnPath(ctx, err) {{- else if and (not $type.IsNilable) $type.PointersInUnmarshalInput }} @@ -89,9 +110,17 @@ {{- end }} {{ with $type.MarshalFunc }} + {{ if $useFunctionSyntaxForExecutionContext -}} + func {{ . }}(ctx context.Context, ec *executionContext, sel ast.SelectionSet, v {{ $type.GO | ref }}) graphql.Marshaler { + {{- else -}} func (ec *executionContext) {{ . }}(ctx context.Context, sel ast.SelectionSet, v {{ $type.GO | ref }}) graphql.Marshaler { + {{- end -}} {{- if or $type.IsPtrToSlice $type.IsPtrToIntf }} + {{ if $useFunctionSyntaxForExecutionContext -}} + return {{ $type.Elem.MarshalFunc }}(ctx, ec, sel, *v) + {{- else -}} return ec.{{ $type.Elem.MarshalFunc }}(ctx, sel, *v) + {{- end }} {{- else if $type.IsSlice }} {{- if not $type.GQL.NonNull }} if v == nil { @@ -101,6 +130,9 @@ ret := make(graphql.Array, len(v)) {{- if not $type.IsScalar }} var wg sync.WaitGroup + {{- if gt $.Config.Exec.WorkerLimit 0 }} + sm := semaphore.NewWeighted({{ $.Config.Exec.WorkerLimit }}) + {{- end }} isLen1 := len(v) == 1 if !isLen1 { wg.Add(len(v)) @@ -124,17 +156,40 @@ }() {{- end }} if !isLen1 { - defer wg.Done() + {{- if gt $.Config.Exec.WorkerLimit 0 }} + defer func(){ + sm.Release(1) + wg.Done() + }() + {{- else }} + defer wg.Done() + {{- end }} } + {{ if $useFunctionSyntaxForExecutionContext -}} + ret[i] = {{ $type.Elem.MarshalFunc }}(ctx, ec, sel, v[i]) + {{- else -}} ret[i] = ec.{{ $type.Elem.MarshalFunc }}(ctx, sel, v[i]) + {{- end }} } if isLen1 { f(i) } else { - go f(i) + {{- if gt $.Config.Exec.WorkerLimit 0 }} + if err := sm.Acquire(ctx, 1); err != nil { + ec.Error(ctx, ctx.Err()) + } else { + go f(i) + } + {{- else }} + go f(i) + {{- end }} } {{ else }} + {{ if $useFunctionSyntaxForExecutionContext -}} + ret[i] = {{ $type.Elem.MarshalFunc }}(ctx, ec, sel, v[i]) + {{- else -}} ret[i] = ec.{{ $type.Elem.MarshalFunc }}(ctx, sel, v[i]) + {{- end }} {{- end }} } {{ if not $type.IsScalar }} wg.Wait() {{ end }} @@ -150,7 +205,11 @@ if v == nil { return graphql.Null } + {{ if $useFunctionSyntaxForExecutionContext -}} + return {{ $type.Elem.MarshalFunc }}(ctx, ec, sel, *v) + {{- else -}} return ec.{{ $type.Elem.MarshalFunc }}(ctx, sel, *v) + {{- end }} {{- else }} {{- if $type.IsNilable }} if v == nil { @@ -195,13 +254,25 @@ {{- end }} {{- else if $type.IsRoot }} {{- if eq $type.Definition.Name "Subscription" }} + {{ if $useFunctionSyntaxForExecutionContext -}} + res := _{{$type.Definition.Name}}(ctx, ec, sel) + {{- else -}} res := ec._{{$type.Definition.Name}}(ctx, sel) + {{- end }} return res(ctx) {{- else }} + {{ if $useFunctionSyntaxForExecutionContext -}} + return _{{$type.Definition.Name}}(ctx, ec, sel) + {{- else -}} return ec._{{$type.Definition.Name}}(ctx, sel) + {{- end }} {{- end }} {{- else }} + {{ if $useFunctionSyntaxForExecutionContext -}} + return _{{$type.Definition.Name}}(ctx, ec, sel, {{ if not $type.IsNilable}}&{{end}} v) + {{- else -}} return ec._{{$type.Definition.Name}}(ctx, sel, {{ if not $type.IsNilable}}&{{end}} v) + {{- end }} {{- end }} {{- end }} } diff --git a/vendor/github.com/99designs/gqlgen/graphql/cache.go b/vendor/github.com/99designs/gqlgen/graphql/cache.go index 8804cfe0..836d9868 100644 --- a/vendor/github.com/99designs/gqlgen/graphql/cache.go +++ b/vendor/github.com/99designs/gqlgen/graphql/cache.go @@ -23,9 +23,13 @@ func (m MapCache[T]) Get(_ context.Context, key string) (value T, ok bool) { // Add adds a value to the cache. func (m MapCache[T]) Add(_ context.Context, key string, value T) { m[key] = value } -type NoCache[T any, T2 *T] struct{} +type NoCache[T any] struct{} -var _ Cache[*string] = (*NoCache[string, *string])(nil) +var _ Cache[string] = (*NoCache[string])(nil) -func (n NoCache[T, T2]) Get(_ context.Context, _ string) (value T2, ok bool) { return nil, false } -func (n NoCache[T, T2]) Add(_ context.Context, _ string, _ T2) {} +func (n NoCache[T]) Get(_ context.Context, _ string) (value T, ok bool) { + var val T + return val, false +} + +func (n NoCache[T]) Add(_ context.Context, _ string, _ T) {} diff --git a/vendor/github.com/99designs/gqlgen/graphql/context_field.go b/vendor/github.com/99designs/gqlgen/graphql/context_field.go index b3fab910..dbb8d9e9 100644 --- a/vendor/github.com/99designs/gqlgen/graphql/context_field.go +++ b/vendor/github.com/99designs/gqlgen/graphql/context_field.go @@ -34,16 +34,16 @@ type FieldContext struct { // Note that, the returned child FieldContext represents the context as it was // before the execution of the field resolver. For example: // - // srv.AroundFields(func(ctx context.Context, next graphql.Resolver) (interface{}, error) { + // srv.AroundFields(func(ctx context.Context, next graphql.Resolver) (any, error) { // fc := graphql.GetFieldContext(ctx) - // op := graphql.GetOperationContext(ctx) + // opCtx := graphql.GetOperationContext(ctx) // collected := graphql.CollectFields(opCtx, fc.Field.Selections, []string{"User"}) // // child, err := fc.Child(ctx, collected[0]) // if err != nil { // return nil, err // } - // fmt.Println("child context %q with args: %v", child.Field.Name, child.Args) + // fmt.Printf("child context %q with args: %v\n", child.Field.Name, child.Args) // // return next(ctx) // }) diff --git a/vendor/github.com/99designs/gqlgen/graphql/context_operation.go b/vendor/github.com/99designs/gqlgen/graphql/context_operation.go index d515acce..718809a4 100644 --- a/vendor/github.com/99designs/gqlgen/graphql/context_operation.go +++ b/vendor/github.com/99designs/gqlgen/graphql/context_operation.go @@ -65,8 +65,8 @@ func GetOperationContext(ctx context.Context) *OperationContext { panic("missing operation context") } -func WithOperationContext(ctx context.Context, rc *OperationContext) context.Context { - return context.WithValue(ctx, operationCtx, rc) +func WithOperationContext(ctx context.Context, opCtx *OperationContext) context.Context { + return context.WithValue(ctx, operationCtx, opCtx) } // HasOperationContext checks if the given context is part of an ongoing operation @@ -77,7 +77,7 @@ func HasOperationContext(ctx context.Context) bool { return ok && val != nil } -// This is just a convenient wrapper method for CollectFields +// CollectFieldsCtx is just a convenient wrapper method for CollectFields. func CollectFieldsCtx(ctx context.Context, satisfies []string) []CollectedField { resctx := GetFieldContext(ctx) return CollectFields(GetOperationContext(ctx), resctx.Field.Selections, satisfies) diff --git a/vendor/github.com/99designs/gqlgen/graphql/context_response.go b/vendor/github.com/99designs/gqlgen/graphql/context_response.go index e0f3285f..340a4048 100644 --- a/vendor/github.com/99designs/gqlgen/graphql/context_response.go +++ b/vendor/github.com/99designs/gqlgen/graphql/context_response.go @@ -51,6 +51,9 @@ func AddErrorf(ctx context.Context, format string, args ...any) { // AddError sends an error to the client, first passing it through the error presenter. func AddError(ctx context.Context, err error) { + if err == nil { + return + } c := getResponseContext(ctx) presentedError := c.errorPresenter(ctx, ErrorOnPath(ctx, err)) diff --git a/vendor/github.com/99designs/gqlgen/graphql/error.go b/vendor/github.com/99designs/gqlgen/graphql/error.go index f816bef6..bfcecd9a 100644 --- a/vendor/github.com/99designs/gqlgen/graphql/error.go +++ b/vendor/github.com/99designs/gqlgen/graphql/error.go @@ -10,6 +10,9 @@ import ( type ErrorPresenterFunc func(ctx context.Context, err error) *gqlerror.Error func DefaultErrorPresenter(ctx context.Context, err error) *gqlerror.Error { + if err == nil { + return nil + } var gqlErr *gqlerror.Error if errors.As(err, &gqlErr) { return gqlErr diff --git a/vendor/github.com/99designs/gqlgen/graphql/executable_schema.go b/vendor/github.com/99designs/gqlgen/graphql/executable_schema.go index aa9d7c44..03d25aab 100644 --- a/vendor/github.com/99designs/gqlgen/graphql/executable_schema.go +++ b/vendor/github.com/99designs/gqlgen/graphql/executable_schema.go @@ -17,8 +17,7 @@ type ExecutableSchema interface { } // CollectFields returns the set of fields from an ast.SelectionSet where all collected fields satisfy at least one of the GraphQL types -// passed through satisfies. Providing an empty or nil slice for satisfies will return collect all fields regardless of fragment -// type conditions. +// passed through satisfies. Providing an empty slice for satisfies will collect all fields regardless of fragment type conditions. func CollectFields(reqCtx *OperationContext, selSet ast.SelectionSet, satisfies []string) []CollectedField { return collectFields(reqCtx, selSet, satisfies, map[string]bool{}) } @@ -39,13 +38,22 @@ func collectFields(reqCtx *OperationContext, selSet ast.SelectionSet, satisfies f.Selections = append(f.Selections, sel.SelectionSet...) case *ast.InlineFragment: - if !shouldIncludeNode(sel.Directives, reqCtx.Variables) { - continue - } - if len(satisfies) > 0 && !instanceOf(sel.TypeCondition, satisfies) { + // To allow simplified "collect all" types behavior, pass an empty list + // of types that the type condition must satisfy: we will apply the + // fragment regardless of type condition. + // + // When the type condition is not set (... { field }) we will apply the + // fragment to any satisfying types. + // + // We will only NOT apply the fragment when we have at least one type in + // the list we must satisfy and a type condition to compare them to. + if len(satisfies) > 0 && sel.TypeCondition != "" && !instanceOf(sel.TypeCondition, satisfies) { continue } + if !shouldIncludeNode(sel.Directives, reqCtx.Variables) { + continue + } shouldDefer, label := deferrable(sel.Directives, reqCtx.Variables) for _, childField := range collectFields(reqCtx, sel.SelectionSet, satisfies, visited) { @@ -61,9 +69,6 @@ func collectFields(reqCtx *OperationContext, selSet ast.SelectionSet, satisfies } case *ast.FragmentSpread: - if !shouldIncludeNode(sel.Directives, reqCtx.Variables) { - continue - } fragmentName := sel.Name if _, seen := visited[fragmentName]; seen { continue @@ -80,6 +85,9 @@ func collectFields(reqCtx *OperationContext, selSet ast.SelectionSet, satisfies continue } + if !shouldIncludeNode(sel.Directives, reqCtx.Variables) { + continue + } shouldDefer, label := deferrable(sel.Directives, reqCtx.Variables) for _, childField := range collectFields(reqCtx, fragment.SelectionSet, satisfies, visited) { diff --git a/vendor/github.com/99designs/gqlgen/graphql/executor/executor.go b/vendor/github.com/99designs/gqlgen/graphql/executor/executor.go index 566b0476..1a58914d 100644 --- a/vendor/github.com/99designs/gqlgen/graphql/executor/executor.go +++ b/vendor/github.com/99designs/gqlgen/graphql/executor/executor.go @@ -7,6 +7,7 @@ import ( "github.com/vektah/gqlparser/v2/gqlerror" "github.com/vektah/gqlparser/v2/parser" "github.com/vektah/gqlparser/v2/validator" + "github.com/vektah/gqlparser/v2/validator/rules" "github.com/99designs/gqlgen/graphql" "github.com/99designs/gqlgen/graphql/errcode" @@ -24,7 +25,8 @@ type Executor struct { recoverFunc graphql.RecoverFunc queryCache graphql.Cache[*ast.QueryDocument] - parserTokenLimit int + parserTokenLimit int + disableSuggestion bool } var _ graphql.GraphExecutor = &Executor{} @@ -36,7 +38,7 @@ func New(es graphql.ExecutableSchema) *Executor { es: es, errorPresenter: graphql.DefaultErrorPresenter, recoverFunc: graphql.DefaultRecover, - queryCache: graphql.NoCache[ast.QueryDocument, *ast.QueryDocument]{}, + queryCache: graphql.NoCache[*ast.QueryDocument]{}, ext: processExtensions(nil), parserTokenLimit: parserTokenNoLimit, } @@ -47,7 +49,7 @@ func (e *Executor) CreateOperationContext( ctx context.Context, params *graphql.RawParams, ) (*graphql.OperationContext, gqlerror.List) { - rc := &graphql.OperationContext{ + opCtx := &graphql.OperationContext{ DisableIntrospection: true, RecoverFunc: e.recoverFunc, ResolverMiddleware: e.ext.fieldMiddleware, @@ -57,56 +59,56 @@ func (e *Executor) CreateOperationContext( OperationStart: graphql.GetStartTime(ctx), }, } - ctx = graphql.WithOperationContext(ctx, rc) + ctx = graphql.WithOperationContext(ctx, opCtx) for _, p := range e.ext.operationParameterMutators { if err := p.MutateOperationParameters(ctx, params); err != nil { - return rc, gqlerror.List{err} + return opCtx, gqlerror.List{err} } } - rc.RawQuery = params.Query - rc.OperationName = params.OperationName - rc.Headers = params.Headers + opCtx.RawQuery = params.Query + opCtx.OperationName = params.OperationName + opCtx.Headers = params.Headers var listErr gqlerror.List - rc.Doc, listErr = e.parseQuery(ctx, &rc.Stats, params.Query) + opCtx.Doc, listErr = e.parseQuery(ctx, &opCtx.Stats, params.Query) if len(listErr) != 0 { - return rc, listErr + return opCtx, listErr } - rc.Operation = rc.Doc.Operations.ForName(params.OperationName) - if rc.Operation == nil { + opCtx.Operation = opCtx.Doc.Operations.ForName(params.OperationName) + if opCtx.Operation == nil { err := gqlerror.Errorf("operation %s not found", params.OperationName) errcode.Set(err, errcode.ValidationFailed) - return rc, gqlerror.List{err} + return opCtx, gqlerror.List{err} } var err error - rc.Variables, err = validator.VariableValues(e.es.Schema(), rc.Operation, params.Variables) + opCtx.Variables, err = validator.VariableValues(e.es.Schema(), opCtx.Operation, params.Variables) if err != nil { gqlErr, ok := err.(*gqlerror.Error) if ok { errcode.Set(gqlErr, errcode.ValidationFailed) - return rc, gqlerror.List{gqlErr} + return opCtx, gqlerror.List{gqlErr} } } - rc.Stats.Validation.End = graphql.Now() + opCtx.Stats.Validation.End = graphql.Now() for _, p := range e.ext.operationContextMutators { - if err := p.MutateOperationContext(ctx, rc); err != nil { - return rc, gqlerror.List{err} + if err := p.MutateOperationContext(ctx, opCtx); err != nil { + return opCtx, gqlerror.List{err} } } - return rc, nil + return opCtx, nil } func (e *Executor) DispatchOperation( ctx context.Context, - rc *graphql.OperationContext, + opCtx *graphql.OperationContext, ) (graphql.ResponseHandler, context.Context) { - ctx = graphql.WithOperationContext(ctx, rc) + ctx = graphql.WithOperationContext(ctx, opCtx) var innerCtx context.Context res := e.ext.operationMiddleware(ctx, func(ctx context.Context) graphql.ResponseHandler { @@ -177,6 +179,10 @@ func (e *Executor) SetParserTokenLimit(limit int) { e.parserTokenLimit = limit } +func (e *Executor) SetDisableSuggestion(value bool) { + e.disableSuggestion = value +} + // parseQuery decodes the incoming query and validates it, pulling from cache if present. // // NOTE: This should NOT look at variables, they will change per request. It should only parse and @@ -216,6 +222,15 @@ func (e *Executor) parseQuery( return nil, gqlerror.List{gqlErr} } + // swap out the FieldsOnCorrectType rule with one that doesn't provide suggestions + if e.disableSuggestion { + validator.RemoveRule("FieldsOnCorrectType") + + rule := rules.FieldsOnCorrectTypeRuleWithoutSuggestions + // rule may already have been added + validator.ReplaceRule(rule.Name, rule.RuleFunc) + } + listErr := validator.Validate(e.es.Schema(), doc) if len(listErr) != 0 { for _, e := range listErr { diff --git a/vendor/github.com/99designs/gqlgen/graphql/handler.go b/vendor/github.com/99designs/gqlgen/graphql/handler.go index 4df36117..ab2ed4b6 100644 --- a/vendor/github.com/99designs/gqlgen/graphql/handler.go +++ b/vendor/github.com/99designs/gqlgen/graphql/handler.go @@ -34,7 +34,7 @@ type ( GraphExecutor interface { CreateOperationContext(ctx context.Context, params *RawParams) (*OperationContext, gqlerror.List) - DispatchOperation(ctx context.Context, rc *OperationContext) (ResponseHandler, context.Context) + DispatchOperation(ctx context.Context, opCtx *OperationContext) (ResponseHandler, context.Context) DispatchError(ctx context.Context, list gqlerror.List) *Response } @@ -65,7 +65,7 @@ type ( // OperationContextMutator is called after creating the request context, but before executing the root resolver. OperationContextMutator interface { - MutateOperationContext(ctx context.Context, rc *OperationContext) *gqlerror.Error + MutateOperationContext(ctx context.Context, opCtx *OperationContext) *gqlerror.Error } // OperationInterceptor is called for each incoming query, for basic requests the writer will be invoked once, diff --git a/vendor/github.com/99designs/gqlgen/graphql/handler/extension/apq.go b/vendor/github.com/99designs/gqlgen/graphql/handler/extension/apq.go index a4cb32c9..9390c4fe 100644 --- a/vendor/github.com/99designs/gqlgen/graphql/handler/extension/apq.go +++ b/vendor/github.com/99designs/gqlgen/graphql/handler/extension/apq.go @@ -6,7 +6,7 @@ import ( "encoding/hex" "errors" - "github.com/mitchellh/mapstructure" + "github.com/go-viper/mapstructure/v2" "github.com/vektah/gqlparser/v2/gqlerror" "github.com/99designs/gqlgen/graphql" @@ -98,12 +98,12 @@ func (a AutomaticPersistedQuery) MutateOperationParameters(ctx context.Context, } func GetApqStats(ctx context.Context) *ApqStats { - rc := graphql.GetOperationContext(ctx) - if rc == nil { + opCtx := graphql.GetOperationContext(ctx) + if opCtx == nil { return nil } - s, _ := rc.Stats.GetExtension(apqExtension).(*ApqStats) + s, _ := opCtx.Stats.GetExtension(apqExtension).(*ApqStats) return s } diff --git a/vendor/github.com/99designs/gqlgen/graphql/handler/extension/complexity.go b/vendor/github.com/99designs/gqlgen/graphql/handler/extension/complexity.go index af1e002f..3684f078 100644 --- a/vendor/github.com/99designs/gqlgen/graphql/handler/extension/complexity.go +++ b/vendor/github.com/99designs/gqlgen/graphql/handler/extension/complexity.go @@ -17,7 +17,7 @@ const errComplexityLimit = "COMPLEXITY_LIMIT_EXCEEDED" // // If a query is submitted that exceeds the limit, a 422 status code will be returned. type ComplexityLimit struct { - Func func(ctx context.Context, rc *graphql.OperationContext) int + Func func(ctx context.Context, opCtx *graphql.OperationContext) int es graphql.ExecutableSchema } @@ -40,7 +40,7 @@ type ComplexityStats struct { // FixedComplexityLimit sets a complexity limit that does not change func FixedComplexityLimit(limit int) *ComplexityLimit { return &ComplexityLimit{ - Func: func(ctx context.Context, rc *graphql.OperationContext) int { + Func: func(ctx context.Context, opCtx *graphql.OperationContext) int { return limit }, } @@ -58,13 +58,13 @@ func (c *ComplexityLimit) Validate(schema graphql.ExecutableSchema) error { return nil } -func (c ComplexityLimit) MutateOperationContext(ctx context.Context, rc *graphql.OperationContext) *gqlerror.Error { - op := rc.Doc.Operations.ForName(rc.OperationName) - complexityCalcs := complexity.Calculate(c.es, op, rc.Variables) +func (c ComplexityLimit) MutateOperationContext(ctx context.Context, opCtx *graphql.OperationContext) *gqlerror.Error { + op := opCtx.Doc.Operations.ForName(opCtx.OperationName) + complexityCalcs := complexity.Calculate(c.es, op, opCtx.Variables) - limit := c.Func(ctx, rc) + limit := c.Func(ctx, opCtx) - rc.Stats.SetExtension(complexityExtension, &ComplexityStats{ + opCtx.Stats.SetExtension(complexityExtension, &ComplexityStats{ Complexity: complexityCalcs, ComplexityLimit: limit, }) @@ -79,11 +79,11 @@ func (c ComplexityLimit) MutateOperationContext(ctx context.Context, rc *graphql } func GetComplexityStats(ctx context.Context) *ComplexityStats { - rc := graphql.GetOperationContext(ctx) - if rc == nil { + opCtx := graphql.GetOperationContext(ctx) + if opCtx == nil { return nil } - s, _ := rc.Stats.GetExtension(complexityExtension).(*ComplexityStats) + s, _ := opCtx.Stats.GetExtension(complexityExtension).(*ComplexityStats) return s } diff --git a/vendor/github.com/99designs/gqlgen/graphql/handler/extension/introspection.go b/vendor/github.com/99designs/gqlgen/graphql/handler/extension/introspection.go index 8e391265..bdf0fdf8 100644 --- a/vendor/github.com/99designs/gqlgen/graphql/handler/extension/introspection.go +++ b/vendor/github.com/99designs/gqlgen/graphql/handler/extension/introspection.go @@ -24,7 +24,7 @@ func (c Introspection) Validate(schema graphql.ExecutableSchema) error { return nil } -func (c Introspection) MutateOperationContext(ctx context.Context, rc *graphql.OperationContext) *gqlerror.Error { - rc.DisableIntrospection = false +func (c Introspection) MutateOperationContext(ctx context.Context, opCtx *graphql.OperationContext) *gqlerror.Error { + opCtx.DisableIntrospection = false return nil } diff --git a/vendor/github.com/99designs/gqlgen/graphql/handler/server.go b/vendor/github.com/99designs/gqlgen/graphql/handler/server.go index 644bad8d..d80e60dc 100644 --- a/vendor/github.com/99designs/gqlgen/graphql/handler/server.go +++ b/vendor/github.com/99designs/gqlgen/graphql/handler/server.go @@ -31,6 +31,21 @@ func New(es graphql.ExecutableSchema) *Server { } } +// NewDefaultServer is a demonstration only. Not for prod. +// +// Currently, the server just picks the first available transport, +// so this example NewDefaultServer orders them, but it is just +// for demonstration purposes. +// You will likely want to tune and better configure Websocket transport +// since adding a new one (To configure it) doesn't have effect. +// +// Also SSE support is not in here at all! +// SSE when used over HTTP/1.1 (but not HTTP/2 or HTTP/3), +// SSE suffers from a severe limitation to the maximum number +// of open connections of 6 per browser. See: +// https://developer.mozilla.org/en-US/docs/Web/API/Server-sent_events/Using_server-sent_events#sect1 +// +// Deprecated: This was and is just an example. func NewDefaultServer(es graphql.ExecutableSchema) *Server { srv := New(es) @@ -72,6 +87,10 @@ func (s *Server) SetParserTokenLimit(limit int) { s.exec.SetParserTokenLimit(limit) } +func (s *Server) SetDisableSuggestion(value bool) { + s.exec.SetDisableSuggestion(value) +} + func (s *Server) Use(extension graphql.HandlerExtension) { s.exec.Use(extension) } diff --git a/vendor/github.com/99designs/gqlgen/graphql/handler/transport/http_get.go b/vendor/github.com/99designs/gqlgen/graphql/handler/transport/http_get.go index 470a0fbe..09f1020d 100644 --- a/vendor/github.com/99designs/gqlgen/graphql/handler/transport/http_get.go +++ b/vendor/github.com/99designs/gqlgen/graphql/handler/transport/http_get.go @@ -66,21 +66,21 @@ func (h GET) Do(w http.ResponseWriter, r *http.Request, exec graphql.GraphExecut raw.ReadTime.End = graphql.Now() - rc, gqlError := exec.CreateOperationContext(r.Context(), raw) + opCtx, gqlError := exec.CreateOperationContext(r.Context(), raw) if gqlError != nil { w.WriteHeader(statusFor(gqlError)) - resp := exec.DispatchError(graphql.WithOperationContext(r.Context(), rc), gqlError) + resp := exec.DispatchError(graphql.WithOperationContext(r.Context(), opCtx), gqlError) writeJson(w, resp) return } - op := rc.Doc.Operations.ForName(rc.OperationName) + op := opCtx.Doc.Operations.ForName(opCtx.OperationName) if op.Operation != ast.Query { w.WriteHeader(http.StatusNotAcceptable) writeJsonError(w, "GET requests only allow query operations") return } - responses, ctx := exec.DispatchOperation(r.Context(), rc) + responses, ctx := exec.DispatchOperation(r.Context(), opCtx) writeJson(w, responses(ctx)) } diff --git a/vendor/github.com/99designs/gqlgen/graphql/handler/transport/http_multipart_mixed.go b/vendor/github.com/99designs/gqlgen/graphql/handler/transport/http_multipart_mixed.go new file mode 100644 index 00000000..9cf1b533 --- /dev/null +++ b/vendor/github.com/99designs/gqlgen/graphql/handler/transport/http_multipart_mixed.go @@ -0,0 +1,298 @@ +package transport + +import ( + "encoding/json" + "fmt" + "io" + "log" + "mime" + "net/http" + "strings" + "sync" + "time" + + "github.com/vektah/gqlparser/v2/gqlerror" + + "github.com/99designs/gqlgen/graphql" +) + +// MultipartMixed is a transport that supports the multipart/mixed spec +type MultipartMixed struct { + Boundary string + DeliveryTimeout time.Duration +} + +var _ graphql.Transport = MultipartMixed{} + +// Supports checks if the request supports the multipart/mixed spec +// Might be worth check the spec required, but Apollo Client mislabel the spec in the headers. +func (t MultipartMixed) Supports(r *http.Request) bool { + if !strings.Contains(r.Header.Get("Accept"), "multipart/mixed") { + return false + } + mediaType, _, err := mime.ParseMediaType(r.Header.Get("Content-Type")) + if err != nil { + return false + } + return r.Method == http.MethodPost && mediaType == "application/json" +} + +// Do implements the multipart/mixed spec as a multipart/mixed response +func (t MultipartMixed) Do(w http.ResponseWriter, r *http.Request, exec graphql.GraphExecutor) { + // Implements the multipart/mixed spec as a multipart/mixed response: + // * https://github.com/graphql/graphql-wg/blob/e4ef5f9d5997815d9de6681655c152b6b7838b4c/rfcs/DeferStream.md + // 2022/08/23 as implemented by gqlgen. + // * https://github.com/graphql/graphql-wg/blob/f22ea7748c6ebdf88fdbf770a8d9e41984ebd429/rfcs/DeferStream.md June 2023 Spec for the + // `incremental` field + // * https://github.com/graphql/graphql-over-http/blob/main/rfcs/IncrementalDelivery.md + // multipart specification + // Follows the format that is used in the Apollo Client tests: + // https://github.com/apollographql/apollo-client/blob/v3.11.8/src/link/http/__tests__/responseIterator.ts#L68 + // Apollo Client, despite mentioning in its requests that they require the 2022 spec, it wants the + // `incremental` field to be an array of responses, not a single response. Theoretically we could + // batch responses in the `incremental` field, if we wanted to optimize this code. + ctx := r.Context() + flusher, ok := w.(http.Flusher) + if !ok { + SendErrorf(w, http.StatusInternalServerError, "streaming unsupported") + return + } + defer flusher.Flush() + + w.Header().Set("Cache-Control", "no-cache") + w.Header().Set("Connection", "keep-alive") + // This header will be replaced below, but it's required in case we return errors. + w.Header().Set("Content-Type", "application/json") + + boundary := t.Boundary + if boundary == "" { + boundary = "-" + } + timeout := t.DeliveryTimeout + if timeout.Milliseconds() < 1 { + // If the timeout is less than 1ms, we'll set it to 1ms to avoid a busy loop + timeout = 1 * time.Millisecond + } + + params := &graphql.RawParams{} + start := graphql.Now() + params.Headers = r.Header + params.ReadTime = graphql.TraceTiming{ + Start: start, + End: graphql.Now(), + } + + bodyString, err := getRequestBody(r) + if err != nil { + gqlErr := gqlerror.Errorf("could not get json request body: %+v", err) + resp := exec.DispatchError(ctx, gqlerror.List{gqlErr}) + log.Printf("could not get json request body: %+v", err.Error()) + writeJson(w, resp) + return + } + + bodyReader := io.NopCloser(strings.NewReader(bodyString)) + if err = jsonDecode(bodyReader, ¶ms); err != nil { + w.WriteHeader(http.StatusBadRequest) + gqlErr := gqlerror.Errorf( + "json request body could not be decoded: %+v body:%s", + err, + bodyString, + ) + resp := exec.DispatchError(ctx, gqlerror.List{gqlErr}) + log.Printf("decoding error: %+v body:%s", err.Error(), bodyString) + writeJson(w, resp) + return + } + + rc, opErr := exec.CreateOperationContext(ctx, params) + ctx = graphql.WithOperationContext(ctx, rc) + if opErr != nil { + w.WriteHeader(statusFor(opErr)) + + resp := exec.DispatchError(ctx, opErr) + writeJson(w, resp) + return + } + + // Example of the response format (note the new lines and boundaries are important!): + // https://github.com/graphql/graphql-over-http/blob/main/rfcs/IncrementalDelivery.md + // --graphql + // Content-Type: application/json + // + // {"data":{"apps":{"apps":[ .. ],"totalNumApps":161,"__typename":"AppsOutput"}},"hasNext":true} + // --graphql + // Content-Type: application/json + // + // {"incremental":[{"data":{"groupAccessCount":0},"label":"test","path":["apps","apps",7],"hasNext":true}],"hasNext":true} + // --graphql + // ... + // --graphql-- + // Last boundary is a closing boundary with two dashes at the end. + + w.Header().Set( + "Content-Type", + fmt.Sprintf(`multipart/mixed;boundary="%s";deferSpec=20220824`, boundary), + ) + + a := newMultipartResponseAggregator(w, boundary, timeout) + defer a.Done(w) + + responses, ctx := exec.DispatchOperation(ctx, rc) + initialResponse := true + for { + response := responses(ctx) + if response == nil { + break + } + + a.Add(response, initialResponse) + initialResponse = false + } +} + +func writeIncrementalJson(w io.Writer, responses []*graphql.Response, hasNext bool) { + // TODO: Remove this wrapper on response once gqlgen supports the 2023 spec + b, err := json.Marshal(struct { + Incremental []*graphql.Response `json:"incremental"` + HasNext bool `json:"hasNext"` + }{ + Incremental: responses, + HasNext: hasNext, + }) + if err != nil { + panic(err) + } + w.Write(b) +} + +func writeBoundary(w io.Writer, boundary string, finalResponse bool) { + if finalResponse { + fmt.Fprintf(w, "--%s--\r\n", boundary) + return + } + fmt.Fprintf(w, "--%s\r\n", boundary) +} + +func writeContentTypeHeader(w io.Writer) { + fmt.Fprintf(w, "Content-Type: application/json\r\n\r\n") +} + +// multipartResponseAggregator helps us reduce the number of responses sent to the frontend by batching all the +// incremental responses together. +type multipartResponseAggregator struct { + mu sync.Mutex + boundary string + initialResponse *graphql.Response + deferResponses []*graphql.Response + done chan bool +} + +// newMultipartResponseAggregator creates a new multipartResponseAggregator +// The aggregator will flush responses to the client every `tickerDuration` (default 1ms) so that +// multiple incremental responses are batched together. +func newMultipartResponseAggregator( + w http.ResponseWriter, + boundary string, + tickerDuration time.Duration, +) *multipartResponseAggregator { + a := &multipartResponseAggregator{ + boundary: boundary, + done: make(chan bool, 1), + } + go func() { + ticker := time.NewTicker(tickerDuration) + defer ticker.Stop() + for { + select { + case <-a.done: + return + case <-ticker.C: + a.flush(w) + } + } + }() + return a +} + +// Done flushes the remaining responses +func (a *multipartResponseAggregator) Done(w http.ResponseWriter) { + a.done <- true + a.flush(w) +} + +// Add accumulates the responses +func (a *multipartResponseAggregator) Add(resp *graphql.Response, initialResponse bool) { + a.mu.Lock() + defer a.mu.Unlock() + if initialResponse { + a.initialResponse = resp + return + } + a.deferResponses = append(a.deferResponses, resp) +} + +// flush sends the accumulated responses to the client +func (a *multipartResponseAggregator) flush(w http.ResponseWriter) { + a.mu.Lock() + defer a.mu.Unlock() + + // If we don't have any responses, we can return early + if a.initialResponse == nil && len(a.deferResponses) == 0 { + return + } + + flusher, ok := w.(http.Flusher) + if !ok { + // This should never happen, as we check for this much earlier on + panic("response writer does not support flushing") + } + + hasNext := false + if a.initialResponse != nil { + // Initial response will need to begin with the boundary + writeBoundary(w, a.boundary, false) + writeContentTypeHeader(w) + + writeJson(w, a.initialResponse) + hasNext = a.initialResponse.HasNext != nil && *a.initialResponse.HasNext + + // Handle when initial is aggregated with deferred responses. + if len(a.deferResponses) > 0 { + fmt.Fprintf(w, "\r\n") + writeBoundary(w, a.boundary, false) + } + + // Reset the initial response so we don't send it again + a.initialResponse = nil + } + + if len(a.deferResponses) > 0 { + writeContentTypeHeader(w) + + // Note: while the 2023 spec that includes "incremental" does not + // explicitly list the fields that should be included as part of the + // incremental object, it shows hasNext only on the response payload + // (marking the status of the operation as a whole), and instead the + // response payload implements pending and complete fields to mark the + // status of the incrementally delivered data. + // + // TODO: use the "HasNext" status of deferResponses items to determine + // the operation status and pending / complete fields, but remove from + // the incremental (deferResponses) object. + hasNext = a.deferResponses[len(a.deferResponses)-1].HasNext != nil && + *a.deferResponses[len(a.deferResponses)-1].HasNext + writeIncrementalJson(w, a.deferResponses, hasNext) + + // Reset the deferResponses so we don't send them again + a.deferResponses = nil + } + + // Make sure to put the delimiter after every request, so that Apollo Client knows that the + // current payload has been sent, and updates the UI. This is particular important for the first + // response and the last response, which may either hang or never get handled. + // Final response will have a closing boundary with two dashes at the end. + fmt.Fprintf(w, "\r\n") + writeBoundary(w, a.boundary, !hasNext) + flusher.Flush() +} diff --git a/vendor/github.com/99designs/gqlgen/graphql/handler/transport/http_post.go b/vendor/github.com/99designs/gqlgen/graphql/handler/transport/http_post.go index 985f8db2..4b9a2399 100644 --- a/vendor/github.com/99designs/gqlgen/graphql/handler/transport/http_post.go +++ b/vendor/github.com/99designs/gqlgen/graphql/handler/transport/http_post.go @@ -1,11 +1,12 @@ package transport import ( + "bytes" "fmt" "io" "mime" "net/http" - "strings" + "sync" "github.com/vektah/gqlparser/v2/gqlerror" @@ -46,32 +47,49 @@ func getRequestBody(r *http.Request) (string, error) { return string(body), nil } +var pool = sync.Pool{ + New: func() any { + return &graphql.RawParams{} + }, +} + func (h POST) Do(w http.ResponseWriter, r *http.Request, exec graphql.GraphExecutor) { ctx := r.Context() writeHeaders(w, h.ResponseHeaders) - params := &graphql.RawParams{} - start := graphql.Now() + params := pool.Get().(*graphql.RawParams) + defer func() { + params.Headers = nil + params.ReadTime = graphql.TraceTiming{} + params.Extensions = nil + params.OperationName = "" + params.Query = "" + params.Variables = nil + + pool.Put(params) + }() params.Headers = r.Header + + start := graphql.Now() params.ReadTime = graphql.TraceTiming{ Start: start, End: graphql.Now(), } - bodyString, err := getRequestBody(r) + bodyBytes, err := io.ReadAll(r.Body) if err != nil { - gqlErr := gqlerror.Errorf("could not get json request body: %+v", err) + gqlErr := gqlerror.Errorf("could not read request body: %+v", err) resp := exec.DispatchError(ctx, gqlerror.List{gqlErr}) writeJson(w, resp) return } - bodyReader := io.NopCloser(strings.NewReader(bodyString)) - if err = jsonDecode(bodyReader, ¶ms); err != nil { + bodyReader := bytes.NewReader(bodyBytes) + if err := jsonDecode(bodyReader, ¶ms); err != nil { w.WriteHeader(http.StatusBadRequest) gqlErr := gqlerror.Errorf( "json request body could not be decoded: %+v body:%s", err, - bodyString, + string(bodyBytes), ) resp := exec.DispatchError(ctx, gqlerror.List{gqlErr}) writeJson(w, resp) diff --git a/vendor/github.com/99designs/gqlgen/graphql/handler/transport/util.go b/vendor/github.com/99designs/gqlgen/graphql/handler/transport/util.go index aca7207e..f2a0d357 100644 --- a/vendor/github.com/99designs/gqlgen/graphql/handler/transport/util.go +++ b/vendor/github.com/99designs/gqlgen/graphql/handler/transport/util.go @@ -13,7 +13,7 @@ import ( func writeJson(w io.Writer, response *graphql.Response) { b, err := json.Marshal(response) if err != nil { - panic(err) + panic(fmt.Errorf("unable to marshal %s: %w", string(response.Data), err)) } w.Write(b) } diff --git a/vendor/github.com/99designs/gqlgen/graphql/handler/transport/websocket.go b/vendor/github.com/99designs/gqlgen/graphql/handler/transport/websocket.go index 32e31c7c..d6c174cd 100644 --- a/vendor/github.com/99designs/gqlgen/graphql/handler/transport/websocket.go +++ b/vendor/github.com/99designs/gqlgen/graphql/handler/transport/websocket.go @@ -54,6 +54,7 @@ type ( receivedPong bool exec graphql.GraphExecutor closed bool + headers http.Header initPayload InitPayload } @@ -119,6 +120,7 @@ func (t Websocket) Do(w http.ResponseWriter, r *http.Request, exec graphql.Graph ctx: r.Context(), exec: exec, me: me, + headers: r.Header, Websocket: t, } @@ -387,6 +389,8 @@ func (c *wsConnection) subscribe(start time.Time, msg *message) { End: graphql.Now(), } + params.Headers = c.headers + rc, err := c.exec.CreateOperationContext(ctx, params) if err != nil { resp := c.exec.DispatchError(graphql.WithOperationContext(ctx, rc), err) diff --git a/vendor/github.com/99designs/gqlgen/graphql/int.go b/vendor/github.com/99designs/gqlgen/graphql/int.go index 41cad3f1..ba269e13 100644 --- a/vendor/github.com/99designs/gqlgen/graphql/int.go +++ b/vendor/github.com/99designs/gqlgen/graphql/int.go @@ -4,6 +4,7 @@ import ( "encoding/json" "fmt" "io" + "math" "strconv" ) @@ -62,24 +63,62 @@ func MarshalInt32(i int32) Marshaler { func UnmarshalInt32(v any) (int32, error) { switch v := v.(type) { case string: - iv, err := strconv.ParseInt(v, 10, 32) + iv, err := strconv.ParseInt(v, 10, 64) if err != nil { return 0, err } - return int32(iv), nil + return safeCastInt32(iv) case int: - return int32(v), nil + return safeCastInt32(int64(v)) case int64: - return int32(v), nil + return safeCastInt32(v) case json.Number: - iv, err := strconv.ParseInt(string(v), 10, 32) + iv, err := strconv.ParseInt(string(v), 10, 64) if err != nil { return 0, err } - return int32(iv), nil + return safeCastInt32(iv) case nil: return 0, nil default: return 0, fmt.Errorf("%T is not an int", v) } } + +// IntegerError is an error type that allows users to identify errors associated +// with receiving an integer value that is not valid for the specific integer +// type designated by the API. IntegerErrors designate otherwise valid unsigned +// or signed 64-bit integers that are invalid in a specific context: they do not +// designate integers that overflow 64-bit versions of the current type. +type IntegerError struct { + Message string +} + +func (e IntegerError) Error() string { + return e.Message +} + +type Int32OverflowError struct { + Value int64 + *IntegerError +} + +func newInt32OverflowError(i int64) *Int32OverflowError { + return &Int32OverflowError{ + Value: i, + IntegerError: &IntegerError{ + Message: fmt.Sprintf("%d overflows signed 32-bit integer", i), + }, + } +} + +func (e *Int32OverflowError) Unwrap() error { + return e.IntegerError +} + +func safeCastInt32(i int64) (int32, error) { + if i > math.MaxInt32 || i < math.MinInt32 { + return 0, newInt32OverflowError(i) + } + return int32(i), nil +} diff --git a/vendor/github.com/99designs/gqlgen/graphql/map.go b/vendor/github.com/99designs/gqlgen/graphql/map.go index 1e91d1d9..2120eef9 100644 --- a/vendor/github.com/99designs/gqlgen/graphql/map.go +++ b/vendor/github.com/99designs/gqlgen/graphql/map.go @@ -6,7 +6,7 @@ import ( "io" ) -func MarshalMap(val map[string]interface{}) Marshaler { +func MarshalMap(val map[string]any) Marshaler { return WriterFunc(func(w io.Writer) { err := json.NewEncoder(w).Encode(val) if err != nil { @@ -15,8 +15,8 @@ func MarshalMap(val map[string]interface{}) Marshaler { }) } -func UnmarshalMap(v interface{}) (map[string]interface{}, error) { - if m, ok := v.(map[string]interface{}); ok { +func UnmarshalMap(v any) (map[string]any, error) { + if m, ok := v.(map[string]any); ok { return m, nil } diff --git a/vendor/github.com/99designs/gqlgen/graphql/playground/playground.go b/vendor/github.com/99designs/gqlgen/graphql/playground/playground.go index 816fcca3..8b1c9787 100644 --- a/vendor/github.com/99designs/gqlgen/graphql/playground/playground.go +++ b/vendor/github.com/99designs/gqlgen/graphql/playground/playground.go @@ -92,7 +92,10 @@ func Handler(title, endpoint string) http.HandlerFunc { // HandlerWithHeaders sets up the playground. // fetcherHeaders are used by the playground's fetcher instance and will not be visible in the UI. // uiHeaders are default headers that will show up in the UI headers editor. -func HandlerWithHeaders(title, endpoint string, fetcherHeaders, uiHeaders map[string]string) http.HandlerFunc { +func HandlerWithHeaders( + title, endpoint string, + fetcherHeaders, uiHeaders map[string]string, +) http.HandlerFunc { return func(w http.ResponseWriter, r *http.Request) { w.Header().Add("Content-Type", "text/html; charset=UTF-8") err := page.Execute(w, map[string]any{ @@ -102,9 +105,9 @@ func HandlerWithHeaders(title, endpoint string, fetcherHeaders, uiHeaders map[st "uiHeaders": uiHeaders, "endpointIsAbsolute": endpointHasScheme(endpoint), "subscriptionEndpoint": getSubscriptionEndpoint(endpoint), - "version": "3.0.6", - "cssSRI": "sha256-wTzfn13a+pLMB5rMeysPPR1hO7x0SwSeQI+cnw7VdbE=", - "jsSRI": "sha256-eNxH+Ah7Z9up9aJYTQycgyNuy953zYZwE9Rqf5rH+r4=", + "version": "3.7.0", + "cssSRI": "sha256-Dbkv2LUWis+0H4Z+IzxLBxM2ka1J133lSjqqtSu49o8=", + "jsSRI": "sha256-qsScAZytFdTAEOM8REpljROHu8DvdvxXBK7xhoq5XD0=", "reactSRI": "sha256-S0lp+k7zWUMk2ixteM6HZvu8L9Eh//OVrt+ZfbCpmgY=", "reactDOMSRI": "sha256-IXWO0ITNDjfnNXIu5POVfqlgYoop36bDzhodR6LW5Pc=", }) diff --git a/vendor/github.com/99designs/gqlgen/graphql/uint.go b/vendor/github.com/99designs/gqlgen/graphql/uint.go index cd5d2355..8352e39f 100644 --- a/vendor/github.com/99designs/gqlgen/graphql/uint.go +++ b/vendor/github.com/99designs/gqlgen/graphql/uint.go @@ -5,6 +5,7 @@ import ( "errors" "fmt" "io" + "math" "strconv" ) @@ -18,21 +19,33 @@ func UnmarshalUint(v any) (uint, error) { switch v := v.(type) { case string: u64, err := strconv.ParseUint(v, 10, 64) + if err != nil { + var strconvErr *strconv.NumError + if errors.As(err, &strconvErr) && isSignedInteger(v) { + return 0, newUintSignError(v) + } + return 0, err + } return uint(u64), err case int: if v < 0 { - return 0, errors.New("cannot convert negative numbers to uint") + return 0, newUintSignError(strconv.FormatInt(int64(v), 10)) } - return uint(v), nil case int64: if v < 0 { - return 0, errors.New("cannot convert negative numbers to uint") + return 0, newUintSignError(strconv.FormatInt(v, 10)) } - return uint(v), nil case json.Number: u64, err := strconv.ParseUint(string(v), 10, 64) + if err != nil { + var strconvErr *strconv.NumError + if errors.As(err, &strconvErr) && isSignedInteger(string(v)) { + return 0, newUintSignError(string(v)) + } + return 0, err + } return uint(u64), err case nil: return 0, nil @@ -50,21 +63,35 @@ func MarshalUint64(i uint64) Marshaler { func UnmarshalUint64(v any) (uint64, error) { switch v := v.(type) { case string: - return strconv.ParseUint(v, 10, 64) + i, err := strconv.ParseUint(v, 10, 64) + if err != nil { + var strconvErr *strconv.NumError + if errors.As(err, &strconvErr) && isSignedInteger(v) { + return 0, newUintSignError(v) + } + return 0, err + } + return i, nil case int: if v < 0 { - return 0, errors.New("cannot convert negative numbers to uint64") + return 0, newUintSignError(strconv.FormatInt(int64(v), 10)) } - return uint64(v), nil case int64: if v < 0 { - return 0, errors.New("cannot convert negative numbers to uint64") + return 0, newUintSignError(strconv.FormatInt(v, 10)) } - return uint64(v), nil case json.Number: - return strconv.ParseUint(string(v), 10, 64) + i, err := strconv.ParseUint(string(v), 10, 64) + if err != nil { + var strconvErr *strconv.NumError + if errors.As(err, &strconvErr) && isSignedInteger(string(v)) { + return 0, newUintSignError(string(v)) + } + return 0, err + } + return i, nil case nil: return 0, nil default: @@ -81,32 +108,92 @@ func MarshalUint32(i uint32) Marshaler { func UnmarshalUint32(v any) (uint32, error) { switch v := v.(type) { case string: - iv, err := strconv.ParseUint(v, 10, 32) + iv, err := strconv.ParseUint(v, 10, 64) if err != nil { + var strconvErr *strconv.NumError + if errors.As(err, &strconvErr) && isSignedInteger(v) { + return 0, newUintSignError(v) + } return 0, err } - return uint32(iv), nil + return safeCastUint32(iv) case int: if v < 0 { - return 0, errors.New("cannot convert negative numbers to uint32") + return 0, newUintSignError(strconv.FormatInt(int64(v), 10)) } - - return uint32(v), nil + return safeCastUint32(uint64(v)) case int64: if v < 0 { - return 0, errors.New("cannot convert negative numbers to uint32") + return 0, newUintSignError(strconv.FormatInt(v, 10)) } - - return uint32(v), nil + return safeCastUint32(uint64(v)) case json.Number: - iv, err := strconv.ParseUint(string(v), 10, 32) + iv, err := strconv.ParseUint(string(v), 10, 64) if err != nil { + var strconvErr *strconv.NumError + if errors.As(err, &strconvErr) && isSignedInteger(string(v)) { + return 0, newUintSignError(string(v)) + } return 0, err } - return uint32(iv), nil + return safeCastUint32(iv) case nil: return 0, nil default: return 0, fmt.Errorf("%T is not an uint", v) } } + +type UintSignError struct { + *IntegerError +} + +func newUintSignError(v string) *UintSignError { + return &UintSignError{ + IntegerError: &IntegerError{ + Message: fmt.Sprintf("%v is an invalid unsigned integer: includes sign", v), + }, + } +} + +func (e *UintSignError) Unwrap() error { + return e.IntegerError +} + +func isSignedInteger(v string) bool { + if v == "" { + return false + } + if v[0] != '-' && v[0] != '+' { + return false + } + if _, err := strconv.ParseUint(v[1:], 10, 64); err == nil { + return true + } + return false +} + +type Uint32OverflowError struct { + Value uint64 + *IntegerError +} + +func newUint32OverflowError(i uint64) *Uint32OverflowError { + return &Uint32OverflowError{ + Value: i, + IntegerError: &IntegerError{ + Message: fmt.Sprintf("%d overflows unsigned 32-bit integer", i), + }, + } +} + +func (e *Uint32OverflowError) Unwrap() error { + return e.IntegerError +} + +func safeCastUint32(i uint64) (uint32, error) { + if i > math.MaxUint32 { + return 0, newUint32OverflowError(i) + } + return uint32(i), nil +} diff --git a/vendor/github.com/99designs/gqlgen/graphql/version.go b/vendor/github.com/99designs/gqlgen/graphql/version.go index 2031242f..926b9078 100644 --- a/vendor/github.com/99designs/gqlgen/graphql/version.go +++ b/vendor/github.com/99designs/gqlgen/graphql/version.go @@ -1,3 +1,3 @@ package graphql -const Version = "v0.17.55" +const Version = "v0.17.63" diff --git a/vendor/github.com/99designs/gqlgen/init-templates/gqlgen.yml.gotmpl b/vendor/github.com/99designs/gqlgen/init-templates/gqlgen.yml.gotmpl index 648ec2b4..e709df0a 100644 --- a/vendor/github.com/99designs/gqlgen/init-templates/gqlgen.yml.gotmpl +++ b/vendor/github.com/99designs/gqlgen/init-templates/gqlgen.yml.gotmpl @@ -4,15 +4,25 @@ schema: # Where should the generated server code go? exec: - filename: graph/generated.go package: graph + layout: single-file # Only other option is "follow-schema," ie multi-file. + + # Only for single-file layout: + filename: graph/generated.go + + # Only for follow-schema layout: + # dir: graph + # filename_template: "{name}.generated.go" + + # Optional: Maximum number of goroutines in concurrency to use per child resolvers(default: unlimited) + # worker_limit: 1000 # Uncomment to enable federation # federation: # filename: graph/federation.go # package: graph # version: 2 -# options +# options: # computed_requires: true # Where should any generated models go? @@ -20,14 +30,27 @@ model: filename: graph/model/models_gen.go package: model + # Optional: Pass in a path to a new gotpl template to use for generating the models + # model_template: [your/path/model.gotpl] + # Where should the resolver implementations go? resolver: - layout: follow-schema - dir: graph package: graph + layout: follow-schema # Only other option is "single-file." + + # Only for single-file layout: + # filename: graph/resolver.go + + # Only for follow-schema layout: + dir: graph filename_template: "{name}.resolvers.go" + # Optional: turn on to not generate template comments above resolvers # omit_template_comment: false + # Optional: Pass in a path to a new gotpl template to use for generating resolvers + # resolver_template: [your/path/resolver.gotpl] + # Optional: turn on to avoid rewriting existing resolver(s) when generating + # preserve_resolver: false # Optional: turn on use ` + "`" + `gqlgen:"fieldName"` + "`" + ` tags in your models # struct_tag: json @@ -36,7 +59,7 @@ resolver: # omit_slice_element_pointers: false # Optional: turn on to omit Is() methods to interface and unions -# omit_interface_checks : true +# omit_interface_checks: true # Optional: turn on to skip generation of ComplexityRoot struct content and Complexity function # omit_complexity: false @@ -47,6 +70,12 @@ resolver: # Optional: turn on to exclude the gqlgen version in the generated file notice. No effect if `omit_gqlgen_file_notice` is true. # omit_gqlgen_version_in_file_notice: false +# Optional: turn on to exclude root models such as Query and Mutation from the generated models file. +# omit_root_models: false + +# Optional: turn on to exclude resolver fields from the generated models file. +# omit_resolver_fields: false + # Optional: turn off to make struct-type struct fields not use pointers # e.g. type Thing struct { FieldA OtherThing } instead of { FieldA *OtherThing } # struct_fields_always_pointers: true @@ -73,6 +102,18 @@ resolver: # argument values but to set them even if they're null. call_argument_directives_with_null: true +# Optional: set build tags that will be used to load packages +# go_build_tags: +# - private +# - enterprise + +# Optional: set to modify the initialisms regarded for Go names +# go_initialisms: +# replace_defaults: false # if true, the default initialisms will get dropped in favor of the new ones instead of being added +# initialisms: # List of initialisms to for Go names +# - 'CC' +# - 'BCC' + # gqlgen will search for any type names in the schema in these go packages # if they match it will use them, otherwise it will generate them. autobind: @@ -90,8 +131,25 @@ models: - github.com/99designs/gqlgen/graphql.Int - github.com/99designs/gqlgen/graphql.Int64 - github.com/99designs/gqlgen/graphql.Int32 + # gqlgen provides a default GraphQL UUID convenience wrapper for github.com/google/uuid + # but you can override this to provide your own GraphQL UUID implementation + UUID: + model: + - github.com/99designs/gqlgen/graphql.UUID + + # The GraphQL spec explicitly states that the Int type is a signed 32-bit + # integer. Using Go int or int64 to represent it can lead to unexpected + # behavior, and some GraphQL tools like Apollo Router will fail when + # communicating numbers that overflow 32-bits. + # + # You may choose to use the custom, built-in Int64 scalar to represent 64-bit + # integers, or ignore the spec and bind Int to graphql.Int / graphql.Int64 + # (the default behavior of gqlgen). This is fine in simple use cases when you + # do not need to worry about interoperability and only expect small numbers. Int: + model: + - github.com/99designs/gqlgen/graphql.Int32 + Int64: model: - github.com/99designs/gqlgen/graphql.Int - github.com/99designs/gqlgen/graphql.Int64 - - github.com/99designs/gqlgen/graphql.Int32 diff --git a/vendor/github.com/99designs/gqlgen/internal/code/alias.go b/vendor/github.com/99designs/gqlgen/internal/code/alias.go index f7685801..03c8e146 100644 --- a/vendor/github.com/99designs/gqlgen/internal/code/alias.go +++ b/vendor/github.com/99designs/gqlgen/internal/code/alias.go @@ -1,5 +1,3 @@ -//go:build !go1.23 - package code import ( @@ -7,7 +5,13 @@ import ( ) // Unalias unwraps an alias type -// TODO: Drop this function when we drop support for go1.22 func Unalias(t types.Type) types.Type { - return t // No-op + if p, ok := t.(*types.Pointer); ok { + // If the type come from auto-binding, + // it will be a pointer to an alias type. + // (e.g: `type Cursor = entgql.Cursor[int]`) + // *ent.Cursor is the type we got from auto-binding. + return types.NewPointer(Unalias(p.Elem())) + } + return types.Unalias(t) } diff --git a/vendor/github.com/99designs/gqlgen/internal/code/alias_1.23.go b/vendor/github.com/99designs/gqlgen/internal/code/alias_1.23.go deleted file mode 100644 index fa0b216c..00000000 --- a/vendor/github.com/99designs/gqlgen/internal/code/alias_1.23.go +++ /dev/null @@ -1,19 +0,0 @@ -//go:build go1.23 - -package code - -import ( - "go/types" -) - -// Unalias unwraps an alias type -func Unalias(t types.Type) types.Type { - if p, ok := t.(*types.Pointer); ok { - // If the type come from auto-binding, - // it will be a pointer to an alias type. - // (e.g: `type Cursor = entgql.Cursor[int]`) - // *ent.Cursor is the type we got from auto-binding. - return types.NewPointer(Unalias(p.Elem())) - } - return types.Unalias(t) -} diff --git a/vendor/github.com/99designs/gqlgen/internal/code/packages.go b/vendor/github.com/99designs/gqlgen/internal/code/packages.go index 17fd5bb6..966794fd 100644 --- a/vendor/github.com/99designs/gqlgen/internal/code/packages.go +++ b/vendor/github.com/99designs/gqlgen/internal/code/packages.go @@ -7,18 +7,11 @@ import ( "os" "os/exec" "path/filepath" - "runtime/debug" "strings" - "sync" "golang.org/x/tools/go/packages" ) -var ( - once = sync.Once{} - modInfo *debug.BuildInfo -) - var mode = packages.NeedName | packages.NeedFiles | packages.NeedTypes | @@ -30,10 +23,11 @@ type ( // Packages is a wrapper around x/tools/go/packages that maintains a (hopefully prewarmed) cache of packages // that can be invalidated as writes are made and packages are known to change. Packages struct { - packages map[string]*packages.Package - importToName map[string]string - loadErrors []error - buildFlags []string + packages map[string]*packages.Package + importToName map[string]string + loadErrors []error + buildFlags []string + packagesToCachePrefix string numLoadCalls int // stupid test steam. ignore. numNameCalls int // stupid test steam. ignore. @@ -42,13 +36,21 @@ type ( Option func(p *Packages) ) -// WithBuildTags adds build tags to the packages.Load call +// WithBuildTags option for NewPackages adds build tags to the packages.Load call func WithBuildTags(tags ...string) func(p *Packages) { return func(p *Packages) { p.buildFlags = append(p.buildFlags, "-tags", strings.Join(tags, ",")) } } +// PackagePrefixToCache option for NewPackages +// will not reset gqlgen packages in packages.Load call +func PackagePrefixToCache(prefixPath string) func(p *Packages) { + return func(p *Packages) { + p.packagesToCachePrefix = prefixPath + } +} + // NewPackages creates a new packages cache // It will load all packages in the current module, and any packages that are passed to Load or LoadAll func NewPackages(opts ...Option) *Packages { @@ -60,27 +62,23 @@ func NewPackages(opts ...Option) *Packages { } func (p *Packages) CleanupUserPackages() { - once.Do(func() { - var ok bool - modInfo, ok = debug.ReadBuildInfo() - if !ok { - modInfo = nil - } - }) - // Don't cleanup github.com/99designs/gqlgen prefixed packages, - // they haven't changed and do not need to be reloaded - if modInfo != nil { + if p.packagesToCachePrefix == "" { + // Cleanup all packages if we don't know which ones to keep + p.packages = nil + } else { + // Don't clean up github.com/99designs/gqlgen prefixed packages, + // they haven't changed and do not need to be reloaded + // if you are using a fork, then you need to have customized + // the prefix using PackagePrefixToCache var toRemove []string for k := range p.packages { - if !strings.HasPrefix(k, modInfo.Main.Path) { + if !strings.HasPrefix(k, p.packagesToCachePrefix) { toRemove = append(toRemove, k) } } for _, k := range toRemove { delete(p.packages, k) } - } else { - p.packages = nil // Cleanup all packages if we don't know for some reason which ones to keep } } @@ -231,8 +229,7 @@ func (p *Packages) ModTidy() error { // Errors returns any errors that were returned by Load, either from the call itself or any of the loaded packages. func (p *Packages) Errors() PkgErrors { - var res []error //nolint:prealloc - res = append(res, p.loadErrors...) + res := append([]error{}, p.loadErrors...) for _, pkg := range p.packages { for _, err := range pkg.Errors { res = append(res, err) diff --git a/vendor/github.com/99designs/gqlgen/plugin/federation/constants.go b/vendor/github.com/99designs/gqlgen/plugin/federation/constants.go index 8571db1f..2427b22c 100644 --- a/vendor/github.com/99designs/gqlgen/plugin/federation/constants.go +++ b/vendor/github.com/99designs/gqlgen/plugin/federation/constants.go @@ -1,8 +1,9 @@ package federation import ( - "github.com/99designs/gqlgen/codegen/config" "github.com/vektah/gqlparser/v2/ast" + + "github.com/99designs/gqlgen/codegen/config" ) // The name of the field argument that is injected into the resolver to support @requires. diff --git a/vendor/github.com/99designs/gqlgen/plugin/federation/federation.go b/vendor/github.com/99designs/gqlgen/plugin/federation/federation.go index f7a4d6be..bd60f789 100644 --- a/vendor/github.com/99designs/gqlgen/plugin/federation/federation.go +++ b/vendor/github.com/99designs/gqlgen/plugin/federation/federation.go @@ -279,10 +279,13 @@ func (f *Federation) GenerateCode(data *codegen.Data) error { typeString := strings.Split(obj.Type.String(), ".") requiresImports[strings.Join(typeString[:len(typeString)-1], ".")] = true + if containsUnionField(reqField) { + continue + } + cgField := reqField.Field.TypeReference(obj, data.Objects) reqField.Type = cgField.TypeReference } - // add type info to entity e.Type = obj.Type } @@ -321,14 +324,24 @@ func (f *Federation) GenerateCode(data *codegen.Data) error { Filename: data.Config.Federation.Filename, Data: struct { Federation - UsePointers bool - }{*f, data.Config.ResolversAlwaysReturnPointers}, + UsePointers bool + UseFunctionSyntaxForExecutionContext bool + }{*f, data.Config.ResolversAlwaysReturnPointers, data.Config.UseFunctionSyntaxForExecutionContext}, GeneratedHeader: true, Packages: data.Config.Packages, Template: federationTemplate, }) } +func containsUnionField(reqField *Requires) bool { + for _, requireFields := range reqField.Field { + if strings.HasPrefix(requireFields, "... on") { + return true + } + } + return false +} + // Fill in types for key fields func populateKeyFieldTypes( resolver *EntityResolver, diff --git a/vendor/github.com/99designs/gqlgen/plugin/federation/federation.gotpl b/vendor/github.com/99designs/gqlgen/plugin/federation/federation.gotpl index fdb40a6a..5e61e15c 100644 --- a/vendor/github.com/99designs/gqlgen/plugin/federation/federation.gotpl +++ b/vendor/github.com/99designs/gqlgen/plugin/federation/federation.gotpl @@ -8,6 +8,8 @@ {{ $options := .PackageOptions }} {{ $usePointers := .UsePointers }} +{{ $useFunctionSyntaxForExecutionContext := .UseFunctionSyntaxForExecutionContext }} + var ( ErrUnknownType = errors.New("unknown type") ErrTypeNotFound = errors.New("type not found") @@ -33,7 +35,7 @@ func (ec *executionContext) __resolve__service(ctx context.Context) (fedruntime. } {{if .Entities}} -func (ec *executionContext) __resolve_entities(ctx context.Context, representations []map[string]interface{}) []fedruntime.Entity { +func (ec *executionContext) __resolve_entities(ctx context.Context, representations []map[string]any) []fedruntime.Entity { list := make([]fedruntime.Entity, len(representations)) repsMap := ec.buildRepresentationGroups(ctx, representations) @@ -169,7 +171,11 @@ func (ec *executionContext) resolveEntity( {{ range $i, $resolver := .Resolvers }} case "{{.ResolverName}}": {{- range $j, $keyField := .KeyFields }} - id{{$j}}, err := ec.{{.Type.UnmarshalFunc}}(ctx, rep["{{.Field.Join `"].(map[string]interface{})["`}}"]) + {{ if $useFunctionSyntaxForExecutionContext -}} + id{{$j}}, err := {{.Type.UnmarshalFunc}}(ctx, ec, rep["{{.Field.Join `"].(map[string]any)["`}}"]) + {{- else -}} + id{{$j}}, err := ec.{{.Type.UnmarshalFunc}}(ctx, rep["{{.Field.Join `"].(map[string]any)["`}}"]) + {{- end }} if err != nil { return nil, fmt.Errorf(`unmarshalling param {{$j}} for {{$resolver.ResolverName}}(): %w`, err) } @@ -187,7 +193,11 @@ func (ec *executionContext) resolveEntity( } {{- else }} {{ range $entity.Requires }} - entity.{{.Field.JoinGo `.`}}, err = ec.{{.Type.UnmarshalFunc}}(ctx, rep["{{.Field.Join `"].(map[string]interface{})["`}}"]) + {{ if $useFunctionSyntaxForExecutionContext -}} + entity.{{.Field.JoinGo `.`}}, err = {{.Type.UnmarshalFunc}}(ctx, ec, rep["{{.Field.Join `"].(map[string]any)["`}}"]) + {{- else -}} + entity.{{.Field.JoinGo `.`}}, err = ec.{{.Type.UnmarshalFunc}}(ctx, rep["{{.Field.Join `"].(map[string]any)["`}}"]) + {{- end }} if err != nil { return nil, err } @@ -231,7 +241,11 @@ func (ec *executionContext) resolveManyEntities( for i, rep := range reps { {{ range $i, $keyField := .KeyFields -}} - id{{$i}}, err := ec.{{.Type.UnmarshalFunc}}(ctx, rep.entity["{{.Field.Join `"].(map[string]interface{})["`}}"]) + {{ if $useFunctionSyntaxForExecutionContext -}} + id{{$i}}, err := {{.Type.UnmarshalFunc}}(ctx, ec, rep.entity["{{.Field.Join `"].(map[string]any)["`}}"]) + {{- else -}} + id{{$i}}, err := ec.{{.Type.UnmarshalFunc}}(ctx, rep.entity["{{.Field.Join `"].(map[string]any)["`}}"]) + {{- end }} if err != nil { return errors.New(fmt.Sprintf("Field %s undefined in schema.", "{{.Definition.Name}}")) } @@ -251,7 +265,11 @@ func (ec *executionContext) resolveManyEntities( for i, entity := range entities { {{- range $entity.Requires }} - entity.{{.Field.JoinGo `.`}}, err = ec.{{.Type.UnmarshalFunc}}(ctx, reps[i].entity["{{.Field.Join `"].(map[string]interface{})["`}}"]) + {{ if $useFunctionSyntaxForExecutionContext -}} + entity.{{.Field.JoinGo `.`}}, err = {{.Type.UnmarshalFunc}}(ctx, ec, reps[i].entity["{{.Field.Join `"].(map[string]any)["`}}"]) + {{- else -}} + entity.{{.Field.JoinGo `.`}}, err = ec.{{.Type.UnmarshalFunc}}(ctx, reps[i].entity["{{.Field.Join `"].(map[string]any)["`}}"]) + {{- end }} if err != nil { return err } @@ -276,11 +294,14 @@ func (ec *executionContext) resolveManyEntities( {{- if .Resolvers }} func entityResolverNameFor{{$entity.Name}}(ctx context.Context, rep EntityRepresentation) (string, error) { + // we collect errors because a later entity resolver may work fine + // when an entity has multiple keys + entityResolverErrs := []error{} {{- range .Resolvers }} for { var ( m EntityRepresentation - val interface{} + val any ok bool ) _ = val @@ -292,10 +313,15 @@ func (ec *executionContext) resolveManyEntities( {{- range $i, $field := .Field }} val, ok = m["{{.}}"] if !ok { + entityResolverErrs = append(entityResolverErrs, + fmt.Errorf("%w due to missing Key Field \"{{.}}\" for {{$entity.Name}}", ErrTypeNotFound)) break } {{- if (ne $i $keyField.Field.LastIndex ) }} - if m, ok = val.(map[string]interface{}); !ok { + if m, ok = val.(map[string]any); !ok { + // nested field value is not a map[string]interface so don't use it + entityResolverErrs = append(entityResolverErrs, + fmt.Errorf("%w due to nested Key Field \"{{.}}\" value not matching map[string]any for {{$entity.Name}}", ErrTypeNotFound)) break } {{- else}} @@ -306,12 +332,15 @@ func (ec *executionContext) resolveManyEntities( {{- end}} {{- end }} if allNull { + entityResolverErrs = append(entityResolverErrs, + fmt.Errorf("%w due to all null value KeyFields for {{$entity.Name}}", ErrTypeNotFound)) break } return "{{.ResolverName}}", nil } {{- end }} - return "", fmt.Errorf("%w for {{$entity.Name}}", ErrTypeNotFound) + return "", fmt.Errorf("%w for {{$entity.Name}} due to %v", ErrTypeNotFound, + errors.Join(entityResolverErrs...).Error()) } {{- end }} {{- end }} diff --git a/vendor/github.com/99designs/gqlgen/plugin/federation/fieldset/fieldset.go b/vendor/github.com/99designs/gqlgen/plugin/federation/fieldset/fieldset.go index 8ff53cd2..65b32eae 100644 --- a/vendor/github.com/99designs/gqlgen/plugin/federation/fieldset/fieldset.go +++ b/vendor/github.com/99designs/gqlgen/plugin/federation/fieldset/fieldset.go @@ -133,8 +133,22 @@ func (f Field) LastIndex() int { // parseUnnestedKeyFieldSet // handles simple case where none of the fields are nested. func parseUnnestedKeyFieldSet(raw string, prefix []string) Set { ret := Set{} + unionField := false for _, s := range strings.Fields(raw) { + if s == "..." { + continue + } + if s == "on" { + unionField = true + continue + } + + if unionField { + s = "... on " + s + unionField = false + } + next := append(prefix[0:len(prefix):len(prefix)], s) //nolint:gocritic // set cap=len in order to force slice reallocation ret = append(ret, next) } diff --git a/vendor/github.com/99designs/gqlgen/plugin/federation/requires.gotpl b/vendor/github.com/99designs/gqlgen/plugin/federation/requires.gotpl index 17377104..64d8b796 100644 --- a/vendor/github.com/99designs/gqlgen/plugin/federation/requires.gotpl +++ b/vendor/github.com/99designs/gqlgen/plugin/federation/requires.gotpl @@ -12,7 +12,7 @@ {{- else -}} // {{.FuncName}} is the requires populator for the {{.Entity.Def.Name}} entity. {{- end }} -func (ec *executionContext) {{.FuncName}}(ctx context.Context, entity *{{.Entity.GetTypeInfo}}, reps map[string]interface{}) error { +func (ec *executionContext) {{.FuncName}}(ctx context.Context, entity *{{.Entity.GetTypeInfo}}, reps map[string]any) error { {{.Implementation}} } {{ end }} diff --git a/vendor/github.com/99designs/gqlgen/plugin/modelgen/models.go b/vendor/github.com/99designs/gqlgen/plugin/modelgen/models.go index 660e3537..0289b656 100644 --- a/vendor/github.com/99designs/gqlgen/plugin/modelgen/models.go +++ b/vendor/github.com/99designs/gqlgen/plugin/modelgen/models.go @@ -356,7 +356,6 @@ func (m *Plugin) generateField( schemaType *ast.Definition, field *ast.FieldDefinition, ) (*Field, error) { - var omittableType types.Type var typ types.Type fieldDef := cfg.Schema.Types[field.Type.Name()] @@ -449,13 +448,9 @@ func (m *Plugin) generateField( return nil, fmt.Errorf("generror: field %v.%v: omittable is only applicable to nullable input fields", schemaType.Name, field.Name) } - var err error - - if omittableType == nil { - omittableType, err = binder.FindTypeFromName("github.com/99designs/gqlgen/graphql.Omittable") - if err != nil { - return nil, err - } + omittableType, err := binder.FindTypeFromName("github.com/99designs/gqlgen/graphql.Omittable") + if err != nil { + return nil, err } f.Type, err = binder.InstantiateType(omittableType, []types.Type{f.Type}) diff --git a/vendor/github.com/99designs/gqlgen/plugin/modelgen/models.gotpl b/vendor/github.com/99designs/gqlgen/plugin/modelgen/models.gotpl index b1114693..29314f19 100644 --- a/vendor/github.com/99designs/gqlgen/plugin/modelgen/models.gotpl +++ b/vendor/github.com/99designs/gqlgen/plugin/modelgen/models.gotpl @@ -84,7 +84,7 @@ return string(e) } - func (e *{{ goModelName .Name }}) UnmarshalGQL(v interface{}) error { + func (e *{{ goModelName .Name }}) UnmarshalGQL(v any) error { str, ok := v.(string) if !ok { return fmt.Errorf("enums must be strings") diff --git a/vendor/github.com/99designs/gqlgen/plugin/resolvergen/resolver.go b/vendor/github.com/99designs/gqlgen/plugin/resolvergen/resolver.go index c0e04089..065ecfb5 100644 --- a/vendor/github.com/99designs/gqlgen/plugin/resolvergen/resolver.go +++ b/vendor/github.com/99designs/gqlgen/plugin/resolvergen/resolver.go @@ -5,7 +5,6 @@ import ( "errors" "fmt" "go/ast" - "io/fs" "os" "path/filepath" "strings" @@ -45,6 +44,7 @@ func (m *Plugin) GenerateCode(data *codegen.Data) error { case config.LayoutSingleFile: return m.generateSingleFile(data) case config.LayoutFollowSchema: + return m.generatePerSchema(data) } @@ -53,6 +53,14 @@ func (m *Plugin) GenerateCode(data *codegen.Data) error { func (m *Plugin) generateSingleFile(data *codegen.Data) error { file := File{} + + if fileExists(data.Config.Resolver.Filename) && + data.Config.Resolver.PreserveResolver { + // file already exists and config says not to update resolver + // so just return + return nil + } + rewriter, err := rewrite.New(data.Config.Resolver.Dir()) if err != nil { return err @@ -85,7 +93,7 @@ func (m *Plugin) generateSingleFile(data *codegen.Data) error { } } - if _, err := os.Stat(data.Config.Resolver.Filename); err == nil { + if fileExists(data.Config.Resolver.Filename) { file.name = data.Config.Resolver.Filename file.imports = rewriter.ExistingImports(file.name) file.RemainingSource = rewriter.RemainingSource(file.name) @@ -104,9 +112,14 @@ func (m *Plugin) generateSingleFile(data *codegen.Data) error { newResolverTemplate = readResolverTemplate(data.Config.Resolver.ResolverTemplate) } + fileNotice := `// THIS CODE WILL BE UPDATED WITH SCHEMA CHANGES. PREVIOUS IMPLEMENTATION FOR SCHEMA CHANGES WILL BE KEPT IN THE COMMENT SECTION. IMPLEMENTATION FOR UNCHANGED SCHEMA WILL BE KEPT.` + if data.Config.Resolver.PreserveResolver { + fileNotice = `// THIS CODE IS A STARTING POINT ONLY. IT WILL NOT BE UPDATED WITH SCHEMA CHANGES.` + } + return templates.Render(templates.Options{ PackageName: data.Config.Resolver.Package, - FileNotice: `// THIS CODE WILL BE UPDATED WITH SCHEMA CHANGES. PREVIOUS IMPLEMENTATION FOR SCHEMA CHANGES WILL BE KEPT IN THE COMMENT SECTION. IMPLEMENTATION FOR UNCHANGED SCHEMA WILL BE KEPT.`, + FileNotice: fileNotice, Filename: data.Config.Resolver.Filename, Data: resolverBuild, Packages: data.Config.Packages, @@ -146,6 +159,7 @@ func (m *Plugin) generatePerSchema(data *codegen.Data) error { continue } structName := templates.LcFirst(o.Name) + templates.UcFirst(data.Config.Resolver.Type) + // TODO(steve): Why do we need to trimLeft "\" here? Some bazel thing? comment := strings.TrimSpace(strings.TrimLeft(rewriter.GetMethodComment(structName, f.GoFieldName), `\`)) implementation := strings.TrimSpace(rewriter.GetMethodBody(structName, f.GoFieldName)) resolver := Resolver{o, f, rewriter.GetPrevDecl(structName, f.GoFieldName), comment, implementation, nil} @@ -183,6 +197,11 @@ func (m *Plugin) generatePerSchema(data *codegen.Data) error { } for _, file := range files { + if fileExists(file.name) && + data.Config.Resolver.PreserveResolver { + // file already exists and config says not to update resolver + continue + } resolverBuild := &ResolverBuild{ File: file, PackageName: data.Config.Resolver.Package, @@ -216,7 +235,7 @@ func (m *Plugin) generatePerSchema(data *codegen.Data) error { } } - if _, err := os.Stat(data.Config.Resolver.Filename); errors.Is(err, fs.ErrNotExist) { + if !fileExists(data.Config.Resolver.Filename) { err := templates.Render(templates.Options{ PackageName: data.Config.Resolver.Package, FileNotice: ` @@ -304,3 +323,10 @@ func readResolverTemplate(customResolverTemplate string) string { } return string(contentBytes) } + +func fileExists(fileName string) bool { + if _, err := os.Stat(fileName); err == nil { + return true + } + return false +} diff --git a/vendor/github.com/99designs/gqlgen/plugin/resolvergen/resolver.gotpl b/vendor/github.com/99designs/gqlgen/plugin/resolvergen/resolver.gotpl index ad6c1085..bede575a 100644 --- a/vendor/github.com/99designs/gqlgen/plugin/resolvergen/resolver.gotpl +++ b/vendor/github.com/99designs/gqlgen/plugin/resolvergen/resolver.gotpl @@ -20,7 +20,7 @@ {{ range $resolver := .Resolvers -}} {{ if $resolver.Comment -}} - // {{ $resolver.Comment }} + {{with $resolver.Comment}}{{.|prefixLines "// "}}{{end}} {{- else if not $.OmitTemplateComment -}} // {{ $resolver.Field.GoFieldName }} is the resolver for the {{ $resolver.Field.Name }} field. {{- end }} diff --git a/vendor/github.com/99designs/gqlgen/plugin/servergen/server.gotpl b/vendor/github.com/99designs/gqlgen/plugin/servergen/server.gotpl index a3ae2a87..eda7863c 100644 --- a/vendor/github.com/99designs/gqlgen/plugin/servergen/server.gotpl +++ b/vendor/github.com/99designs/gqlgen/plugin/servergen/server.gotpl @@ -2,8 +2,12 @@ {{ reserveImport "log" }} {{ reserveImport "net/http" }} {{ reserveImport "os" }} +{{ reserveImport "github.com/vektah/gqlparser/v2/ast" }} {{ reserveImport "github.com/99designs/gqlgen/graphql/playground" }} {{ reserveImport "github.com/99designs/gqlgen/graphql/handler" }} +{{ reserveImport "github.com/99designs/gqlgen/graphql/handler/extension" }} +{{ reserveImport "github.com/99designs/gqlgen/graphql/handler/lru" }} +{{ reserveImport "github.com/99designs/gqlgen/graphql/handler/transport" }} const defaultPort = "8080" @@ -13,7 +17,18 @@ func main() { port = defaultPort } - srv := handler.NewDefaultServer({{ lookupImport .ExecPackageName }}.NewExecutableSchema({{ lookupImport .ExecPackageName}}.Config{Resolvers: &{{ lookupImport .ResolverPackageName}}.Resolver{}})) + srv := handler.New({{ lookupImport .ExecPackageName }}.NewExecutableSchema({{ lookupImport .ExecPackageName}}.Config{Resolvers: &{{ lookupImport .ResolverPackageName}}.Resolver{}})) + + srv.AddTransport(transport.Options{}) + srv.AddTransport(transport.GET{}) + srv.AddTransport(transport.POST{}) + + srv.SetQueryCache(lru.New[*ast.QueryDocument](1000)) + + srv.Use(extension.Introspection{}) + srv.Use(extension.AutomaticPersistedQuery{ + Cache: lru.New[string](100), + }) http.Handle("/", playground.Handler("GraphQL playground", "/query")) http.Handle("/query", srv) diff --git a/vendor/github.com/Masterminds/semver/v3/version.go b/vendor/github.com/Masterminds/semver/v3/version.go index ff499fb6..304edc34 100644 --- a/vendor/github.com/Masterminds/semver/v3/version.go +++ b/vendor/github.com/Masterminds/semver/v3/version.go @@ -39,9 +39,11 @@ var ( ) // semVerRegex is the regular expression used to parse a semantic version. -const semVerRegex string = `v?([0-9]+)(\.[0-9]+)?(\.[0-9]+)?` + - `(-([0-9A-Za-z\-]+(\.[0-9A-Za-z\-]+)*))?` + - `(\+([0-9A-Za-z\-]+(\.[0-9A-Za-z\-]+)*))?` +// This is not the official regex from the semver spec. It has been modified to allow for loose handling +// where versions like 2.1 are detected. +const semVerRegex string = `v?(0|[1-9]\d*)(?:\.(0|[1-9]\d*))?(?:\.(0|[1-9]\d*))?` + + `(?:-((?:0|[1-9]\d*|\d*[a-zA-Z-][0-9a-zA-Z-]*)(?:\.(?:0|[1-9]\d*|\d*[a-zA-Z-][0-9a-zA-Z-]*))*))?` + + `(?:\+([0-9a-zA-Z-]+(?:\.[0-9a-zA-Z-]+)*))?` // Version represents a single semantic version. type Version struct { @@ -146,8 +148,8 @@ func NewVersion(v string) (*Version, error) { } sv := &Version{ - metadata: m[8], - pre: m[5], + metadata: m[5], + pre: m[4], original: v, } @@ -158,7 +160,7 @@ func NewVersion(v string) (*Version, error) { } if m[2] != "" { - sv.minor, err = strconv.ParseUint(strings.TrimPrefix(m[2], "."), 10, 64) + sv.minor, err = strconv.ParseUint(m[2], 10, 64) if err != nil { return nil, fmt.Errorf("Error parsing version segment: %s", err) } @@ -167,7 +169,7 @@ func NewVersion(v string) (*Version, error) { } if m[3] != "" { - sv.patch, err = strconv.ParseUint(strings.TrimPrefix(m[3], "."), 10, 64) + sv.patch, err = strconv.ParseUint(m[3], 10, 64) if err != nil { return nil, fmt.Errorf("Error parsing version segment: %s", err) } @@ -612,7 +614,9 @@ func containsOnly(s string, comp string) bool { func validatePrerelease(p string) error { eparts := strings.Split(p, ".") for _, p := range eparts { - if containsOnly(p, num) { + if p == "" { + return ErrInvalidMetadata + } else if containsOnly(p, num) { if len(p) > 1 && p[0] == '0' { return ErrSegmentStartsZero } @@ -631,7 +635,9 @@ func validatePrerelease(p string) error { func validateMetadata(m string) error { eparts := strings.Split(m, ".") for _, p := range eparts { - if !containsOnly(p, allowed) { + if p == "" { + return ErrInvalidMetadata + } else if !containsOnly(p, allowed) { return ErrInvalidMetadata } } diff --git a/vendor/github.com/adhocore/gronx/next.go b/vendor/github.com/adhocore/gronx/next.go index 3643374a..f52375e3 100644 --- a/vendor/github.com/adhocore/gronx/next.go +++ b/vendor/github.com/adhocore/gronx/next.go @@ -29,7 +29,7 @@ func NextTickAfter(expr string, start time.Time, inclRefTime bool) (time.Time, e } segments, _ := Segments(expr) - if len(segments) > 6 && isUnreachableYear(segments[6], next, inclRefTime, false) { + if len(segments) > 6 && isUnreachableYear(segments[6], next, false) { return next, fmt.Errorf("unreachable year segment: %s", segments[6]) } @@ -123,25 +123,19 @@ over: var dashRe = regexp.MustCompile(`/.*$`) -func isUnreachableYear(year string, ref time.Time, incl bool, reverse bool) bool { +func isUnreachableYear(year string, ref time.Time, reverse bool) bool { if year == "*" || year == "?" { return false } - edge, inc := ref.Year(), 1 - if !incl { - if reverse { - inc = -1 - } - edge += inc - } + edge := ref.Year() for _, offset := range strings.Split(year, ",") { if strings.Index(offset, "*/") == 0 || strings.Index(offset, "0/") == 0 { return false } for _, part := range strings.Split(dashRe.ReplaceAllString(offset, ""), "-") { val, err := strconv.Atoi(part) - if err != nil || (!reverse && val >= edge) || (reverse && val < edge) { + if err != nil || (!reverse && val >= edge) || (reverse && val <= edge) { return false } } diff --git a/vendor/github.com/adhocore/gronx/prev.go b/vendor/github.com/adhocore/gronx/prev.go index cc2fc942..4f29ef11 100644 --- a/vendor/github.com/adhocore/gronx/prev.go +++ b/vendor/github.com/adhocore/gronx/prev.go @@ -19,7 +19,7 @@ func PrevTickBefore(expr string, start time.Time, inclRefTime bool) (time.Time, } segments, _ := Segments(expr) - if len(segments) > 6 && isUnreachableYear(segments[6], prev, inclRefTime, true) { + if len(segments) > 6 && isUnreachableYear(segments[6], prev, true) { return prev, fmt.Errorf("unreachable year segment: %s", segments[6]) } diff --git a/vendor/github.com/caddyserver/certmagic/README.md b/vendor/github.com/caddyserver/certmagic/README.md index c1aa8f52..4ab1bf5c 100644 --- a/vendor/github.com/caddyserver/certmagic/README.md +++ b/vendor/github.com/caddyserver/certmagic/README.md @@ -90,7 +90,7 @@ CertMagic - Automatic HTTPS using Let's Encrypt - Exponential backoff with carefully-tuned intervals - Retries with optional test/staging CA endpoint instead of production, to avoid rate limits - Written in Go, a language with memory-safety guarantees -- Powered by [ACMEz](https://github.com/mholt/acmez/v2), _the_ premier ACME client library for Go +- Powered by [ACMEz](https://github.com/mholt/acmez/v3), _the_ premier ACME client library for Go - All [libdns](https://github.com/libdns) DNS providers work out-of-the-box - Pluggable storage backends (default: file system) - Pluggable key sources @@ -567,7 +567,7 @@ We welcome your contributions! Please see our **[contributing guidelines](https: ## Project History -CertMagic is the core of Caddy's advanced TLS automation code, extracted into a library. The underlying ACME client implementation is [ACMEz](https://github.com/mholt/acmez/v2). CertMagic's code was originally a central part of Caddy even before Let's Encrypt entered public beta in 2015. +CertMagic is the core of Caddy's advanced TLS automation code, extracted into a library. The underlying ACME client implementation is [ACMEz](https://github.com/mholt/acmez/v3). CertMagic's code was originally a central part of Caddy even before Let's Encrypt entered public beta in 2015. In the years since then, Caddy's TLS automation techniques have been widely adopted, tried and tested in production, and served millions of sites and secured trillions of connections. @@ -579,9 +579,9 @@ Caddy was also the first to sport "on-demand" issuance technology, which obtains Consequently, CertMagic brings all these (and more) features and capabilities right into your own Go programs. -You can [watch a 2016 dotGo talk](https://www.dotconferences.com/2016/10/matthew-holt-go-with-acme) by the author of this library about using ACME to automate certificate management in Go programs: +You can [watch a 2016 dotGo talk](https://youtu.be/KdX51QJWQTA) by the author of this library about using ACME to automate certificate management in Go programs: -[![Matthew Holt speaking at dotGo 2016 about ACME in Go](https://user-images.githubusercontent.com/1128849/49921557-2d506780-fe6b-11e8-97bf-6053b6b4eb48.png)](https://www.dotconferences.com/2016/10/matthew-holt-go-with-acme) +[![Matthew Holt speaking at dotGo 2016 about ACME in Go](https://user-images.githubusercontent.com/1128849/49921557-2d506780-fe6b-11e8-97bf-6053b6b4eb48.png)](https://youtu.be/KdX51QJWQTA) diff --git a/vendor/github.com/caddyserver/certmagic/account.go b/vendor/github.com/caddyserver/certmagic/account.go index 0c43ad63..7b8efa05 100644 --- a/vendor/github.com/caddyserver/certmagic/account.go +++ b/vendor/github.com/caddyserver/certmagic/account.go @@ -32,7 +32,7 @@ import ( "strings" "sync" - "github.com/mholt/acmez/v2/acme" + "github.com/mholt/acmez/v3/acme" "go.uber.org/zap" ) diff --git a/vendor/github.com/caddyserver/certmagic/acmeclient.go b/vendor/github.com/caddyserver/certmagic/acmeclient.go index c6e1f6ed..6e1f1f7f 100644 --- a/vendor/github.com/caddyserver/certmagic/acmeclient.go +++ b/vendor/github.com/caddyserver/certmagic/acmeclient.go @@ -18,6 +18,7 @@ import ( "context" "crypto/x509" "fmt" + "log/slog" "net" "net/http" "net/url" @@ -26,9 +27,10 @@ import ( "sync" "time" - "github.com/mholt/acmez/v2" - "github.com/mholt/acmez/v2/acme" + "github.com/mholt/acmez/v3" + "github.com/mholt/acmez/v3/acme" "go.uber.org/zap" + "go.uber.org/zap/exp/zapslog" ) // acmeClient holds state necessary to perform ACME operations @@ -276,7 +278,7 @@ func (iss *ACMEIssuer) newBasicACMEClient() (*acmez.Client, error) { Directory: caURL, UserAgent: buildUAString(), HTTPClient: iss.httpClient, - Logger: iss.Logger.Named("acme_client"), + Logger: slog.New(zapslog.NewHandler(iss.Logger.Named("acme_client").Core())), }, }, nil } diff --git a/vendor/github.com/caddyserver/certmagic/acmeissuer.go b/vendor/github.com/caddyserver/certmagic/acmeissuer.go index e010f087..02656526 100644 --- a/vendor/github.com/caddyserver/certmagic/acmeissuer.go +++ b/vendor/github.com/caddyserver/certmagic/acmeissuer.go @@ -28,8 +28,8 @@ import ( "sync" "time" - "github.com/mholt/acmez/v2" - "github.com/mholt/acmez/v2/acme" + "github.com/mholt/acmez/v3" + "github.com/mholt/acmez/v3/acme" "go.uber.org/zap" ) @@ -69,6 +69,15 @@ type ACMEIssuer struct { // with this ACME account ExternalAccount *acme.EAB + // Optionally select an ACME profile offered + // by the ACME server. The list of supported + // profile names can be obtained from the ACME + // server's directory endpoint. For details: + // https://datatracker.ietf.org/doc/draft-aaron-acme-profiles/ + // + // (EXPERIMENTAL: Subject to change.) + Profile string + // Optionally specify the validity period of // the certificate(s) here as offsets from the // approximate time of certificate issuance, @@ -282,7 +291,7 @@ func NewACMEIssuer(cfg *Config, template ACMEIssuer) *ACMEIssuer { } // IssuerKey returns the unique issuer key for the -// confgured CA endpoint. +// configured CA endpoint. func (am *ACMEIssuer) IssuerKey() string { return am.issuerKey(am.CA) } @@ -450,6 +459,7 @@ func (am *ACMEIssuer) doIssue(ctx context.Context, csr *x509.CertificateRequest, if am.NotAfter != 0 { params.NotAfter = time.Now().Add(am.NotAfter) } + params.Profile = am.Profile // Notify the ACME server we are replacing a certificate (if the caller says we are), // only if the following conditions are met: @@ -482,7 +492,7 @@ func (am *ACMEIssuer) doIssue(ctx context.Context, csr *x509.CertificateRequest, zap.String("account_id", client.account.Location), zap.Strings("account_contact", client.account.Contact), zap.String("key_location", am.storageKeyUserPrivateKey(client.acmeClient.Directory, am.getEmail())), - zap.Object("problem", prob)) + zap.Any("problem", prob)) // the account we have no longer exists on the CA, so we need to create a new one; // we could use the same key pair, but this is a good opportunity to rotate keys diff --git a/vendor/github.com/caddyserver/certmagic/certificates.go b/vendor/github.com/caddyserver/certmagic/certificates.go index 2965712a..05b10140 100644 --- a/vendor/github.com/caddyserver/certmagic/certificates.go +++ b/vendor/github.com/caddyserver/certmagic/certificates.go @@ -26,7 +26,7 @@ import ( "strings" "time" - "github.com/mholt/acmez/v2/acme" + "github.com/mholt/acmez/v3/acme" "go.uber.org/zap" "golang.org/x/crypto/ocsp" ) @@ -87,6 +87,14 @@ func (cert Certificate) NeedsRenewal(cfg *Config) bool { // call it again to see if the cert in storage still needs renewal -- you probably don't want // to log the second time for checking the cert in storage which is mainly for synchronization. func (cfg *Config) certNeedsRenewal(leaf *x509.Certificate, ari acme.RenewalInfo, emitLogs bool) bool { + // though this should never happen, safeguard to avoid panics which happened before (since patched; but just in case) + if leaf == nil { + if emitLogs { + cfg.Logger.Error("cannot check if nil leaf cert needs renewal") + } + return false + } + expiration := expiresAt(leaf) var logger *zap.Logger @@ -108,7 +116,7 @@ func (cfg *Config) certNeedsRenewal(leaf *x509.Certificate, ari acme.RenewalInfo // (notice that we don't strictly require an ARI window to also exist; we presume // that if a time has been selected, a window does or did exist, even if it didn't // get stored/encoded for some reason - but also: this allows administrators to - // manually or explicitly schedule a renewal time indepedently of ARI which could + // manually or explicitly schedule a renewal time independently of ARI which could // be useful) selectedTime := ari.SelectedTime @@ -145,7 +153,7 @@ func (cfg *Config) certNeedsRenewal(leaf *x509.Certificate, ari acme.RenewalInfo // possibility of a bug in ARI compromising a site's uptime: we should always always // always give heed to actual validity period if currentlyInRenewalWindow(leaf.NotBefore, expiration, 1.0/20.0) { - logger.Warn("certificate is in emergency renewal window; superceding ARI", + logger.Warn("certificate is in emergency renewal window; superseding ARI", zap.Duration("remaining", time.Until(expiration)), zap.Time("renewal_cutoff", cutoff)) return true @@ -188,6 +196,14 @@ func (cert Certificate) Expired() bool { return time.Now().After(expiresAt(cert.Leaf)) } +// Lifetime returns the duration of the certificate's validity. +func (cert Certificate) Lifetime() time.Duration { + if cert.Leaf == nil || cert.Leaf.NotAfter.IsZero() { + return 0 + } + return expiresAt(cert.Leaf).Sub(cert.Leaf.NotBefore) +} + // currentlyInRenewalWindow returns true if the current time is within // (or after) the renewal window, according to the given start/end // dates and the ratio of the renewal window. If true is returned, diff --git a/vendor/github.com/caddyserver/certmagic/certmagic.go b/vendor/github.com/caddyserver/certmagic/certmagic.go index 6b7be634..f54cdd31 100644 --- a/vendor/github.com/caddyserver/certmagic/certmagic.go +++ b/vendor/github.com/caddyserver/certmagic/certmagic.go @@ -28,7 +28,7 @@ // you use this lower-level API, you'll have to be sure to solve the HTTP // and TLS-ALPN challenges yourself (unless you disabled them or use the // DNS challenge) by using the provided Config.GetCertificate function -// in your tls.Config and/or Config.HTTPChallangeHandler in your HTTP +// in your tls.Config and/or Config.HTTPChallengeHandler in your HTTP // handler. // // See the package's README for more instruction. @@ -261,7 +261,7 @@ func ManageAsync(ctx context.Context, domainNames []string) error { // containing the names passed into those functions if // no DecisionFunc is set. This ensures some degree of // control by default to avoid certificate operations for -// aribtrary domain names. To override this whitelist, +// arbitrary domain names. To override this whitelist, // manually specify a DecisionFunc. To impose rate limits, // specify your own DecisionFunc. type OnDemandConfig struct { diff --git a/vendor/github.com/caddyserver/certmagic/config.go b/vendor/github.com/caddyserver/certmagic/config.go index a7771848..2d1f07d2 100644 --- a/vendor/github.com/caddyserver/certmagic/config.go +++ b/vendor/github.com/caddyserver/certmagic/config.go @@ -35,8 +35,8 @@ import ( "strings" "time" - "github.com/mholt/acmez/v2" - "github.com/mholt/acmez/v2/acme" + "github.com/mholt/acmez/v3" + "github.com/mholt/acmez/v3/acme" "go.uber.org/zap" "golang.org/x/crypto/ocsp" "golang.org/x/net/idna" @@ -874,7 +874,7 @@ func (cfg *Config) renewCert(ctx context.Context, name string, force, interactiv // are compliant, so their CSR requirements just needlessly add friction, complexity, // and inefficiency for clients. CommonName has been deprecated for 25+ years. useCSR := csr - if _, ok := issuer.(*ZeroSSLIssuer); ok { + if issuer.IssuerKey() == "zerossl" { useCSR, err = cfg.generateCSR(privateKey, []string{name}, true) if err != nil { return err diff --git a/vendor/github.com/caddyserver/certmagic/handshake.go b/vendor/github.com/caddyserver/certmagic/handshake.go index 1ff0ce27..55389b12 100644 --- a/vendor/github.com/caddyserver/certmagic/handshake.go +++ b/vendor/github.com/caddyserver/certmagic/handshake.go @@ -25,7 +25,7 @@ import ( "sync" "time" - "github.com/mholt/acmez/v2" + "github.com/mholt/acmez/v3" "go.uber.org/zap" "golang.org/x/crypto/ocsp" ) @@ -231,9 +231,16 @@ func (cfg *Config) selectCert(hello *tls.ClientHelloInfo, name string) (Certific // otherwise it returns an expired certificate that the client supports, // otherwise it just returns the first certificate in the list of choices. func DefaultCertificateSelector(hello *tls.ClientHelloInfo, choices []Certificate) (Certificate, error) { + if len(choices) == 1 { + // Fast path: There's only one choice, so we would always return that one + // regardless of whether it is expired or not compatible. + return choices[0], nil + } if len(choices) == 0 { return Certificate{}, fmt.Errorf("no certificates available") } + + // Slow path: There are choices, so we need to check each of them. now := time.Now() best := choices[0] for _, choice := range choices { @@ -549,12 +556,31 @@ func (cfg *Config) obtainOnDemandCertificate(ctx context.Context, hello *tls.Cli // // This function is safe for use by multiple concurrent goroutines. func (cfg *Config) handshakeMaintenance(ctx context.Context, hello *tls.ClientHelloInfo, cert Certificate) (Certificate, error) { - logger := cfg.Logger.Named("on_demand") + logger := cfg.Logger.Named("on_demand").With( + zap.Strings("identifiers", cert.Names), + zap.String("server_name", hello.ServerName)) + + renewIfNecessary := func(ctx context.Context, hello *tls.ClientHelloInfo, cert Certificate) (Certificate, error) { + if cert.Leaf == nil { + return cert, fmt.Errorf("leaf certificate is unexpectedly nil: either the Certificate got replaced by an empty value, or it was not properly initialized") + } + if cfg.certNeedsRenewal(cert.Leaf, cert.ari, true) { + // Check if the certificate still exists on disk. If not, we need to obtain a new one. + // This can happen if the certificate was cleaned up by the storage cleaner, but still + // remains in the in-memory cache. + if !cfg.storageHasCertResourcesAnyIssuer(ctx, cert.Names[0]) { + logger.Debug("certificate not found on disk; obtaining new certificate") + return cfg.obtainOnDemandCertificate(ctx, hello) + } + // Otherwise, renew the certificate. + return cfg.renewDynamicCertificate(ctx, hello, cert) + } + return cert, nil + } // Check OCSP staple validity if cert.ocsp != nil && !freshOCSP(cert.ocsp) { logger.Debug("OCSP response needs refreshing", - zap.Strings("identifiers", cert.Names), zap.Int("ocsp_status", cert.ocsp.Status), zap.Time("this_update", cert.ocsp.ThisUpdate), zap.Time("next_update", cert.ocsp.NextUpdate)) @@ -563,13 +589,9 @@ func (cfg *Config) handshakeMaintenance(ctx context.Context, hello *tls.ClientHe if err != nil { // An error with OCSP stapling is not the end of the world, and in fact, is // quite common considering not all certs have issuer URLs that support it. - logger.Warn("stapling OCSP", - zap.String("server_name", hello.ServerName), - zap.Strings("sans", cert.Names), - zap.Error(err)) + logger.Warn("stapling OCSP", zap.Error(err)) } else { logger.Debug("successfully stapled new OCSP response", - zap.Strings("identifiers", cert.Names), zap.Int("ocsp_status", cert.ocsp.Status), zap.Time("this_update", cert.ocsp.ThisUpdate), zap.Time("next_update", cert.ocsp.NextUpdate)) @@ -581,21 +603,39 @@ func (cfg *Config) handshakeMaintenance(ctx context.Context, hello *tls.ClientHe cfg.certCache.mu.Unlock() } - // Check ARI status - if !cfg.DisableARI && cert.ari.NeedsRefresh() { - // we ignore the second return value here because we go on to check renewal status below regardless - var err error - cert, _, err = cfg.updateARI(ctx, cert, logger) - if err != nil { - logger.Error("updated ARI", zap.Error(err)) - } + // Check ARI status, but it's only relevant if the certificate is not expired (otherwise, we already know it needs renewal!) + if !cfg.DisableARI && cert.ari.NeedsRefresh() && time.Now().Before(cert.Leaf.NotAfter) { + // update ARI in a goroutine to avoid blocking an active handshake, since the results of + // this do not strictly affect the handshake; even though the cert may be updated with + // the new ARI, it is also updated in the cache and in storage, so future handshakes + // will utilize it + go func(hello *tls.ClientHelloInfo, cert Certificate, logger *zap.Logger) { + // TODO: a different context that isn't tied to the handshake is probably better + // than a generic background context; maybe a longer-lived server config context, + // or something that the importing package sets on the Config struct; for example, + // a Caddy config context could be good, so that ARI updates will continue after + // the handshake goes away, but will be stopped if the underlying server is stopped + // (for now, use an unusual timeout to help recognize it in log patterns, if needed) + ctx, cancel := context.WithTimeout(context.Background(), 8*time.Minute) + defer cancel() + + var err error + // we ignore the second return value here because we check renewal status below regardless + cert, _, err = cfg.updateARI(ctx, cert, logger) + if err != nil { + logger.Error("updating ARI", zap.Error(err)) + } + _, err = renewIfNecessary(ctx, hello, cert) + if err != nil { + logger.Error("renewing certificate based on updated ARI", zap.Error(err)) + } + }(hello, cert, logger) } // We attempt to replace any certificates that were revoked. // Crucially, this happens OUTSIDE a lock on the certCache. if certShouldBeForceRenewed(cert) { logger.Warn("on-demand certificate's OCSP status is REVOKED; will try to forcefully renew", - zap.Strings("identifiers", cert.Names), zap.Int("ocsp_status", cert.ocsp.Status), zap.Time("revoked_at", cert.ocsp.RevokedAt), zap.Time("this_update", cert.ocsp.ThisUpdate), @@ -603,21 +643,8 @@ func (cfg *Config) handshakeMaintenance(ctx context.Context, hello *tls.ClientHe return cfg.renewDynamicCertificate(ctx, hello, cert) } - // Check cert expiration - if cfg.certNeedsRenewal(cert.Leaf, cert.ari, true) { - // Check if the certificate still exists on disk. If not, we need to obtain a new one. - // This can happen if the certificate was cleaned up by the storage cleaner, but still - // remains in the in-memory cache. - if !cfg.storageHasCertResourcesAnyIssuer(ctx, cert.Names[0]) { - logger.Debug("certificate not found on disk; obtaining new certificate", - zap.Strings("identifiers", cert.Names)) - return cfg.obtainOnDemandCertificate(ctx, hello) - } - // Otherwise, renew the certificate. - return cfg.renewDynamicCertificate(ctx, hello, cert) - } - - return cert, nil + // Since renewal conditions may have changed, do a renewal if necessary + return renewIfNecessary(ctx, hello, cert) } // renewDynamicCertificate renews the certificate for name using cfg. It returns the @@ -943,6 +970,6 @@ type helloInfoCtxKey string // a context.Context within a DecisionFunc. However, be advised that it is best practice // that the decision whether to obtain a certificate is be based solely on the name, // not other properties of the specific connection/client requesting the connection. -// For example, it is not adviseable to use a client's IP address to decide whether to +// For example, it is not advisable to use a client's IP address to decide whether to // allow a certificate. Instead, the ClientHello can be useful for logging, etc. const ClientHelloInfoCtxKey helloInfoCtxKey = "certmagic:ClientHelloInfo" diff --git a/vendor/github.com/caddyserver/certmagic/httphandlers.go b/vendor/github.com/caddyserver/certmagic/httphandlers.go index 70dcff02..ffbda834 100644 --- a/vendor/github.com/caddyserver/certmagic/httphandlers.go +++ b/vendor/github.com/caddyserver/certmagic/httphandlers.go @@ -19,7 +19,7 @@ import ( "net/url" "strings" - "github.com/mholt/acmez/v2/acme" + "github.com/mholt/acmez/v3/acme" "go.uber.org/zap" ) diff --git a/vendor/github.com/caddyserver/certmagic/maintain.go b/vendor/github.com/caddyserver/certmagic/maintain.go index dea2cfdf..a27ca96a 100644 --- a/vendor/github.com/caddyserver/certmagic/maintain.go +++ b/vendor/github.com/caddyserver/certmagic/maintain.go @@ -27,7 +27,7 @@ import ( "strings" "time" - "github.com/mholt/acmez/v2/acme" + "github.com/mholt/acmez/v3/acme" "go.uber.org/zap" "golang.org/x/crypto/ocsp" ) @@ -507,7 +507,19 @@ func (cfg *Config) updateARI(ctx context.Context, cert Certificate, logger *zap. if err == nil && gotNewARI { // great, storage has a newer one we can use cfg.certCache.mu.Lock() - updatedCert = cfg.certCache.cache[cert.hash] + var ok bool + updatedCert, ok = cfg.certCache.cache[cert.hash] + if !ok { + // cert is no longer in the cache... why? what's the right thing to do here? + cfg.certCache.mu.Unlock() + updatedCert = cert // return input cert, not an empty one + updatedCert.ari = newARI // might as well give it the new ARI for the benefit of our caller, but it won't be updated in the cache or in storage + logger.Warn("loaded newer ARI from storage, but certificate is no longer in cache; newer ARI will be returned to caller, but not persisted in the cache", + zap.Time("selected_time", newARI.SelectedTime), + zap.Timep("next_update", newARI.RetryAfter), + zap.String("explanation_url", newARI.ExplanationURL)) + return + } updatedCert.ari = newARI cfg.certCache.cache[cert.hash] = updatedCert cfg.certCache.mu.Unlock() @@ -523,7 +535,7 @@ func (cfg *Config) updateARI(ctx context.Context, cert Certificate, logger *zap. // of the issuers configured, hopefully one of them is the ACME CA we got the cert from for _, iss := range cfg.Issuers { - if ariGetter, ok := iss.(RenewalInfoGetter); ok { + if ariGetter, ok := iss.(RenewalInfoGetter); ok && iss.IssuerKey() == cert.issuerKey { newARI, err = ariGetter.GetRenewalInfo(ctx, cert) // be sure to use existing newARI variable so we can compare against old value in the defer if err != nil { // could be anything, but a common error might simply be the "wrong" ACME CA @@ -549,7 +561,21 @@ func (cfg *Config) updateARI(ctx context.Context, cert Certificate, logger *zap. // be sure we get the cert from the cache while inside a lock to avoid logical races cfg.certCache.mu.Lock() - updatedCert = cfg.certCache.cache[cert.hash] + updatedCert, ok = cfg.certCache.cache[cert.hash] + if !ok { + // cert is no longer in the cache; this can happen for several reasons (past expiration, + // rejected by on-demand permission module, random eviction due to full cache, etc), but + // it probably means we don't have use of this ARI update now, so while we can return it + // to the caller, we don't persist it anywhere beyond that... + cfg.certCache.mu.Unlock() + updatedCert = cert // return input cert, not an empty one + updatedCert.ari = newARI // might as well give it the new ARI for the benefit of our caller, but it won't be updated in the cache or in storage + logger.Warn("obtained ARI update, but certificate no longer in cache; ARI update will be returned to caller, but not stored", + zap.Time("selected_time", newARI.SelectedTime), + zap.Timep("next_update", newARI.RetryAfter), + zap.String("explanation_url", newARI.ExplanationURL)) + return + } updatedCert.ari = newARI cfg.certCache.cache[cert.hash] = updatedCert cfg.certCache.mu.Unlock() @@ -581,7 +607,7 @@ func (cfg *Config) updateARI(ctx context.Context, cert Certificate, logger *zap. return } - logger.Info("updated ACME renewal information", + logger.Info("updated and stored ACME renewal information", zap.Time("selected_time", newARI.SelectedTime), zap.Timep("next_update", newARI.RetryAfter), zap.String("explanation_url", newARI.ExplanationURL)) diff --git a/vendor/github.com/caddyserver/certmagic/ocsp.go b/vendor/github.com/caddyserver/certmagic/ocsp.go index fe6dbb8f..c87a560f 100644 --- a/vendor/github.com/caddyserver/certmagic/ocsp.go +++ b/vendor/github.com/caddyserver/certmagic/ocsp.go @@ -93,11 +93,16 @@ func stapleOCSP(ctx context.Context, ocspConfig OCSPConfig, storage Storage, cer // then we need to request it from the OCSP responder if ocspResp == nil || len(ocspBytes) == 0 { ocspBytes, ocspResp, ocspErr = getOCSPForCert(ocspConfig, pemBundle) + // An error here is not a problem because a certificate + // may simply not contain a link to an OCSP server. if ocspErr != nil { - // An error here is not a problem because a certificate may simply - // not contain a link to an OCSP server. But we should log it anyway. + // For short-lived certificates, this is fine and we can ignore + // logging because OCSP doesn't make much sense for them anyway. + if cert.Lifetime() < 7*24*time.Hour { + return nil + } // There's nothing else we can do to get OCSP for this certificate, - // so we can return here with the error. + // so we can return here with the error to warn about it. return fmt.Errorf("no OCSP stapling for %v: %w", cert.Names, ocspErr) } gotNewOCSP = true diff --git a/vendor/github.com/caddyserver/certmagic/solvers.go b/vendor/github.com/caddyserver/certmagic/solvers.go index 557f17bd..c2e9e700 100644 --- a/vendor/github.com/caddyserver/certmagic/solvers.go +++ b/vendor/github.com/caddyserver/certmagic/solvers.go @@ -30,8 +30,8 @@ import ( "time" "github.com/libdns/libdns" - "github.com/mholt/acmez/v2" - "github.com/mholt/acmez/v2/acme" + "github.com/mholt/acmez/v3" + "github.com/mholt/acmez/v3/acme" "github.com/miekg/dns" "go.uber.org/zap" ) @@ -547,14 +547,15 @@ func (s *DNSManager) getDNSPresentMemory(dnsName, recType, value string) (dnsPre defer s.recordsMu.Unlock() var memory dnsPresentMemory + var found bool for _, mem := range s.records[dnsName] { if mem.zoneRec.record.Type == recType && mem.zoneRec.record.Value == value { memory = mem + found = true break } } - - if memory.zoneRec.record.Name == "" { + if !found { return dnsPresentMemory{}, fmt.Errorf("no memory of presenting a DNS record for %q (usually OK if presenting also failed)", dnsName) } diff --git a/vendor/github.com/caddyserver/certmagic/zerosslissuer.go b/vendor/github.com/caddyserver/certmagic/zerosslissuer.go index 4a33bfa2..70618cb2 100644 --- a/vendor/github.com/caddyserver/certmagic/zerosslissuer.go +++ b/vendor/github.com/caddyserver/certmagic/zerosslissuer.go @@ -26,8 +26,8 @@ import ( "time" "github.com/caddyserver/zerossl" - "github.com/mholt/acmez/v2" - "github.com/mholt/acmez/v2/acme" + "github.com/mholt/acmez/v3" + "github.com/mholt/acmez/v3/acme" "go.uber.org/zap" ) @@ -62,6 +62,9 @@ type ZeroSSLIssuer struct { // validation, set this field. CNAMEValidation *DNSManager + // Delay between poll attempts. + PollInterval time.Duration + // An optional (but highly recommended) logger. Logger *zap.Logger } @@ -203,8 +206,8 @@ func (iss *ZeroSSLIssuer) Issue(ctx context.Context, csr *x509.CertificateReques }, nil } -func (*ZeroSSLIssuer) waitForCertToBeIssued(ctx context.Context, client zerossl.Client, cert zerossl.CertificateObject) (zerossl.CertificateObject, error) { - ticker := time.NewTicker(5 * time.Second) +func (iss *ZeroSSLIssuer) waitForCertToBeIssued(ctx context.Context, client zerossl.Client, cert zerossl.CertificateObject) (zerossl.CertificateObject, error) { + ticker := time.NewTicker(iss.pollInterval()) defer ticker.Stop() for { @@ -227,6 +230,13 @@ func (*ZeroSSLIssuer) waitForCertToBeIssued(ctx context.Context, client zerossl. } } +func (iss *ZeroSSLIssuer) pollInterval() time.Duration { + if iss.PollInterval == 0 { + return defaultPollInterval + } + return iss.PollInterval +} + func (iss *ZeroSSLIssuer) getClient() zerossl.Client { return zerossl.Client{AccessKey: iss.APIKey} } @@ -299,9 +309,8 @@ func (iss *ZeroSSLIssuer) getDistributedValidationInfo(ctx context.Context, iden } const ( - zerosslAPIBase = "https://" + zerossl.BaseURL + "/acme" - zerosslValidationPathPrefix = "/.well-known/pki-validation/" - zerosslIssuerKey = "zerossl" + zerosslIssuerKey = "zerossl" + defaultPollInterval = 5 * time.Second ) // Interface guards diff --git a/vendor/github.com/cpuguy83/go-md2man/v2/md2man/debug.go b/vendor/github.com/cpuguy83/go-md2man/v2/md2man/debug.go new file mode 100644 index 00000000..0ec4b12c --- /dev/null +++ b/vendor/github.com/cpuguy83/go-md2man/v2/md2man/debug.go @@ -0,0 +1,62 @@ +package md2man + +import ( + "fmt" + "io" + "os" + "strings" + + "github.com/russross/blackfriday/v2" +) + +func fmtListFlags(flags blackfriday.ListType) string { + knownFlags := []struct { + name string + flag blackfriday.ListType + }{ + {"ListTypeOrdered", blackfriday.ListTypeOrdered}, + {"ListTypeDefinition", blackfriday.ListTypeDefinition}, + {"ListTypeTerm", blackfriday.ListTypeTerm}, + {"ListItemContainsBlock", blackfriday.ListItemContainsBlock}, + {"ListItemBeginningOfList", blackfriday.ListItemBeginningOfList}, + {"ListItemEndOfList", blackfriday.ListItemEndOfList}, + } + + var f []string + for _, kf := range knownFlags { + if flags&kf.flag != 0 { + f = append(f, kf.name) + flags &^= kf.flag + } + } + if flags != 0 { + f = append(f, fmt.Sprintf("Unknown(%#x)", flags)) + } + return strings.Join(f, "|") +} + +type debugDecorator struct { + blackfriday.Renderer +} + +func depth(node *blackfriday.Node) int { + d := 0 + for n := node.Parent; n != nil; n = n.Parent { + d++ + } + return d +} + +func (d *debugDecorator) RenderNode(w io.Writer, node *blackfriday.Node, entering bool) blackfriday.WalkStatus { + fmt.Fprintf(os.Stderr, "%s%s %v %v\n", + strings.Repeat(" ", depth(node)), + map[bool]string{true: "+", false: "-"}[entering], + node, + fmtListFlags(node.ListFlags)) + var b strings.Builder + status := d.Renderer.RenderNode(io.MultiWriter(&b, w), node, entering) + if b.Len() > 0 { + fmt.Fprintf(os.Stderr, ">> %q\n", b.String()) + } + return status +} diff --git a/vendor/github.com/cpuguy83/go-md2man/v2/md2man/md2man.go b/vendor/github.com/cpuguy83/go-md2man/v2/md2man/md2man.go index 42bf32aa..62d91b77 100644 --- a/vendor/github.com/cpuguy83/go-md2man/v2/md2man/md2man.go +++ b/vendor/github.com/cpuguy83/go-md2man/v2/md2man/md2man.go @@ -1,16 +1,23 @@ package md2man import ( + "os" + "strconv" + "github.com/russross/blackfriday/v2" ) // Render converts a markdown document into a roff formatted document. func Render(doc []byte) []byte { renderer := NewRoffRenderer() + var r blackfriday.Renderer = renderer + if v, _ := strconv.ParseBool(os.Getenv("MD2MAN_DEBUG")); v { + r = &debugDecorator{Renderer: r} + } return blackfriday.Run(doc, []blackfriday.Option{ - blackfriday.WithRenderer(renderer), + blackfriday.WithRenderer(r), blackfriday.WithExtensions(renderer.GetExtensions()), }...) } diff --git a/vendor/github.com/cpuguy83/go-md2man/v2/md2man/roff.go b/vendor/github.com/cpuguy83/go-md2man/v2/md2man/roff.go index 8a290f19..9d6c473f 100644 --- a/vendor/github.com/cpuguy83/go-md2man/v2/md2man/roff.go +++ b/vendor/github.com/cpuguy83/go-md2man/v2/md2man/roff.go @@ -14,10 +14,8 @@ import ( // roffRenderer implements the blackfriday.Renderer interface for creating // roff format (manpages) from markdown text type roffRenderer struct { - extensions blackfriday.Extensions listCounters []int firstHeader bool - firstDD bool listDepth int } @@ -43,7 +41,7 @@ const ( quoteTag = "\n.PP\n.RS\n" quoteCloseTag = "\n.RE\n" listTag = "\n.RS\n" - listCloseTag = "\n.RE\n" + listCloseTag = ".RE\n" dtTag = "\n.TP\n" dd2Tag = "\n" tableStart = "\n.TS\nallbox;\n" @@ -56,23 +54,18 @@ const ( // NewRoffRenderer creates a new blackfriday Renderer for generating roff documents // from markdown func NewRoffRenderer() *roffRenderer { // nolint: golint - var extensions blackfriday.Extensions - - extensions |= blackfriday.NoIntraEmphasis - extensions |= blackfriday.Tables - extensions |= blackfriday.FencedCode - extensions |= blackfriday.SpaceHeadings - extensions |= blackfriday.Footnotes - extensions |= blackfriday.Titleblock - extensions |= blackfriday.DefinitionLists - return &roffRenderer{ - extensions: extensions, - } + return &roffRenderer{} } // GetExtensions returns the list of extensions used by this renderer implementation -func (r *roffRenderer) GetExtensions() blackfriday.Extensions { - return r.extensions +func (*roffRenderer) GetExtensions() blackfriday.Extensions { + return blackfriday.NoIntraEmphasis | + blackfriday.Tables | + blackfriday.FencedCode | + blackfriday.SpaceHeadings | + blackfriday.Footnotes | + blackfriday.Titleblock | + blackfriday.DefinitionLists } // RenderHeader handles outputting the header at document start @@ -103,7 +96,23 @@ func (r *roffRenderer) RenderNode(w io.Writer, node *blackfriday.Node, entering switch node.Type { case blackfriday.Text: - escapeSpecialChars(w, node.Literal) + // Special case: format the NAME section as required for proper whatis parsing. + // Refer to the lexgrog(1) and groff_man(7) manual pages for details. + if node.Parent != nil && + node.Parent.Type == blackfriday.Paragraph && + node.Parent.Prev != nil && + node.Parent.Prev.Type == blackfriday.Heading && + node.Parent.Prev.FirstChild != nil && + bytes.EqualFold(node.Parent.Prev.FirstChild.Literal, []byte("NAME")) { + before, after, found := bytes.Cut(node.Literal, []byte(" - ")) + escapeSpecialChars(w, before) + if found { + out(w, ` \- `) + escapeSpecialChars(w, after) + } + } else { + escapeSpecialChars(w, node.Literal) + } case blackfriday.Softbreak: out(w, crTag) case blackfriday.Hardbreak: @@ -141,14 +150,25 @@ func (r *roffRenderer) RenderNode(w io.Writer, node *blackfriday.Node, entering case blackfriday.Document: break case blackfriday.Paragraph: - // roff .PP markers break lists - if r.listDepth > 0 { - return blackfriday.GoToNext - } if entering { - out(w, paraTag) + if r.listDepth > 0 { + // roff .PP markers break lists + if node.Prev != nil { // continued paragraph + if node.Prev.Type == blackfriday.List && node.Prev.ListFlags&blackfriday.ListTypeDefinition == 0 { + out(w, ".IP\n") + } else { + out(w, crTag) + } + } + } else if node.Prev != nil && node.Prev.Type == blackfriday.Heading { + out(w, crTag) + } else { + out(w, paraTag) + } } else { - out(w, crTag) + if node.Next == nil || node.Next.Type != blackfriday.List { + out(w, crTag) + } } case blackfriday.BlockQuote: if entering { @@ -211,6 +231,10 @@ func (r *roffRenderer) handleHeading(w io.Writer, node *blackfriday.Node, enteri func (r *roffRenderer) handleList(w io.Writer, node *blackfriday.Node, entering bool) { openTag := listTag closeTag := listCloseTag + if (entering && r.listDepth == 0) || (!entering && r.listDepth == 1) { + openTag = crTag + closeTag = "" + } if node.ListFlags&blackfriday.ListTypeDefinition != 0 { // tags for definition lists handled within Item node openTag = "" @@ -239,23 +263,25 @@ func (r *roffRenderer) handleItem(w io.Writer, node *blackfriday.Node, entering } else if node.ListFlags&blackfriday.ListTypeTerm != 0 { // DT (definition term): line just before DD (see below). out(w, dtTag) - r.firstDD = true } else if node.ListFlags&blackfriday.ListTypeDefinition != 0 { // DD (definition description): line that starts with ": ". // // We have to distinguish between the first DD and the // subsequent ones, as there should be no vertical // whitespace between the DT and the first DD. - if r.firstDD { - r.firstDD = false - } else { - out(w, dd2Tag) + if node.Prev != nil && node.Prev.ListFlags&(blackfriday.ListTypeTerm|blackfriday.ListTypeDefinition) == blackfriday.ListTypeDefinition { + if node.Prev.Type == blackfriday.Item && + node.Prev.LastChild != nil && + node.Prev.LastChild.Type == blackfriday.List && + node.Prev.LastChild.ListFlags&blackfriday.ListTypeDefinition == 0 { + out(w, ".IP\n") + } else { + out(w, dd2Tag) + } } } else { out(w, ".IP \\(bu 2\n") } - } else { - out(w, "\n") } } diff --git a/vendor/github.com/datarhei/gosrt/config.go b/vendor/github.com/datarhei/gosrt/config.go index 53122d87..1f687775 100644 --- a/vendor/github.com/datarhei/gosrt/config.go +++ b/vendor/github.com/datarhei/gosrt/config.go @@ -15,7 +15,7 @@ const ( MIN_PAYLOAD_SIZE = MIN_MSS_SIZE - UDP_HEADER_SIZE - SRT_HEADER_SIZE MAX_PAYLOAD_SIZE = MAX_MSS_SIZE - UDP_HEADER_SIZE - SRT_HEADER_SIZE MIN_PASSPHRASE_SIZE = 10 - MAX_PASSPHRASE_SIZE = 79 + MAX_PASSPHRASE_SIZE = 80 MAX_STREAMID_SIZE = 512 SRT_VERSION = 0x010401 ) @@ -169,6 +169,9 @@ type Config struct { // An implementation of the Logger interface Logger Logger + + // if a new IP starts sending data on an existing socket id, allow it + AllowPeerIpChange bool } // DefaultConfig is the default configuration for a SRT connection @@ -209,6 +212,7 @@ var defaultConfig Config = Config{ TooLatePacketDrop: true, TransmissionType: "live", TSBPDMode: true, + AllowPeerIpChange: false, } // DefaultConfig returns the default configuration for Dial and Listen. diff --git a/vendor/github.com/datarhei/gosrt/congestion/live/receive.go b/vendor/github.com/datarhei/gosrt/congestion/live/receive.go index 4999b757..7bcf7f18 100644 --- a/vendor/github.com/datarhei/gosrt/congestion/live/receive.go +++ b/vendor/github.com/datarhei/gosrt/congestion/live/receive.go @@ -265,11 +265,7 @@ func (r *receiver) periodicACK(now uint64) (ok bool, sequenceNumber circular.Num } minPktTsbpdTime, maxPktTsbpdTime := uint64(0), uint64(0) - - ackSequenceNumber := r.lastDeliveredSequenceNumber - - // Find the sequence number up until we have all in a row. - // Where the first gap is (or at the end of the list) is where we can ACK to. + ackSequenceNumber := r.lastACKSequenceNumber e := r.packetList.Front() if e != nil { @@ -277,49 +273,42 @@ func (r *receiver) periodicACK(now uint64) (ok bool, sequenceNumber circular.Num minPktTsbpdTime = p.Header().PktTsbpdTime maxPktTsbpdTime = p.Header().PktTsbpdTime + } - // If there are packets that should be delivered by now, move foward. - if p.Header().PktTsbpdTime <= now { - for e = e.Next(); e != nil; e = e.Next() { - p = e.Value.(packet.Packet) + // Find the sequence number up until we have all in a row. + // Where the first gap is (or at the end of the list) is where we can ACK to. - if p.Header().PktTsbpdTime > now { - break - } - } + for e := r.packetList.Front(); e != nil; e = e.Next() { + p := e.Value.(packet.Packet) - ackSequenceNumber = p.Header().PacketSequenceNumber - maxPktTsbpdTime = p.Header().PktTsbpdTime - - if e != nil { - if e = e.Next(); e != nil { - p = e.Value.(packet.Packet) - } - } + // Skip packets that we already ACK'd. + if p.Header().PacketSequenceNumber.Lte(ackSequenceNumber) { + continue } + // If there are packets that should have been delivered by now, move forward. + if p.Header().PktTsbpdTime <= now { + ackSequenceNumber = p.Header().PacketSequenceNumber + continue + } + + // Check if the packet is the next in the row. if p.Header().PacketSequenceNumber.Equals(ackSequenceNumber.Inc()) { ackSequenceNumber = p.Header().PacketSequenceNumber - - for e = e.Next(); e != nil; e = e.Next() { - p = e.Value.(packet.Packet) - if !p.Header().PacketSequenceNumber.Equals(ackSequenceNumber.Inc()) { - break - } - - ackSequenceNumber = p.Header().PacketSequenceNumber - maxPktTsbpdTime = p.Header().PktTsbpdTime - } + maxPktTsbpdTime = p.Header().PktTsbpdTime + continue } - ok = true - sequenceNumber = ackSequenceNumber.Inc() - - // Keep track of the last ACK's sequence. with this we can faster ignore - // packets that come in that have a lower sequence number. - r.lastACKSequenceNumber = ackSequenceNumber + break } + ok = true + sequenceNumber = ackSequenceNumber.Inc() + + // Keep track of the last ACK's sequence number. With this we can faster ignore + // packets that come in late that have a lower sequence number. + r.lastACKSequenceNumber = ackSequenceNumber + r.lastPeriodicACK = now r.nPackets = 0 @@ -338,13 +327,19 @@ func (r *receiver) periodicNAK(now uint64) (ok bool, from, to circular.Number) { // Send a periodic NAK - ackSequenceNumber := r.lastDeliveredSequenceNumber + ackSequenceNumber := r.lastACKSequenceNumber // Send a NAK only for the first gap. // Alternatively send a NAK for max. X gaps because the size of the NAK packet is limited. for e := r.packetList.Front(); e != nil; e = e.Next() { p := e.Value.(packet.Packet) + // Skip packets that we already ACK'd. + if p.Header().PacketSequenceNumber.Lte(ackSequenceNumber) { + continue + } + + // If this packet is not in sequence, we stop here and report that gap. if !p.Header().PacketSequenceNumber.Equals(ackSequenceNumber.Inc()) { nackSequenceNumber := ackSequenceNumber.Inc() diff --git a/vendor/github.com/datarhei/gosrt/conn_request.go b/vendor/github.com/datarhei/gosrt/conn_request.go index 80576955..210c2d81 100644 --- a/vendor/github.com/datarhei/gosrt/conn_request.go +++ b/vendor/github.com/datarhei/gosrt/conn_request.go @@ -7,6 +7,7 @@ import ( "github.com/datarhei/gosrt/crypto" "github.com/datarhei/gosrt/packet" + "github.com/datarhei/gosrt/rand" ) // ConnRequest is an incoming connection request @@ -206,6 +207,18 @@ func newConnRequest(ln *listener, p packet.Packet) *connRequest { return nil } + + // We only support live congestion control + if cif.HasCongestionCtl && cif.CongestionCtl != "live" { + cif.HandshakeType = packet.HandshakeType(REJ_CONGESTION) + ln.log("handshake:recv:error", func() string { return "only live congestion control is supported" }) + p.MarshalCIF(cif) + ln.log("handshake:send:dump", func() string { return p.Dump() }) + ln.log("handshake:send:cif", func() string { return cif.String() }) + ln.send(p) + + return nil + } } else { cif.HandshakeType = packet.HandshakeType(REJ_ROGUE) ln.log("handshake:recv:error", func() string { return fmt.Sprintf("only HSv4 and HSv5 are supported (got HSv%d)", cif.Version) }) @@ -328,6 +341,23 @@ func (req *connRequest) Reject(reason RejectionReason) { delete(req.ln.connReqs, req.socketId) } +// generateSocketId generates an SRT SocketID that can be used for this connection +func (req *connRequest) generateSocketId() (uint32, error) { + for i := 0; i < 10; i++ { + socketId, err := rand.Uint32() + if err != nil { + return 0, fmt.Errorf("could not generate random socket id") + } + + // check that the socket id is not already in use + if _, found := req.ln.conns[socketId]; !found { + return socketId, nil + } + } + + return 0, fmt.Errorf("could not generate unused socketid") +} + func (req *connRequest) Accept() (Conn, error) { if req.crypto != nil && len(req.passphrase) == 0 { req.Reject(REJ_BADSECRET) @@ -342,7 +372,10 @@ func (req *connRequest) Accept() (Conn, error) { } // Create a new socket ID - socketId := uint32(time.Since(req.ln.start).Microseconds()) + socketId, err := req.generateSocketId() + if err != nil { + return nil, fmt.Errorf("could not generate socket id: %w", err) + } // Select the largest TSBPD delay advertised by the caller, but at least 120ms recvTsbpdDelay := uint16(req.config.ReceiverLatency.Milliseconds()) diff --git a/vendor/github.com/datarhei/gosrt/connection.go b/vendor/github.com/datarhei/gosrt/connection.go index ea83ca79..b9decebc 100644 --- a/vendor/github.com/datarhei/gosrt/connection.go +++ b/vendor/github.com/datarhei/gosrt/connection.go @@ -69,6 +69,51 @@ type Conn interface { Version() uint32 } +type rtt struct { + rtt float64 // microseconds + rttVar float64 // microseconds + + lock sync.RWMutex +} + +func (r *rtt) Recalculate(rtt time.Duration) { + // 4.10. Round-Trip Time Estimation + lastRTT := float64(rtt.Microseconds()) + + r.lock.Lock() + defer r.lock.Unlock() + + r.rtt = r.rtt*0.875 + lastRTT*0.125 + r.rttVar = r.rttVar*0.75 + math.Abs(r.rtt-lastRTT)*0.25 +} + +func (r *rtt) RTT() float64 { + r.lock.RLock() + defer r.lock.RUnlock() + + return r.rtt +} + +func (r *rtt) RTTVar() float64 { + r.lock.RLock() + defer r.lock.RUnlock() + + return r.rttVar +} + +func (r *rtt) NAKInterval() float64 { + r.lock.RLock() + defer r.lock.RUnlock() + + // 4.8.2. Packet Retransmission (NAKs) + nakInterval := (r.rtt + 4*r.rttVar) / 2 + if nakInterval < 20000 { + nakInterval = 20000 // 20ms + } + + return nakInterval +} + type connStats struct { headerSize uint64 pktSentACK uint64 @@ -108,19 +153,16 @@ type srtConn struct { config Config - cryptoLock sync.Mutex crypto crypto.Crypto keyBaseEncryption packet.PacketEncryption kmPreAnnounceCountdown uint64 kmRefreshCountdown uint64 kmConfirmed bool + cryptoLock sync.Mutex peerIdleTimeout *time.Timer - rtt float64 // microseconds - rttVar float64 // microseconds - - nakInterval float64 + rtt rtt // microseconds ackLock sync.RWMutex ackNumbers map[uint32]time.Time @@ -232,10 +274,10 @@ func newSRTConn(config srtConnConfig) *srtConn { c.kmRefreshCountdown = c.config.KMRefreshRate // 4.10. Round-Trip Time Estimation - c.rtt = float64((100 * time.Millisecond).Microseconds()) - c.rttVar = float64((50 * time.Millisecond).Microseconds()) - - c.nakInterval = float64((20 * time.Millisecond).Microseconds()) + c.rtt = rtt{ + rtt: float64((100 * time.Millisecond).Microseconds()), + rttVar: float64((50 * time.Millisecond).Microseconds()), + } c.networkQueue = make(chan packet.Packet, 1024) @@ -788,7 +830,7 @@ func (c *srtConn) handleNAK(p packet.Packet) { // handleACKACK updates the RTT and NAK interval for the congestion control. func (c *srtConn) handleACKACK(p packet.Packet) { - c.ackLock.RLock() + c.ackLock.Lock() c.statisticsLock.Lock() c.statistics.pktRecvACKACK++ @@ -814,31 +856,17 @@ func (c *srtConn) handleACKACK(p packet.Packet) { } } - nakInterval := uint64(c.nakInterval) + c.ackLock.Unlock() - c.ackLock.RUnlock() - - c.recv.SetNAKInterval(nakInterval) + c.recv.SetNAKInterval(uint64(c.rtt.NAKInterval())) } // recalculateRTT recalculates the RTT based on a full ACK exchange func (c *srtConn) recalculateRTT(rtt time.Duration) { - // 4.10. Round-Trip Time Estimation - lastRTT := float64(rtt.Microseconds()) - - c.rtt = c.rtt*0.875 + lastRTT*0.125 - c.rttVar = c.rttVar*0.75 + math.Abs(c.rtt-lastRTT)*0.25 - - // 4.8.2. Packet Retransmission (NAKs) - nakInterval := (c.rtt + 4*c.rttVar) / 2 - if nakInterval < 20000 { - c.nakInterval = 20000 // 20ms - } else { - c.nakInterval = nakInterval - } + c.rtt.Recalculate(rtt) c.log("connection:rtt", func() string { - return fmt.Sprintf("RTT=%.0fus RTTVar=%.0fus NAKInterval=%.0fms", c.rtt, c.rttVar, c.nakInterval/1000) + return fmt.Sprintf("RTT=%.0fus RTTVar=%.0fus NAKInterval=%.0fms", c.rtt.RTT(), c.rtt.RTTVar(), c.rtt.NAKInterval()/1000) }) } @@ -1219,8 +1247,8 @@ func (c *srtConn) sendACK(seq circular.Number, lite bool) { } else { pps, bps, capacity := c.recv.PacketRate() - cif.RTT = uint32(c.rtt) - cif.RTTVar = uint32(c.rttVar) + cif.RTT = uint32(c.rtt.RTT()) + cif.RTTVar = uint32(c.rtt.RTTVar()) cif.AvailableBufferSize = c.config.FC // TODO: available buffer size (packets) cif.PacketsReceivingRate = uint32(pps) // packets receiving rate (packets/s) cif.EstimatedLinkCapacity = uint32(capacity) // estimated link capacity (packets/s), not relevant for live mode @@ -1488,7 +1516,7 @@ func (c *srtConn) Stats(s *Statistics) { UsPktSendPeriod: send.UsPktSndPeriod, PktFlowWindow: uint64(c.config.FC), PktFlightSize: send.PktFlightSize, - MsRTT: c.rtt / 1000, + MsRTT: c.rtt.RTT() / 1000, MbpsSentRate: send.MbpsEstimatedSentBandwidth, MbpsRecvRate: recv.MbpsEstimatedRecvBandwidth, MbpsLinkCapacity: recv.MbpsEstimatedLinkCapacity, diff --git a/vendor/github.com/datarhei/gosrt/listen.go b/vendor/github.com/datarhei/gosrt/listen.go index 024d10fd..765ad51c 100644 --- a/vendor/github.com/datarhei/gosrt/listen.go +++ b/vendor/github.com/datarhei/gosrt/listen.go @@ -407,6 +407,14 @@ func (ln *listener) reader(ctx context.Context) { break } + if !ln.config.AllowPeerIpChange { + if p.Header().Addr.String() != conn.RemoteAddr().String() { + // ignore the packet, it's not from the expected peer + // https://haivision.github.io/srt-rfc/draft-sharabayko-srt.html#name-security-considerations + break + } + } + conn.push(p) } } diff --git a/vendor/github.com/datarhei/gosrt/packet/packet.go b/vendor/github.com/datarhei/gosrt/packet/packet.go index a03018bd..2b42ff84 100644 --- a/vendor/github.com/datarhei/gosrt/packet/packet.go +++ b/vendor/github.com/datarhei/gosrt/packet/packet.go @@ -33,7 +33,7 @@ const ( CTRLTYPE_SHUTDOWN CtrlType = 0x0005 CTRLTYPE_ACKACK CtrlType = 0x0006 CRTLTYPE_DROPREQ CtrlType = 0x0007 // unimplemented, sender->receiver - CRTLTYPE_PEERERROR CtrlType = 0x0008 // unimplemented, receiver->sender + CRTLTYPE_PEERERROR CtrlType = 0x0008 // unimplemented, receiver->sender (only for file transfers) CTRLTYPE_USER CtrlType = 0x7FFF ) @@ -141,8 +141,8 @@ const ( EXTTYPE_KMRSP CtrlSubType = 4 EXTTYPE_SID CtrlSubType = 5 EXTTYPE_CONGESTION CtrlSubType = 6 - EXTTYPE_FILTER CtrlSubType = 7 - EXTTYPE_GROUP CtrlSubType = 8 + EXTTYPE_FILTER CtrlSubType = 7 // unimplemented + EXTTYPE_GROUP CtrlSubType = 8 // unimplemented ) func (h CtrlSubType) String() string { @@ -484,7 +484,7 @@ type CIFHandshake struct { Version uint32 // A base protocol version number. Currently used values are 4 and 5. Values greater than 5 are reserved for future use. EncryptionField uint16 // Block cipher family and key size. The values of this field are described in Table 2. The default value is AES-128. - ExtensionField uint16 // This field is message specific extension related to Handshake Type field. The value MUST be set to 0 except for the following cases. (1) If the handshake control packet is the INDUCTION message, this field is sent back by the Listener. (2) In the case of a CONCLUSION message, this field value should contain a combination of Extension Type values. For more details, see Section 4.3.1. + ExtensionField uint16 // This field is a message specific extension related to Handshake Type field. The value MUST be set to 0 except for the following cases. (1) If the handshake control packet is the INDUCTION message, this field is sent back by the Listener. (2) In the case of a CONCLUSION message, this field value should contain a combination of Extension Type values. For more details, see Section 4.3.1. InitialPacketSequenceNumber circular.Number // The sequence number of the very first data packet to be sent. MaxTransmissionUnitSize uint32 // This value is typically set to 1500, which is the default Maximum Transmission Unit (MTU) size for Ethernet, but can be less. MaxFlowWindowSize uint32 // The value of this field is the maximum number of data packets allowed to be "in flight" (i.e. the number of sent packets for which an ACK control packet has not yet been received). @@ -493,9 +493,10 @@ type CIFHandshake struct { SynCookie uint32 // Randomized value for processing a handshake. The value of this field is specified by the handshake message type. See Section 4.3. PeerIP srtnet.IP // IPv4 or IPv6 address of the packet's sender. The value consists of four 32-bit fields. In the case of IPv4 addresses, fields 2, 3 and 4 are filled with zeroes. - HasHS bool - HasKM bool - HasSID bool + HasHS bool + HasKM bool + HasSID bool + HasCongestionCtl bool // 3.2.1.1. Handshake Extension Message SRTHS *CIFHandshakeExtension @@ -505,6 +506,9 @@ type CIFHandshake struct { // 3.2.1.3. Stream ID Extension Message StreamId string + + // ??? Congestion Control Extension message (handshake.md #### Congestion controller) + CongestionCtl string } func (c CIFHandshake) String() string { @@ -537,6 +541,12 @@ func (c CIFHandshake) String() string { fmt.Fprintf(&b, " streamId : %s\n", c.StreamId) fmt.Fprintf(&b, "--- /SIDExt ---\n") } + + if c.HasCongestionCtl { + fmt.Fprintf(&b, "--- CongestionExt ---\n") + fmt.Fprintf(&b, " congestion : %s\n", c.CongestionCtl) + fmt.Fprintf(&b, "--- /CongestionExt ---\n") + } } fmt.Fprintf(&b, "--- /handshake ---") @@ -599,7 +609,7 @@ func (c *CIFHandshake) Unmarshal(data []byte) error { if extensionType == EXTTYPE_HSREQ || extensionType == EXTTYPE_HSRSP { // 3.2.1.1. Handshake Extension Message if extensionLength != 12 || len(pivot) < extensionLength { - return fmt.Errorf("invalid extension length") + return fmt.Errorf("invalid extension length of %d bytes (%s)", extensionLength, extensionType.String()) } c.HasHS = true @@ -612,7 +622,7 @@ func (c *CIFHandshake) Unmarshal(data []byte) error { } else if extensionType == EXTTYPE_KMREQ || extensionType == EXTTYPE_KMRSP { // 3.2.1.2. Key Material Extension Message if len(pivot) < extensionLength { - return fmt.Errorf("invalid extension length") + return fmt.Errorf("invalid extension length of %d bytes (%s)", extensionLength, extensionType.String()) } c.HasKM = true @@ -638,7 +648,7 @@ func (c *CIFHandshake) Unmarshal(data []byte) error { } else if extensionType == EXTTYPE_SID { // 3.2.1.3. Stream ID Extension Message if extensionLength > 512 || len(pivot) < extensionLength { - return fmt.Errorf("invalid extension length") + return fmt.Errorf("invalid extension length of %d bytes (%s)", extensionLength, extensionType.String()) } c.HasSID = true @@ -653,8 +663,30 @@ func (c *CIFHandshake) Unmarshal(data []byte) error { } c.StreamId = strings.TrimRight(b.String(), "\x00") + } else if extensionType == EXTTYPE_CONGESTION { + // ??? Congestion Control Extension message (handshake.md #### Congestion controller) + if extensionLength > 4 || len(pivot) < extensionLength { + return fmt.Errorf("invalid extension length of %d bytes (%s)", extensionLength, extensionType.String()) + } + + c.HasCongestionCtl = true + + var b strings.Builder + + for i := 0; i < extensionLength; i += 4 { + b.WriteByte(pivot[i+3]) + b.WriteByte(pivot[i+2]) + b.WriteByte(pivot[i+1]) + b.WriteByte(pivot[i+0]) + } + + c.CongestionCtl = strings.TrimRight(b.String(), "\x00") + } else if extensionType == EXTTYPE_FILTER || extensionType == EXTTYPE_GROUP { + if len(pivot) < extensionLength { + return fmt.Errorf("invalid extension length of %d bytes (%s)", extensionLength, extensionType.String()) + } } else { - return fmt.Errorf("unimplemented extension (%d)", extensionType) + return fmt.Errorf("unknown extension (%d)", extensionType) } if len(pivot) > extensionLength { @@ -695,6 +727,10 @@ func (c *CIFHandshake) Marshal(w io.Writer) { if c.HasSID { c.ExtensionField = c.ExtensionField | 4 } + + if c.HasCongestionCtl { + c.ExtensionField = c.ExtensionField | 4 + } } else { c.EncryptionField = 0 c.ExtensionField = 2 @@ -773,6 +809,33 @@ func (c *CIFHandshake) Marshal(w io.Writer) { w.Write(buffer[:4]) } } + + if c.HasCongestionCtl && c.CongestionCtl != "live" { + congestion := bytes.NewBufferString(c.CongestionCtl) + + missing := (4 - congestion.Len()%4) + if missing < 4 { + for i := 0; i < missing; i++ { + congestion.WriteByte(0) + } + } + + binary.BigEndian.PutUint16(buffer[0:], EXTTYPE_CONGESTION.Value()) + binary.BigEndian.PutUint16(buffer[2:], uint16(congestion.Len()/4)) + + w.Write(buffer[:4]) + + b := congestion.Bytes() + + for i := 0; i < len(b); i += 4 { + buffer[0] = b[i+3] + buffer[1] = b[i+2] + buffer[2] = b[i+1] + buffer[3] = b[i+0] + + w.Write(buffer[:4]) + } + } } // 3.2.1.1.1. Handshake Extension Message Flags diff --git a/vendor/github.com/datarhei/gosrt/rand/rand.go b/vendor/github.com/datarhei/gosrt/rand/rand.go index 0f354943..ff9be570 100644 --- a/vendor/github.com/datarhei/gosrt/rand/rand.go +++ b/vendor/github.com/datarhei/gosrt/rand/rand.go @@ -12,7 +12,7 @@ func RandomString(length int, charset string) (string, error) { if err != nil { return "", err } - b[i] = charset[int(j)] + b[i] = charset[j] } return string(b), nil diff --git a/vendor/github.com/gabriel-vasile/mimetype/internal/magic/archive.go b/vendor/github.com/gabriel-vasile/mimetype/internal/magic/archive.go index b59042c6..068d00f7 100644 --- a/vendor/github.com/gabriel-vasile/mimetype/internal/magic/archive.go +++ b/vendor/github.com/gabriel-vasile/mimetype/internal/magic/archive.go @@ -52,10 +52,15 @@ func InstallShieldCab(raw []byte, _ uint32) bool { } // Zstd matches a Zstandard archive file. +// https://github.com/facebook/zstd/blob/dev/doc/zstd_compression_format.md func Zstd(raw []byte, limit uint32) bool { - return len(raw) >= 4 && - (0x22 <= raw[0] && raw[0] <= 0x28 || raw[0] == 0x1E) && // Different Zstandard versions. - bytes.HasPrefix(raw[1:], []byte{0xB5, 0x2F, 0xFD}) + if len(raw) < 4 { + return false + } + sig := binary.LittleEndian.Uint32(raw) + // Check for Zstandard frames and skippable frames. + return (sig >= 0xFD2FB522 && sig <= 0xFD2FB528) || + (sig >= 0x184D2A50 && sig <= 0x184D2A5F) } // CRX matches a Chrome extension file: a zip archive prepended by a package header. diff --git a/vendor/github.com/gabriel-vasile/mimetype/internal/magic/binary.go b/vendor/github.com/gabriel-vasile/mimetype/internal/magic/binary.go index 96040e6c..76973201 100644 --- a/vendor/github.com/gabriel-vasile/mimetype/internal/magic/binary.go +++ b/vendor/github.com/gabriel-vasile/mimetype/internal/magic/binary.go @@ -23,6 +23,8 @@ var ( Torrent = prefix([]byte("d8:announce")) // PAR1 matches a parquet file. Par1 = prefix([]byte{0x50, 0x41, 0x52, 0x31}) + // CBOR matches a Concise Binary Object Representation https://cbor.io/ + CBOR = prefix([]byte{0xD9, 0xD9, 0xF7}) ) // Java bytecode and Mach-O binaries share the same magic number. @@ -34,7 +36,7 @@ func classOrMachOFat(in []byte) bool { return false } - return bytes.HasPrefix(in, []byte{0xCA, 0xFE, 0xBA, 0xBE}) + return binary.BigEndian.Uint32(in) == macho.MagicFat } // Class matches a java class file. @@ -44,7 +46,7 @@ func Class(raw []byte, limit uint32) bool { // MachO matches Mach-O binaries format. func MachO(raw []byte, limit uint32) bool { - if classOrMachOFat(raw) && raw[7] < 20 { + if classOrMachOFat(raw) && raw[7] < 0x14 { return true } @@ -156,11 +158,11 @@ func Marc(raw []byte, limit uint32) bool { // the GL transmission Format (glTF). // GLB uses little endian and its header structure is as follows: // -// <-- 12-byte header --> -// | magic | version | length | -// | (uint32) | (uint32) | (uint32) | -// | \x67\x6C\x54\x46 | \x01\x00\x00\x00 | ... | -// | g l T F | 1 | ... | +// <-- 12-byte header --> +// | magic | version | length | +// | (uint32) | (uint32) | (uint32) | +// | \x67\x6C\x54\x46 | \x01\x00\x00\x00 | ... | +// | g l T F | 1 | ... | // // Visit [glTF specification] and [IANA glTF entry] for more details. // @@ -172,14 +174,15 @@ var Glb = prefix([]byte("\x67\x6C\x54\x46\x02\x00\x00\x00"), // TzIf matches a Time Zone Information Format (TZif) file. // See more: https://tools.ietf.org/id/draft-murchison-tzdist-tzif-00.html#rfc.section.3 // Its header structure is shown below: -// +---------------+---+ -// | magic (4) | <-+-- version (1) -// +---------------+---+---------------------------------------+ -// | [unused - reserved for future use] (15) | -// +---------------+---------------+---------------+-----------+ -// | isutccnt (4) | isstdcnt (4) | leapcnt (4) | -// +---------------+---------------+---------------+ -// | timecnt (4) | typecnt (4) | charcnt (4) | +// +// +---------------+---+ +// | magic (4) | <-+-- version (1) +// +---------------+---+---------------------------------------+ +// | [unused - reserved for future use] (15) | +// +---------------+---------------+---------------+-----------+ +// | isutccnt (4) | isstdcnt (4) | leapcnt (4) | +// +---------------+---------------+---------------+ +// | timecnt (4) | typecnt (4) | charcnt (4) | func TzIf(raw []byte, limit uint32) bool { // File is at least 44 bytes (header size). if len(raw) < 44 { diff --git a/vendor/github.com/gabriel-vasile/mimetype/internal/magic/zip.go b/vendor/github.com/gabriel-vasile/mimetype/internal/magic/zip.go index f866113f..f6c64829 100644 --- a/vendor/github.com/gabriel-vasile/mimetype/internal/magic/zip.go +++ b/vendor/github.com/gabriel-vasile/mimetype/internal/magic/zip.go @@ -110,3 +110,22 @@ func zipContains(raw, sig []byte, msoCheck bool) bool { } return false } + +// APK matches an Android Package Archive. +// The source of signatures is https://github.com/file/file/blob/1778642b8ba3d947a779a36fcd81f8e807220a19/magic/Magdir/archive#L1820-L1887 +func APK(raw []byte, _ uint32) bool { + apkSignatures := [][]byte{ + []byte("AndroidManifest.xml"), + []byte("META-INF/com/android/build/gradle/app-metadata.properties"), + []byte("classes.dex"), + []byte("resources.arsc"), + []byte("res/drawable"), + } + for _, sig := range apkSignatures { + if zipContains(raw, sig, false) { + return true + } + } + + return false +} diff --git a/vendor/github.com/gabriel-vasile/mimetype/supported_mimes.md b/vendor/github.com/gabriel-vasile/mimetype/supported_mimes.md index 042a5aa7..f9bf03cb 100644 --- a/vendor/github.com/gabriel-vasile/mimetype/supported_mimes.md +++ b/vendor/github.com/gabriel-vasile/mimetype/supported_mimes.md @@ -1,4 +1,4 @@ -## 176 Supported MIME types +## 178 Supported MIME types This file is automatically generated when running tests. Do not edit manually. Extension | MIME type | Aliases @@ -11,6 +11,7 @@ Extension | MIME type | Aliases **.docx** | application/vnd.openxmlformats-officedocument.wordprocessingml.document | - **.pptx** | application/vnd.openxmlformats-officedocument.presentationml.presentation | - **.epub** | application/epub+zip | - +**.apk** | application/vnd.android.package-archive | - **.jar** | application/jar | - **.odt** | application/vnd.oasis.opendocument.text | application/x-vnd.oasis.opendocument.text **.ott** | application/vnd.oasis.opendocument.text-template | application/x-vnd.oasis.opendocument.text-template @@ -79,7 +80,7 @@ Extension | MIME type | Aliases **.avif** | image/avif | - **.3gp** | video/3gpp | video/3gp, audio/3gpp **.3g2** | video/3gpp2 | video/3g2, audio/3gpp2 -**.mp4** | audio/mp4 | audio/x-m4a, audio/x-mp4a +**.mp4** | audio/mp4 | audio/x-mp4a **.mqv** | video/quicktime | - **.m4a** | audio/x-m4a | - **.m4v** | video/x-m4v | - @@ -118,6 +119,7 @@ Extension | MIME type | Aliases **.mobi** | application/x-mobipocket-ebook | - **.lit** | application/x-ms-reader | - **.bpg** | image/bpg | - +**.cbor** | application/cbor | - **.sqlite** | application/vnd.sqlite3 | application/x-sqlite3 **.dwg** | image/vnd.dwg | image/x-dwg, application/acad, application/x-acad, application/autocad_dwg, application/dwg, application/x-dwg, application/x-autocad, drawing/dwg **.nes** | application/vnd.nintendo.snes.rom | - @@ -162,7 +164,7 @@ Extension | MIME type | Aliases **.xfdf** | application/vnd.adobe.xfdf | - **.owl** | application/owl+xml | - **.php** | text/x-php | - -**.js** | application/javascript | application/x-javascript, text/javascript +**.js** | text/javascript | application/x-javascript, application/javascript **.lua** | text/x-lua | - **.pl** | text/x-perl | - **.py** | text/x-python | text/x-script.python, application/x-python diff --git a/vendor/github.com/gabriel-vasile/mimetype/tree.go b/vendor/github.com/gabriel-vasile/mimetype/tree.go index aa7c8cdb..b5f56622 100644 --- a/vendor/github.com/gabriel-vasile/mimetype/tree.go +++ b/vendor/github.com/gabriel-vasile/mimetype/tree.go @@ -21,7 +21,7 @@ var root = newMIME("application/octet-stream", "", jpm, jxs, gif, webp, exe, elf, ar, tar, xar, bz2, fits, tiff, bmp, ico, mp3, flac, midi, ape, musePack, amr, wav, aiff, au, mpeg, quickTime, mp4, webM, avi, flv, mkv, asf, aac, voc, m3u, rmvb, gzip, class, swf, crx, ttf, woff, - woff2, otf, ttc, eot, wasm, shx, dbf, dcm, rar, djvu, mobi, lit, bpg, + woff2, otf, ttc, eot, wasm, shx, dbf, dcm, rar, djvu, mobi, lit, bpg, cbor, sqlite3, dwg, nes, lnk, macho, qcp, icns, hdr, mrc, mdb, accdb, zstd, cab, rpm, xz, lzip, torrent, cpio, tzif, xcf, pat, gbr, glb, cabIS, jxr, parquet, // Keep text last because it is the slowest check. @@ -44,7 +44,11 @@ var ( "application/gzip-compressed", "application/x-gzip-compressed", "gzip/document") sevenZ = newMIME("application/x-7z-compressed", ".7z", magic.SevenZ) - zip = newMIME("application/zip", ".zip", magic.Zip, xlsx, docx, pptx, epub, jar, odt, ods, odp, odg, odf, odc, sxc). + // APK must be checked before JAR because APK is a subset of JAR. + // This means APK should be a child of JAR detector, but in practice, + // the decisive signature for JAR might be located at the end of the file + // and not reachable because of library readLimit. + zip = newMIME("application/zip", ".zip", magic.Zip, xlsx, docx, pptx, epub, apk, jar, odt, ods, odp, odg, odf, odc, sxc). alias("application/x-zip", "application/x-zip-compressed") tar = newMIME("application/x-tar", ".tar", magic.Tar) xar = newMIME("application/x-xar", ".xar", magic.Xar) @@ -57,6 +61,7 @@ var ( pptx = newMIME("application/vnd.openxmlformats-officedocument.presentationml.presentation", ".pptx", magic.Pptx) epub = newMIME("application/epub+zip", ".epub", magic.Epub) jar = newMIME("application/jar", ".jar", magic.Jar) + apk = newMIME("application/vnd.android.package-archive", ".apk", magic.APK) ole = newMIME("application/x-ole-storage", "", magic.Ole, msi, aaf, msg, xls, pub, ppt, doc) msi = newMIME("application/x-ms-installer", ".msi", magic.Msi). alias("application/x-windows-installer", "application/x-msi") @@ -87,8 +92,8 @@ var ( html = newMIME("text/html", ".html", magic.HTML) php = newMIME("text/x-php", ".php", magic.Php) rtf = newMIME("text/rtf", ".rtf", magic.Rtf).alias("application/rtf") - js = newMIME("application/javascript", ".js", magic.Js). - alias("application/x-javascript", "text/javascript") + js = newMIME("text/javascript", ".js", magic.Js). + alias("application/x-javascript", "application/javascript") srt = newMIME("application/x-subrip", ".srt", magic.Srt). alias("application/x-srt", "text/x-srt") vtt = newMIME("text/vtt", ".vtt", magic.Vtt) @@ -156,7 +161,7 @@ var ( aac = newMIME("audio/aac", ".aac", magic.AAC) voc = newMIME("audio/x-unknown", ".voc", magic.Voc) aMp4 = newMIME("audio/mp4", ".mp4", magic.AMp4). - alias("audio/x-m4a", "audio/x-mp4a") + alias("audio/x-mp4a") m4a = newMIME("audio/x-m4a", ".m4a", magic.M4a) m3u = newMIME("application/vnd.apple.mpegurl", ".m3u", magic.M3u). alias("audio/mpegurl") @@ -261,4 +266,5 @@ var ( jxr = newMIME("image/jxr", ".jxr", magic.Jxr).alias("image/vnd.ms-photo") parquet = newMIME("application/vnd.apache.parquet", ".parquet", magic.Par1). alias("application/x-parquet") + cbor = newMIME("application/cbor", ".cbor", magic.CBOR) ) diff --git a/vendor/github.com/go-playground/validator/v10/README.md b/vendor/github.com/go-playground/validator/v10/README.md index ddd65b07..25eadf02 100644 --- a/vendor/github.com/go-playground/validator/v10/README.md +++ b/vendor/github.com/go-playground/validator/v10/README.md @@ -1,7 +1,7 @@ Package validator ================= [![Join the chat at https://gitter.im/go-playground/validator](https://badges.gitter.im/Join%20Chat.svg)](https://gitter.im/go-playground/validator?utm_source=badge&utm_medium=badge&utm_campaign=pr-badge&utm_content=badge) -![Project status](https://img.shields.io/badge/version-10.22.1-green.svg) +![Project status](https://img.shields.io/badge/version-10.24.0-green.svg) [![Build Status](https://travis-ci.org/go-playground/validator.svg?branch=master)](https://travis-ci.org/go-playground/validator) [![Coverage Status](https://coveralls.io/repos/go-playground/validator/badge.svg?branch=master&service=github)](https://coveralls.io/github/go-playground/validator?branch=master) [![Go Report Card](https://goreportcard.com/badge/github.com/go-playground/validator)](https://goreportcard.com/report/github.com/go-playground/validator) @@ -22,6 +22,11 @@ It has the following **unique** features: - Customizable i18n aware error messages. - Default validator for the [gin](https://github.com/gin-gonic/gin) web framework; upgrading from v8 to v9 in gin see [here](https://github.com/go-playground/validator/tree/master/_examples/gin-upgrading-overriding) +A Call for Maintainers +---------------------- + +Please read the discussiong started [here](https://github.com/go-playground/validator/discussions/1330) if you are interested in contributing/helping maintain this package. + Installation ------------ @@ -266,74 +271,75 @@ validate := validator.New(validator.WithRequiredStructEnabled()) Benchmarks ------ -###### Run on MacBook Pro (15-inch, 2017) go version go1.10.2 darwin/amd64 +###### Run on MacBook Pro Max M3 ```go -go version go1.21.0 darwin/arm64 +go version go1.23.3 darwin/arm64 goos: darwin goarch: arm64 +cpu: Apple M3 Max pkg: github.com/go-playground/validator/v10 -BenchmarkFieldSuccess-8 33142266 35.94 ns/op 0 B/op 0 allocs/op -BenchmarkFieldSuccessParallel-8 200816191 6.568 ns/op 0 B/op 0 allocs/op -BenchmarkFieldFailure-8 6779707 175.1 ns/op 200 B/op 4 allocs/op -BenchmarkFieldFailureParallel-8 11044147 108.4 ns/op 200 B/op 4 allocs/op -BenchmarkFieldArrayDiveSuccess-8 6054232 194.4 ns/op 97 B/op 5 allocs/op -BenchmarkFieldArrayDiveSuccessParallel-8 12523388 94.07 ns/op 97 B/op 5 allocs/op -BenchmarkFieldArrayDiveFailure-8 3587043 334.3 ns/op 300 B/op 10 allocs/op -BenchmarkFieldArrayDiveFailureParallel-8 5816665 200.8 ns/op 300 B/op 10 allocs/op -BenchmarkFieldMapDiveSuccess-8 2217910 540.1 ns/op 288 B/op 14 allocs/op -BenchmarkFieldMapDiveSuccessParallel-8 4446698 258.7 ns/op 288 B/op 14 allocs/op -BenchmarkFieldMapDiveFailure-8 2392759 504.6 ns/op 376 B/op 13 allocs/op -BenchmarkFieldMapDiveFailureParallel-8 4244199 286.9 ns/op 376 B/op 13 allocs/op -BenchmarkFieldMapDiveWithKeysSuccess-8 2005857 592.1 ns/op 288 B/op 14 allocs/op -BenchmarkFieldMapDiveWithKeysSuccessParallel-8 4400850 296.9 ns/op 288 B/op 14 allocs/op -BenchmarkFieldMapDiveWithKeysFailure-8 1850227 643.8 ns/op 553 B/op 16 allocs/op -BenchmarkFieldMapDiveWithKeysFailureParallel-8 3293233 375.1 ns/op 553 B/op 16 allocs/op -BenchmarkFieldCustomTypeSuccess-8 12174412 98.25 ns/op 32 B/op 2 allocs/op -BenchmarkFieldCustomTypeSuccessParallel-8 34389907 35.49 ns/op 32 B/op 2 allocs/op -BenchmarkFieldCustomTypeFailure-8 7582524 156.6 ns/op 184 B/op 3 allocs/op -BenchmarkFieldCustomTypeFailureParallel-8 13019902 92.79 ns/op 184 B/op 3 allocs/op -BenchmarkFieldOrTagSuccess-8 3427260 349.4 ns/op 16 B/op 1 allocs/op -BenchmarkFieldOrTagSuccessParallel-8 15144128 81.25 ns/op 16 B/op 1 allocs/op -BenchmarkFieldOrTagFailure-8 5913546 201.9 ns/op 216 B/op 5 allocs/op -BenchmarkFieldOrTagFailureParallel-8 9810212 113.7 ns/op 216 B/op 5 allocs/op -BenchmarkStructLevelValidationSuccess-8 13456327 87.66 ns/op 16 B/op 1 allocs/op -BenchmarkStructLevelValidationSuccessParallel-8 41818888 27.77 ns/op 16 B/op 1 allocs/op -BenchmarkStructLevelValidationFailure-8 4166284 272.6 ns/op 264 B/op 7 allocs/op -BenchmarkStructLevelValidationFailureParallel-8 7594581 152.1 ns/op 264 B/op 7 allocs/op -BenchmarkStructSimpleCustomTypeSuccess-8 6508082 182.6 ns/op 32 B/op 2 allocs/op -BenchmarkStructSimpleCustomTypeSuccessParallel-8 23078605 54.78 ns/op 32 B/op 2 allocs/op -BenchmarkStructSimpleCustomTypeFailure-8 3118352 381.0 ns/op 416 B/op 9 allocs/op -BenchmarkStructSimpleCustomTypeFailureParallel-8 5300738 224.1 ns/op 432 B/op 10 allocs/op -BenchmarkStructFilteredSuccess-8 4761807 251.1 ns/op 216 B/op 5 allocs/op -BenchmarkStructFilteredSuccessParallel-8 8792598 128.6 ns/op 216 B/op 5 allocs/op -BenchmarkStructFilteredFailure-8 5202573 232.1 ns/op 216 B/op 5 allocs/op -BenchmarkStructFilteredFailureParallel-8 9591267 121.4 ns/op 216 B/op 5 allocs/op -BenchmarkStructPartialSuccess-8 5188512 231.6 ns/op 224 B/op 4 allocs/op -BenchmarkStructPartialSuccessParallel-8 9179776 123.1 ns/op 224 B/op 4 allocs/op -BenchmarkStructPartialFailure-8 3071212 392.5 ns/op 440 B/op 9 allocs/op -BenchmarkStructPartialFailureParallel-8 5344261 223.7 ns/op 440 B/op 9 allocs/op -BenchmarkStructExceptSuccess-8 3184230 375.0 ns/op 424 B/op 8 allocs/op -BenchmarkStructExceptSuccessParallel-8 10090130 108.9 ns/op 208 B/op 3 allocs/op -BenchmarkStructExceptFailure-8 3347226 357.7 ns/op 424 B/op 8 allocs/op -BenchmarkStructExceptFailureParallel-8 5654923 209.5 ns/op 424 B/op 8 allocs/op -BenchmarkStructSimpleCrossFieldSuccess-8 5232265 229.1 ns/op 56 B/op 3 allocs/op -BenchmarkStructSimpleCrossFieldSuccessParallel-8 17436674 64.75 ns/op 56 B/op 3 allocs/op -BenchmarkStructSimpleCrossFieldFailure-8 3128613 383.6 ns/op 272 B/op 8 allocs/op -BenchmarkStructSimpleCrossFieldFailureParallel-8 6994113 168.8 ns/op 272 B/op 8 allocs/op -BenchmarkStructSimpleCrossStructCrossFieldSuccess-8 3506487 340.9 ns/op 64 B/op 4 allocs/op -BenchmarkStructSimpleCrossStructCrossFieldSuccessParallel-8 13431300 91.77 ns/op 64 B/op 4 allocs/op -BenchmarkStructSimpleCrossStructCrossFieldFailure-8 2410566 500.9 ns/op 288 B/op 9 allocs/op -BenchmarkStructSimpleCrossStructCrossFieldFailureParallel-8 6344510 188.2 ns/op 288 B/op 9 allocs/op -BenchmarkStructSimpleSuccess-8 8922726 133.8 ns/op 0 B/op 0 allocs/op -BenchmarkStructSimpleSuccessParallel-8 55291153 23.63 ns/op 0 B/op 0 allocs/op -BenchmarkStructSimpleFailure-8 3171553 378.4 ns/op 416 B/op 9 allocs/op -BenchmarkStructSimpleFailureParallel-8 5571692 212.0 ns/op 416 B/op 9 allocs/op -BenchmarkStructComplexSuccess-8 1683750 714.5 ns/op 224 B/op 5 allocs/op -BenchmarkStructComplexSuccessParallel-8 4578046 257.0 ns/op 224 B/op 5 allocs/op -BenchmarkStructComplexFailure-8 481585 2547 ns/op 3041 B/op 48 allocs/op -BenchmarkStructComplexFailureParallel-8 965764 1577 ns/op 3040 B/op 48 allocs/op -BenchmarkOneof-8 17380881 68.50 ns/op 0 B/op 0 allocs/op -BenchmarkOneofParallel-8 8084733 153.5 ns/op 0 B/op 0 allocs/op +BenchmarkFieldSuccess-16 42461943 27.88 ns/op 0 B/op 0 allocs/op +BenchmarkFieldSuccessParallel-16 486632887 2.289 ns/op 0 B/op 0 allocs/op +BenchmarkFieldFailure-16 9566167 121.3 ns/op 200 B/op 4 allocs/op +BenchmarkFieldFailureParallel-16 17551471 83.68 ns/op 200 B/op 4 allocs/op +BenchmarkFieldArrayDiveSuccess-16 7602306 155.6 ns/op 97 B/op 5 allocs/op +BenchmarkFieldArrayDiveSuccessParallel-16 20664610 59.80 ns/op 97 B/op 5 allocs/op +BenchmarkFieldArrayDiveFailure-16 4659756 252.9 ns/op 301 B/op 10 allocs/op +BenchmarkFieldArrayDiveFailureParallel-16 8010116 152.9 ns/op 301 B/op 10 allocs/op +BenchmarkFieldMapDiveSuccess-16 2834575 421.2 ns/op 288 B/op 14 allocs/op +BenchmarkFieldMapDiveSuccessParallel-16 7179700 171.8 ns/op 288 B/op 14 allocs/op +BenchmarkFieldMapDiveFailure-16 3081728 384.4 ns/op 376 B/op 13 allocs/op +BenchmarkFieldMapDiveFailureParallel-16 6058137 204.0 ns/op 377 B/op 13 allocs/op +BenchmarkFieldMapDiveWithKeysSuccess-16 2544975 464.8 ns/op 288 B/op 14 allocs/op +BenchmarkFieldMapDiveWithKeysSuccessParallel-16 6661954 181.4 ns/op 288 B/op 14 allocs/op +BenchmarkFieldMapDiveWithKeysFailure-16 2435484 490.7 ns/op 553 B/op 16 allocs/op +BenchmarkFieldMapDiveWithKeysFailureParallel-16 4249617 282.0 ns/op 554 B/op 16 allocs/op +BenchmarkFieldCustomTypeSuccess-16 14943525 77.35 ns/op 32 B/op 2 allocs/op +BenchmarkFieldCustomTypeSuccessParallel-16 64051954 20.61 ns/op 32 B/op 2 allocs/op +BenchmarkFieldCustomTypeFailure-16 10721384 107.1 ns/op 184 B/op 3 allocs/op +BenchmarkFieldCustomTypeFailureParallel-16 18714495 69.77 ns/op 184 B/op 3 allocs/op +BenchmarkFieldOrTagSuccess-16 4063124 294.3 ns/op 16 B/op 1 allocs/op +BenchmarkFieldOrTagSuccessParallel-16 31903756 41.22 ns/op 18 B/op 1 allocs/op +BenchmarkFieldOrTagFailure-16 7748558 146.8 ns/op 216 B/op 5 allocs/op +BenchmarkFieldOrTagFailureParallel-16 13139854 92.05 ns/op 216 B/op 5 allocs/op +BenchmarkStructLevelValidationSuccess-16 16808389 70.25 ns/op 16 B/op 1 allocs/op +BenchmarkStructLevelValidationSuccessParallel-16 90686955 14.47 ns/op 16 B/op 1 allocs/op +BenchmarkStructLevelValidationFailure-16 5818791 200.2 ns/op 264 B/op 7 allocs/op +BenchmarkStructLevelValidationFailureParallel-16 11115874 107.5 ns/op 264 B/op 7 allocs/op +BenchmarkStructSimpleCustomTypeSuccess-16 7764956 151.9 ns/op 32 B/op 2 allocs/op +BenchmarkStructSimpleCustomTypeSuccessParallel-16 52316265 30.37 ns/op 32 B/op 2 allocs/op +BenchmarkStructSimpleCustomTypeFailure-16 4195429 277.2 ns/op 416 B/op 9 allocs/op +BenchmarkStructSimpleCustomTypeFailureParallel-16 7305661 164.6 ns/op 432 B/op 10 allocs/op +BenchmarkStructFilteredSuccess-16 6312625 186.1 ns/op 216 B/op 5 allocs/op +BenchmarkStructFilteredSuccessParallel-16 13684459 93.42 ns/op 216 B/op 5 allocs/op +BenchmarkStructFilteredFailure-16 6751482 171.2 ns/op 216 B/op 5 allocs/op +BenchmarkStructFilteredFailureParallel-16 14146070 86.93 ns/op 216 B/op 5 allocs/op +BenchmarkStructPartialSuccess-16 6544448 177.3 ns/op 224 B/op 4 allocs/op +BenchmarkStructPartialSuccessParallel-16 13951946 88.73 ns/op 224 B/op 4 allocs/op +BenchmarkStructPartialFailure-16 4075833 287.5 ns/op 440 B/op 9 allocs/op +BenchmarkStructPartialFailureParallel-16 7490805 161.3 ns/op 440 B/op 9 allocs/op +BenchmarkStructExceptSuccess-16 4107187 281.4 ns/op 424 B/op 8 allocs/op +BenchmarkStructExceptSuccessParallel-16 15979173 80.86 ns/op 208 B/op 3 allocs/op +BenchmarkStructExceptFailure-16 4434372 264.3 ns/op 424 B/op 8 allocs/op +BenchmarkStructExceptFailureParallel-16 8081367 154.1 ns/op 424 B/op 8 allocs/op +BenchmarkStructSimpleCrossFieldSuccess-16 6459542 183.4 ns/op 56 B/op 3 allocs/op +BenchmarkStructSimpleCrossFieldSuccessParallel-16 41013781 37.95 ns/op 56 B/op 3 allocs/op +BenchmarkStructSimpleCrossFieldFailure-16 4034998 292.1 ns/op 272 B/op 8 allocs/op +BenchmarkStructSimpleCrossFieldFailureParallel-16 11348446 115.3 ns/op 272 B/op 8 allocs/op +BenchmarkStructSimpleCrossStructCrossFieldSuccess-16 4448528 267.7 ns/op 64 B/op 4 allocs/op +BenchmarkStructSimpleCrossStructCrossFieldSuccessParallel-16 26813619 48.33 ns/op 64 B/op 4 allocs/op +BenchmarkStructSimpleCrossStructCrossFieldFailure-16 3090646 384.5 ns/op 288 B/op 9 allocs/op +BenchmarkStructSimpleCrossStructCrossFieldFailureParallel-16 9870906 129.5 ns/op 288 B/op 9 allocs/op +BenchmarkStructSimpleSuccess-16 10675562 109.5 ns/op 0 B/op 0 allocs/op +BenchmarkStructSimpleSuccessParallel-16 131159784 8.932 ns/op 0 B/op 0 allocs/op +BenchmarkStructSimpleFailure-16 4094979 286.6 ns/op 416 B/op 9 allocs/op +BenchmarkStructSimpleFailureParallel-16 7606663 157.9 ns/op 416 B/op 9 allocs/op +BenchmarkStructComplexSuccess-16 2073470 576.0 ns/op 224 B/op 5 allocs/op +BenchmarkStructComplexSuccessParallel-16 7821831 161.3 ns/op 224 B/op 5 allocs/op +BenchmarkStructComplexFailure-16 576358 2001 ns/op 3042 B/op 48 allocs/op +BenchmarkStructComplexFailureParallel-16 1000000 1171 ns/op 3041 B/op 48 allocs/op +BenchmarkOneof-16 22503973 52.82 ns/op 0 B/op 0 allocs/op +BenchmarkOneofParallel-16 8538474 140.4 ns/op 0 B/op 0 allocs/op ``` Complementary Software @@ -349,6 +355,20 @@ How to Contribute Make a pull request... +Maintenance and support for SDK major versions +---------------------------------------------- + +See prior discussion [here](https://github.com/go-playground/validator/discussions/1342) for more details. + +This package is aligned with the [Go release policy](https://go.dev/doc/devel/release) in that support is guaranteed for +the two most recent major versions. + +This does not mean the package will not work with older versions of Go, only that we reserve the right to increase the +MSGV(Minimum Supported Go Version) when the need arises to address Security issues/patches, OS issues & support or newly +introduced functionality that would greatly benefit the maintenance and/or usage of this package. + +If and when the MSGV is increased it will be done so in a minimum of a `Minor` release bump. + License ------- Distributed under MIT License, please see license file within the code for more details. diff --git a/vendor/github.com/go-playground/validator/v10/baked_in.go b/vendor/github.com/go-playground/validator/v10/baked_in.go index d1a3656a..2f66c183 100644 --- a/vendor/github.com/go-playground/validator/v10/baked_in.go +++ b/vendor/github.com/go-playground/validator/v10/baked_in.go @@ -205,6 +205,7 @@ var ( "fqdn": isFQDN, "unique": isUnique, "oneof": isOneOf, + "oneofci": isOneOfCI, "html": isHTML, "html_encoded": isHTMLEncoded, "url_encoded": isURLEncoded, @@ -213,6 +214,7 @@ var ( "json": isJSON, "jwt": isJWT, "hostname_port": isHostnamePort, + "port": isPort, "lowercase": isLowercase, "uppercase": isUppercase, "datetime": isDatetime, @@ -299,6 +301,23 @@ func isOneOf(fl FieldLevel) bool { return false } +// isOneOfCI is the validation function for validating if the current field's value is one of the provided string values (case insensitive). +func isOneOfCI(fl FieldLevel) bool { + vals := parseOneOfParam2(fl.Param()) + field := fl.Field() + + if field.Kind() != reflect.String { + panic(fmt.Sprintf("Bad field type %T", field.Interface())) + } + v := field.String() + for _, val := range vals { + if strings.EqualFold(val, v) { + return true + } + } + return false +} + // isUnique is the validation function for validating if each array|slice|map value is unique func isUnique(fl FieldLevel) bool { field := fl.Field() @@ -2711,6 +2730,13 @@ func isHostnamePort(fl FieldLevel) bool { return true } +// IsPort validates if the current field's value represents a valid port +func isPort(fl FieldLevel) bool { + val := fl.Field().Uint() + + return val >= 1 && val <= 65535 +} + // isLowercase is the validation function for validating if the current field's value is a lowercase string. func isLowercase(fl FieldLevel) bool { field := fl.Field() diff --git a/vendor/github.com/go-playground/validator/v10/doc.go b/vendor/github.com/go-playground/validator/v10/doc.go index 90a8ade6..c9b1616e 100644 --- a/vendor/github.com/go-playground/validator/v10/doc.go +++ b/vendor/github.com/go-playground/validator/v10/doc.go @@ -489,12 +489,19 @@ For strings, ints, and uints, oneof will ensure that the value is one of the values in the parameter. The parameter should be a list of values separated by whitespace. Values may be strings or numbers. To match strings with spaces in them, include -the target string between single quotes. +the target string between single quotes. Kind of like an 'enum'. Usage: oneof=red green oneof='red green' 'blue yellow' oneof=5 7 9 +# One Of Case Insensitive + +Works the same as oneof but is case insensitive and therefore only accepts strings. + + Usage: oneofci=red green + oneofci='red green' 'blue yellow' + # Greater Than For numbers, this will ensure that the value is greater than the diff --git a/vendor/github.com/go-playground/validator/v10/regexes.go b/vendor/github.com/go-playground/validator/v10/regexes.go index 7e1dd5a0..871cf7df 100644 --- a/vendor/github.com/go-playground/validator/v10/regexes.go +++ b/vendor/github.com/go-playground/validator/v10/regexes.go @@ -73,7 +73,7 @@ const ( cveRegexString = `^CVE-(1999|2\d{3})-(0[^0]\d{2}|0\d[^0]\d{1}|0\d{2}[^0]|[1-9]{1}\d{3,})$` // CVE Format Id https://cve.mitre.org/cve/identifiers/syntaxchange.html mongodbIdRegexString = "^[a-f\\d]{24}$" mongodbConnStringRegexString = "^mongodb(\\+srv)?:\\/\\/(([a-zA-Z\\d]+):([a-zA-Z\\d$:\\/?#\\[\\]@]+)@)?(([a-z\\d.-]+)(:[\\d]+)?)((,(([a-z\\d.-]+)(:(\\d+))?))*)?(\\/[a-zA-Z-_]{1,64})?(\\?(([a-zA-Z]+)=([a-zA-Z\\d]+))(&(([a-zA-Z\\d]+)=([a-zA-Z\\d]+))?)*)?$" - cronRegexString = `(@(annually|yearly|monthly|weekly|daily|hourly|reboot))|(@every (\d+(ns|us|µs|ms|s|m|h))+)|((((\d+,)+\d+|(\d+(\/|-)\d+)|\d+|\*) ?){5,7})` + cronRegexString = `(@(annually|yearly|monthly|weekly|daily|hourly|reboot))|(@every (\d+(ns|us|µs|ms|s|m|h))+)|((((\d+,)+\d+|((\*|\d+)(\/|-)\d+)|\d+|\*) ?){5,7})` spicedbIDRegexString = `^(([a-zA-Z0-9/_|\-=+]{1,})|\*)$` spicedbPermissionRegexString = "^([a-z][a-z0-9_]{1,62}[a-z0-9])?$" spicedbTypeRegexString = "^([a-z][a-z0-9_]{1,61}[a-z0-9]/)?[a-z][a-z0-9_]{1,62}[a-z0-9]$" diff --git a/vendor/github.com/go-viper/mapstructure/v2/.editorconfig b/vendor/github.com/go-viper/mapstructure/v2/.editorconfig new file mode 100644 index 00000000..1f664d13 --- /dev/null +++ b/vendor/github.com/go-viper/mapstructure/v2/.editorconfig @@ -0,0 +1,18 @@ +root = true + +[*] +charset = utf-8 +end_of_line = lf +indent_size = 4 +indent_style = space +insert_final_newline = true +trim_trailing_whitespace = true + +[*.go] +indent_style = tab + +[{Makefile,*.mk}] +indent_style = tab + +[*.nix] +indent_size = 2 diff --git a/vendor/github.com/go-viper/mapstructure/v2/.envrc b/vendor/github.com/go-viper/mapstructure/v2/.envrc new file mode 100644 index 00000000..2e0f9f5f --- /dev/null +++ b/vendor/github.com/go-viper/mapstructure/v2/.envrc @@ -0,0 +1,4 @@ +if ! has nix_direnv_version || ! nix_direnv_version 3.0.4; then + source_url "https://raw.githubusercontent.com/nix-community/nix-direnv/3.0.4/direnvrc" "sha256-DzlYZ33mWF/Gs8DDeyjr8mnVmQGx7ASYqA5WlxwvBG4=" +fi +use flake . --impure diff --git a/vendor/github.com/go-viper/mapstructure/v2/.gitignore b/vendor/github.com/go-viper/mapstructure/v2/.gitignore new file mode 100644 index 00000000..470e7ca2 --- /dev/null +++ b/vendor/github.com/go-viper/mapstructure/v2/.gitignore @@ -0,0 +1,6 @@ +/.devenv/ +/.direnv/ +/.pre-commit-config.yaml +/bin/ +/build/ +/var/ diff --git a/vendor/github.com/go-viper/mapstructure/v2/.golangci.yaml b/vendor/github.com/go-viper/mapstructure/v2/.golangci.yaml new file mode 100644 index 00000000..763143aa --- /dev/null +++ b/vendor/github.com/go-viper/mapstructure/v2/.golangci.yaml @@ -0,0 +1,23 @@ +run: + timeout: 5m + +linters-settings: + gci: + sections: + - standard + - default + - prefix(github.com/go-viper/mapstructure) + golint: + min-confidence: 0 + goimports: + local-prefixes: github.com/go-viper/maptstructure + +linters: + disable-all: true + enable: + - gci + - gofmt + - gofumpt + - goimports + - staticcheck + # - stylecheck diff --git a/vendor/github.com/mitchellh/mapstructure/CHANGELOG.md b/vendor/github.com/go-viper/mapstructure/v2/CHANGELOG.md similarity index 92% rename from vendor/github.com/mitchellh/mapstructure/CHANGELOG.md rename to vendor/github.com/go-viper/mapstructure/v2/CHANGELOG.md index c7582349..afd44e5f 100644 --- a/vendor/github.com/mitchellh/mapstructure/CHANGELOG.md +++ b/vendor/github.com/go-viper/mapstructure/v2/CHANGELOG.md @@ -1,3 +1,11 @@ +> [!WARNING] +> As of v2 of this library, change log can be found in GitHub releases. + +## 1.5.1 + +* Wrap errors so they're compatible with `errors.Is` and `errors.As` [GH-282] +* Fix map of slices not decoding properly in certain cases. [GH-266] + ## 1.5.0 * New option `IgnoreUntaggedFields` to ignore decoding to any fields diff --git a/vendor/github.com/mitchellh/mapstructure/LICENSE b/vendor/github.com/go-viper/mapstructure/v2/LICENSE similarity index 100% rename from vendor/github.com/mitchellh/mapstructure/LICENSE rename to vendor/github.com/go-viper/mapstructure/v2/LICENSE diff --git a/vendor/github.com/go-viper/mapstructure/v2/README.md b/vendor/github.com/go-viper/mapstructure/v2/README.md new file mode 100644 index 00000000..dd5ec69d --- /dev/null +++ b/vendor/github.com/go-viper/mapstructure/v2/README.md @@ -0,0 +1,80 @@ +# mapstructure + +[![GitHub Workflow Status](https://img.shields.io/github/actions/workflow/status/go-viper/mapstructure/ci.yaml?branch=main&style=flat-square)](https://github.com/go-viper/mapstructure/actions?query=workflow%3ACI) +[![go.dev reference](https://img.shields.io/badge/go.dev-reference-007d9c?logo=go&logoColor=white&style=flat-square)](https://pkg.go.dev/mod/github.com/go-viper/mapstructure/v2) +![Go Version](https://img.shields.io/badge/go%20version-%3E=1.18-61CFDD.svg?style=flat-square) + +mapstructure is a Go library for decoding generic map values to structures +and vice versa, while providing helpful error handling. + +This library is most useful when decoding values from some data stream (JSON, +Gob, etc.) where you don't _quite_ know the structure of the underlying data +until you read a part of it. You can therefore read a `map[string]interface{}` +and use this library to decode it into the proper underlying native Go +structure. + +## Installation + +```shell +go get github.com/go-viper/mapstructure/v2 +``` + +## Migrating from `github.com/mitchellh/mapstructure` + +[@mitchehllh](https://github.com/mitchellh) announced his intent to archive some of his unmaintained projects (see [here](https://gist.github.com/mitchellh/90029601268e59a29e64e55bab1c5bdc) and [here](https://github.com/mitchellh/mapstructure/issues/349)). This is a repository achieved the "blessed fork" status. + +You can migrate to this package by changing your import paths in your Go files to `github.com/go-viper/mapstructure/v2`. +The API is the same, so you don't need to change anything else. + +Here is a script that can help you with the migration: + +```shell +sed -i 's/github.com\/mitchellh\/mapstructure/github.com\/go-viper\/mapstructure\/v2/g' $(find . -type f -name '*.go') +``` + +If you need more time to migrate your code, that is absolutely fine. + +Some of the latest fixes are backported to the v1 release branch of this package, so you can use the Go modules `replace` feature until you are ready to migrate: + +```shell +replace github.com/mitchellh/mapstructure => github.com/go-viper/mapstructure v1.6.0 +``` + +## Usage & Example + +For usage and examples see the [documentation](https://pkg.go.dev/mod/github.com/go-viper/mapstructure/v2). + +The `Decode` function has examples associated with it there. + +## But Why?! + +Go offers fantastic standard libraries for decoding formats such as JSON. +The standard method is to have a struct pre-created, and populate that struct +from the bytes of the encoded format. This is great, but the problem is if +you have configuration or an encoding that changes slightly depending on +specific fields. For example, consider this JSON: + +```json +{ + "type": "person", + "name": "Mitchell" +} +``` + +Perhaps we can't populate a specific structure without first reading +the "type" field from the JSON. We could always do two passes over the +decoding of the JSON (reading the "type" first, and the rest later). +However, it is much simpler to just decode this into a `map[string]interface{}` +structure, read the "type" key, then use something like this library +to decode it into the proper structure. + +## Credits + +Mapstructure was originally created by [@mitchellh](https://github.com/mitchellh). +This is a maintained fork of the original library. + +Read more about the reasons for the fork [here](https://github.com/mitchellh/mapstructure/issues/349). + +## License + +The project is licensed under the [MIT License](LICENSE). diff --git a/vendor/github.com/go-viper/mapstructure/v2/decode_hooks.go b/vendor/github.com/go-viper/mapstructure/v2/decode_hooks.go new file mode 100644 index 00000000..1f3c69d4 --- /dev/null +++ b/vendor/github.com/go-viper/mapstructure/v2/decode_hooks.go @@ -0,0 +1,630 @@ +package mapstructure + +import ( + "encoding" + "errors" + "fmt" + "net" + "net/netip" + "net/url" + "reflect" + "strconv" + "strings" + "time" +) + +// typedDecodeHook takes a raw DecodeHookFunc (an interface{}) and turns +// it into the proper DecodeHookFunc type, such as DecodeHookFuncType. +func typedDecodeHook(h DecodeHookFunc) DecodeHookFunc { + // Create variables here so we can reference them with the reflect pkg + var f1 DecodeHookFuncType + var f2 DecodeHookFuncKind + var f3 DecodeHookFuncValue + + // Fill in the variables into this interface and the rest is done + // automatically using the reflect package. + potential := []interface{}{f1, f2, f3} + + v := reflect.ValueOf(h) + vt := v.Type() + for _, raw := range potential { + pt := reflect.ValueOf(raw).Type() + if vt.ConvertibleTo(pt) { + return v.Convert(pt).Interface() + } + } + + return nil +} + +// cachedDecodeHook takes a raw DecodeHookFunc (an interface{}) and turns +// it into a closure to be used directly +// if the type fails to convert we return a closure always erroring to keep the previous behaviour +func cachedDecodeHook(raw DecodeHookFunc) func(from reflect.Value, to reflect.Value) (interface{}, error) { + switch f := typedDecodeHook(raw).(type) { + case DecodeHookFuncType: + return func(from reflect.Value, to reflect.Value) (interface{}, error) { + return f(from.Type(), to.Type(), from.Interface()) + } + case DecodeHookFuncKind: + return func(from reflect.Value, to reflect.Value) (interface{}, error) { + return f(from.Kind(), to.Kind(), from.Interface()) + } + case DecodeHookFuncValue: + return func(from reflect.Value, to reflect.Value) (interface{}, error) { + return f(from, to) + } + default: + return func(from reflect.Value, to reflect.Value) (interface{}, error) { + return nil, errors.New("invalid decode hook signature") + } + } +} + +// DecodeHookExec executes the given decode hook. This should be used +// since it'll naturally degrade to the older backwards compatible DecodeHookFunc +// that took reflect.Kind instead of reflect.Type. +func DecodeHookExec( + raw DecodeHookFunc, + from reflect.Value, to reflect.Value, +) (interface{}, error) { + switch f := typedDecodeHook(raw).(type) { + case DecodeHookFuncType: + return f(from.Type(), to.Type(), from.Interface()) + case DecodeHookFuncKind: + return f(from.Kind(), to.Kind(), from.Interface()) + case DecodeHookFuncValue: + return f(from, to) + default: + return nil, errors.New("invalid decode hook signature") + } +} + +// ComposeDecodeHookFunc creates a single DecodeHookFunc that +// automatically composes multiple DecodeHookFuncs. +// +// The composed funcs are called in order, with the result of the +// previous transformation. +func ComposeDecodeHookFunc(fs ...DecodeHookFunc) DecodeHookFunc { + cached := make([]func(from reflect.Value, to reflect.Value) (interface{}, error), 0, len(fs)) + for _, f := range fs { + cached = append(cached, cachedDecodeHook(f)) + } + return func(f reflect.Value, t reflect.Value) (interface{}, error) { + var err error + data := f.Interface() + + newFrom := f + for _, c := range cached { + data, err = c(newFrom, t) + if err != nil { + return nil, err + } + newFrom = reflect.ValueOf(data) + } + + return data, nil + } +} + +// OrComposeDecodeHookFunc executes all input hook functions until one of them returns no error. In that case its value is returned. +// If all hooks return an error, OrComposeDecodeHookFunc returns an error concatenating all error messages. +func OrComposeDecodeHookFunc(ff ...DecodeHookFunc) DecodeHookFunc { + cached := make([]func(from reflect.Value, to reflect.Value) (interface{}, error), 0, len(ff)) + for _, f := range ff { + cached = append(cached, cachedDecodeHook(f)) + } + return func(a, b reflect.Value) (interface{}, error) { + var allErrs string + var out interface{} + var err error + + for _, c := range cached { + out, err = c(a, b) + if err != nil { + allErrs += err.Error() + "\n" + continue + } + + return out, nil + } + + return nil, errors.New(allErrs) + } +} + +// StringToSliceHookFunc returns a DecodeHookFunc that converts +// string to []string by splitting on the given sep. +func StringToSliceHookFunc(sep string) DecodeHookFunc { + return func( + f reflect.Type, + t reflect.Type, + data interface{}, + ) (interface{}, error) { + if f.Kind() != reflect.String { + return data, nil + } + if t != reflect.SliceOf(f) { + return data, nil + } + + raw := data.(string) + if raw == "" { + return []string{}, nil + } + + return strings.Split(raw, sep), nil + } +} + +// StringToTimeDurationHookFunc returns a DecodeHookFunc that converts +// strings to time.Duration. +func StringToTimeDurationHookFunc() DecodeHookFunc { + return func( + f reflect.Type, + t reflect.Type, + data interface{}, + ) (interface{}, error) { + if f.Kind() != reflect.String { + return data, nil + } + if t != reflect.TypeOf(time.Duration(5)) { + return data, nil + } + + // Convert it by parsing + return time.ParseDuration(data.(string)) + } +} + +// StringToURLHookFunc returns a DecodeHookFunc that converts +// strings to *url.URL. +func StringToURLHookFunc() DecodeHookFunc { + return func( + f reflect.Type, + t reflect.Type, + data interface{}, + ) (interface{}, error) { + if f.Kind() != reflect.String { + return data, nil + } + if t != reflect.TypeOf(&url.URL{}) { + return data, nil + } + + // Convert it by parsing + return url.Parse(data.(string)) + } +} + +// StringToIPHookFunc returns a DecodeHookFunc that converts +// strings to net.IP +func StringToIPHookFunc() DecodeHookFunc { + return func( + f reflect.Type, + t reflect.Type, + data interface{}, + ) (interface{}, error) { + if f.Kind() != reflect.String { + return data, nil + } + if t != reflect.TypeOf(net.IP{}) { + return data, nil + } + + // Convert it by parsing + ip := net.ParseIP(data.(string)) + if ip == nil { + return net.IP{}, fmt.Errorf("failed parsing ip %v", data) + } + + return ip, nil + } +} + +// StringToIPNetHookFunc returns a DecodeHookFunc that converts +// strings to net.IPNet +func StringToIPNetHookFunc() DecodeHookFunc { + return func( + f reflect.Type, + t reflect.Type, + data interface{}, + ) (interface{}, error) { + if f.Kind() != reflect.String { + return data, nil + } + if t != reflect.TypeOf(net.IPNet{}) { + return data, nil + } + + // Convert it by parsing + _, net, err := net.ParseCIDR(data.(string)) + return net, err + } +} + +// StringToTimeHookFunc returns a DecodeHookFunc that converts +// strings to time.Time. +func StringToTimeHookFunc(layout string) DecodeHookFunc { + return func( + f reflect.Type, + t reflect.Type, + data interface{}, + ) (interface{}, error) { + if f.Kind() != reflect.String { + return data, nil + } + if t != reflect.TypeOf(time.Time{}) { + return data, nil + } + + // Convert it by parsing + return time.Parse(layout, data.(string)) + } +} + +// WeaklyTypedHook is a DecodeHookFunc which adds support for weak typing to +// the decoder. +// +// Note that this is significantly different from the WeaklyTypedInput option +// of the DecoderConfig. +func WeaklyTypedHook( + f reflect.Kind, + t reflect.Kind, + data interface{}, +) (interface{}, error) { + dataVal := reflect.ValueOf(data) + switch t { + case reflect.String: + switch f { + case reflect.Bool: + if dataVal.Bool() { + return "1", nil + } + return "0", nil + case reflect.Float32: + return strconv.FormatFloat(dataVal.Float(), 'f', -1, 64), nil + case reflect.Int: + return strconv.FormatInt(dataVal.Int(), 10), nil + case reflect.Slice: + dataType := dataVal.Type() + elemKind := dataType.Elem().Kind() + if elemKind == reflect.Uint8 { + return string(dataVal.Interface().([]uint8)), nil + } + case reflect.Uint: + return strconv.FormatUint(dataVal.Uint(), 10), nil + } + } + + return data, nil +} + +func RecursiveStructToMapHookFunc() DecodeHookFunc { + return func(f reflect.Value, t reflect.Value) (interface{}, error) { + if f.Kind() != reflect.Struct { + return f.Interface(), nil + } + + var i interface{} = struct{}{} + if t.Type() != reflect.TypeOf(&i).Elem() { + return f.Interface(), nil + } + + m := make(map[string]interface{}) + t.Set(reflect.ValueOf(m)) + + return f.Interface(), nil + } +} + +// TextUnmarshallerHookFunc returns a DecodeHookFunc that applies +// strings to the UnmarshalText function, when the target type +// implements the encoding.TextUnmarshaler interface +func TextUnmarshallerHookFunc() DecodeHookFuncType { + return func( + f reflect.Type, + t reflect.Type, + data interface{}, + ) (interface{}, error) { + if f.Kind() != reflect.String { + return data, nil + } + result := reflect.New(t).Interface() + unmarshaller, ok := result.(encoding.TextUnmarshaler) + if !ok { + return data, nil + } + str, ok := data.(string) + if !ok { + str = reflect.Indirect(reflect.ValueOf(&data)).Elem().String() + } + if err := unmarshaller.UnmarshalText([]byte(str)); err != nil { + return nil, err + } + return result, nil + } +} + +// StringToNetIPAddrHookFunc returns a DecodeHookFunc that converts +// strings to netip.Addr. +func StringToNetIPAddrHookFunc() DecodeHookFunc { + return func( + f reflect.Type, + t reflect.Type, + data interface{}, + ) (interface{}, error) { + if f.Kind() != reflect.String { + return data, nil + } + if t != reflect.TypeOf(netip.Addr{}) { + return data, nil + } + + // Convert it by parsing + return netip.ParseAddr(data.(string)) + } +} + +// StringToNetIPAddrPortHookFunc returns a DecodeHookFunc that converts +// strings to netip.AddrPort. +func StringToNetIPAddrPortHookFunc() DecodeHookFunc { + return func( + f reflect.Type, + t reflect.Type, + data interface{}, + ) (interface{}, error) { + if f.Kind() != reflect.String { + return data, nil + } + if t != reflect.TypeOf(netip.AddrPort{}) { + return data, nil + } + + // Convert it by parsing + return netip.ParseAddrPort(data.(string)) + } +} + +// StringToBasicTypeHookFunc returns a DecodeHookFunc that converts +// strings to basic types. +// int8, uint8, int16, uint16, int32, uint32, int64, uint64, int, uint, float32, float64, bool, byte, rune, complex64, complex128 +func StringToBasicTypeHookFunc() DecodeHookFunc { + return ComposeDecodeHookFunc( + StringToInt8HookFunc(), + StringToUint8HookFunc(), + StringToInt16HookFunc(), + StringToUint16HookFunc(), + StringToInt32HookFunc(), + StringToUint32HookFunc(), + StringToInt64HookFunc(), + StringToUint64HookFunc(), + StringToIntHookFunc(), + StringToUintHookFunc(), + StringToFloat32HookFunc(), + StringToFloat64HookFunc(), + StringToBoolHookFunc(), + // byte and rune are aliases for uint8 and int32 respectively + // StringToByteHookFunc(), + // StringToRuneHookFunc(), + StringToComplex64HookFunc(), + StringToComplex128HookFunc(), + ) +} + +// StringToInt8HookFunc returns a DecodeHookFunc that converts +// strings to int8. +func StringToInt8HookFunc() DecodeHookFunc { + return func(f reflect.Type, t reflect.Type, data interface{}) (interface{}, error) { + if f.Kind() != reflect.String || t.Kind() != reflect.Int8 { + return data, nil + } + + // Convert it by parsing + i64, err := strconv.ParseInt(data.(string), 0, 8) + return int8(i64), err + } +} + +// StringToUint8HookFunc returns a DecodeHookFunc that converts +// strings to uint8. +func StringToUint8HookFunc() DecodeHookFunc { + return func(f reflect.Type, t reflect.Type, data interface{}) (interface{}, error) { + if f.Kind() != reflect.String || t.Kind() != reflect.Uint8 { + return data, nil + } + + // Convert it by parsing + u64, err := strconv.ParseUint(data.(string), 0, 8) + return uint8(u64), err + } +} + +// StringToInt16HookFunc returns a DecodeHookFunc that converts +// strings to int16. +func StringToInt16HookFunc() DecodeHookFunc { + return func(f reflect.Type, t reflect.Type, data interface{}) (interface{}, error) { + if f.Kind() != reflect.String || t.Kind() != reflect.Int16 { + return data, nil + } + + // Convert it by parsing + i64, err := strconv.ParseInt(data.(string), 0, 16) + return int16(i64), err + } +} + +// StringToUint16HookFunc returns a DecodeHookFunc that converts +// strings to uint16. +func StringToUint16HookFunc() DecodeHookFunc { + return func(f reflect.Type, t reflect.Type, data interface{}) (interface{}, error) { + if f.Kind() != reflect.String || t.Kind() != reflect.Uint16 { + return data, nil + } + + // Convert it by parsing + u64, err := strconv.ParseUint(data.(string), 0, 16) + return uint16(u64), err + } +} + +// StringToInt32HookFunc returns a DecodeHookFunc that converts +// strings to int32. +func StringToInt32HookFunc() DecodeHookFunc { + return func(f reflect.Type, t reflect.Type, data interface{}) (interface{}, error) { + if f.Kind() != reflect.String || t.Kind() != reflect.Int32 { + return data, nil + } + + // Convert it by parsing + i64, err := strconv.ParseInt(data.(string), 0, 32) + return int32(i64), err + } +} + +// StringToUint32HookFunc returns a DecodeHookFunc that converts +// strings to uint32. +func StringToUint32HookFunc() DecodeHookFunc { + return func(f reflect.Type, t reflect.Type, data interface{}) (interface{}, error) { + if f.Kind() != reflect.String || t.Kind() != reflect.Uint32 { + return data, nil + } + + // Convert it by parsing + u64, err := strconv.ParseUint(data.(string), 0, 32) + return uint32(u64), err + } +} + +// StringToInt64HookFunc returns a DecodeHookFunc that converts +// strings to int64. +func StringToInt64HookFunc() DecodeHookFunc { + return func(f reflect.Type, t reflect.Type, data interface{}) (interface{}, error) { + if f.Kind() != reflect.String || t.Kind() != reflect.Int64 { + return data, nil + } + + // Convert it by parsing + return strconv.ParseInt(data.(string), 0, 64) + } +} + +// StringToUint64HookFunc returns a DecodeHookFunc that converts +// strings to uint64. +func StringToUint64HookFunc() DecodeHookFunc { + return func(f reflect.Type, t reflect.Type, data interface{}) (interface{}, error) { + if f.Kind() != reflect.String || t.Kind() != reflect.Uint64 { + return data, nil + } + + // Convert it by parsing + return strconv.ParseUint(data.(string), 0, 64) + } +} + +// StringToIntHookFunc returns a DecodeHookFunc that converts +// strings to int. +func StringToIntHookFunc() DecodeHookFunc { + return func(f reflect.Type, t reflect.Type, data interface{}) (interface{}, error) { + if f.Kind() != reflect.String || t.Kind() != reflect.Int { + return data, nil + } + + // Convert it by parsing + i64, err := strconv.ParseInt(data.(string), 0, 0) + return int(i64), err + } +} + +// StringToUintHookFunc returns a DecodeHookFunc that converts +// strings to uint. +func StringToUintHookFunc() DecodeHookFunc { + return func(f reflect.Type, t reflect.Type, data interface{}) (interface{}, error) { + if f.Kind() != reflect.String || t.Kind() != reflect.Uint { + return data, nil + } + + // Convert it by parsing + u64, err := strconv.ParseUint(data.(string), 0, 0) + return uint(u64), err + } +} + +// StringToFloat32HookFunc returns a DecodeHookFunc that converts +// strings to float32. +func StringToFloat32HookFunc() DecodeHookFunc { + return func(f reflect.Type, t reflect.Type, data interface{}) (interface{}, error) { + if f.Kind() != reflect.String || t.Kind() != reflect.Float32 { + return data, nil + } + + // Convert it by parsing + f64, err := strconv.ParseFloat(data.(string), 32) + return float32(f64), err + } +} + +// StringToFloat64HookFunc returns a DecodeHookFunc that converts +// strings to float64. +func StringToFloat64HookFunc() DecodeHookFunc { + return func(f reflect.Type, t reflect.Type, data interface{}) (interface{}, error) { + if f.Kind() != reflect.String || t.Kind() != reflect.Float64 { + return data, nil + } + + // Convert it by parsing + return strconv.ParseFloat(data.(string), 64) + } +} + +// StringToBoolHookFunc returns a DecodeHookFunc that converts +// strings to bool. +func StringToBoolHookFunc() DecodeHookFunc { + return func(f reflect.Type, t reflect.Type, data interface{}) (interface{}, error) { + if f.Kind() != reflect.String || t.Kind() != reflect.Bool { + return data, nil + } + + // Convert it by parsing + return strconv.ParseBool(data.(string)) + } +} + +// StringToByteHookFunc returns a DecodeHookFunc that converts +// strings to byte. +func StringToByteHookFunc() DecodeHookFunc { + return StringToUint8HookFunc() +} + +// StringToRuneHookFunc returns a DecodeHookFunc that converts +// strings to rune. +func StringToRuneHookFunc() DecodeHookFunc { + return StringToInt32HookFunc() +} + +// StringToComplex64HookFunc returns a DecodeHookFunc that converts +// strings to complex64. +func StringToComplex64HookFunc() DecodeHookFunc { + return func(f reflect.Type, t reflect.Type, data interface{}) (interface{}, error) { + if f.Kind() != reflect.String || t.Kind() != reflect.Complex64 { + return data, nil + } + + // Convert it by parsing + c128, err := strconv.ParseComplex(data.(string), 64) + return complex64(c128), err + } +} + +// StringToComplex128HookFunc returns a DecodeHookFunc that converts +// strings to complex128. +func StringToComplex128HookFunc() DecodeHookFunc { + return func(f reflect.Type, t reflect.Type, data interface{}) (interface{}, error) { + if f.Kind() != reflect.String || t.Kind() != reflect.Complex128 { + return data, nil + } + + // Convert it by parsing + return strconv.ParseComplex(data.(string), 128) + } +} diff --git a/vendor/github.com/go-viper/mapstructure/v2/flake.lock b/vendor/github.com/go-viper/mapstructure/v2/flake.lock new file mode 100644 index 00000000..4bea8154 --- /dev/null +++ b/vendor/github.com/go-viper/mapstructure/v2/flake.lock @@ -0,0 +1,472 @@ +{ + "nodes": { + "cachix": { + "inputs": { + "devenv": "devenv_2", + "flake-compat": [ + "devenv", + "flake-compat" + ], + "nixpkgs": [ + "devenv", + "nixpkgs" + ], + "pre-commit-hooks": [ + "devenv", + "pre-commit-hooks" + ] + }, + "locked": { + "lastModified": 1712055811, + "narHash": "sha256-7FcfMm5A/f02yyzuavJe06zLa9hcMHsagE28ADcmQvk=", + "owner": "cachix", + "repo": "cachix", + "rev": "02e38da89851ec7fec3356a5c04bc8349cae0e30", + "type": "github" + }, + "original": { + "owner": "cachix", + "repo": "cachix", + "type": "github" + } + }, + "devenv": { + "inputs": { + "cachix": "cachix", + "flake-compat": "flake-compat_2", + "nix": "nix_2", + "nixpkgs": "nixpkgs_2", + "pre-commit-hooks": "pre-commit-hooks" + }, + "locked": { + "lastModified": 1717245169, + "narHash": "sha256-+mW3rTBjGU8p1THJN0lX/Dd/8FbnF+3dB+mJuSaxewE=", + "owner": "cachix", + "repo": "devenv", + "rev": "c3f9f053c077c6f88a3de5276d9178c62baa3fc3", + "type": "github" + }, + "original": { + "owner": "cachix", + "repo": "devenv", + "type": "github" + } + }, + "devenv_2": { + "inputs": { + "flake-compat": [ + "devenv", + "cachix", + "flake-compat" + ], + "nix": "nix", + "nixpkgs": "nixpkgs", + "poetry2nix": "poetry2nix", + "pre-commit-hooks": [ + "devenv", + "cachix", + "pre-commit-hooks" + ] + }, + "locked": { + "lastModified": 1708704632, + "narHash": "sha256-w+dOIW60FKMaHI1q5714CSibk99JfYxm0CzTinYWr+Q=", + "owner": "cachix", + "repo": "devenv", + "rev": "2ee4450b0f4b95a1b90f2eb5ffea98b90e48c196", + "type": "github" + }, + "original": { + "owner": "cachix", + "ref": "python-rewrite", + "repo": "devenv", + "type": "github" + } + }, + "flake-compat": { + "flake": false, + "locked": { + "lastModified": 1673956053, + "narHash": "sha256-4gtG9iQuiKITOjNQQeQIpoIB6b16fm+504Ch3sNKLd8=", + "owner": "edolstra", + "repo": "flake-compat", + "rev": "35bb57c0c8d8b62bbfd284272c928ceb64ddbde9", + "type": "github" + }, + "original": { + "owner": "edolstra", + "repo": "flake-compat", + "type": "github" + } + }, + "flake-compat_2": { + "flake": false, + "locked": { + "lastModified": 1696426674, + "narHash": "sha256-kvjfFW7WAETZlt09AgDn1MrtKzP7t90Vf7vypd3OL1U=", + "owner": "edolstra", + "repo": "flake-compat", + "rev": "0f9255e01c2351cc7d116c072cb317785dd33b33", + "type": "github" + }, + "original": { + "owner": "edolstra", + "repo": "flake-compat", + "type": "github" + } + }, + "flake-parts": { + "inputs": { + "nixpkgs-lib": "nixpkgs-lib" + }, + "locked": { + "lastModified": 1717285511, + "narHash": "sha256-iKzJcpdXih14qYVcZ9QC9XuZYnPc6T8YImb6dX166kw=", + "owner": "hercules-ci", + "repo": "flake-parts", + "rev": "2a55567fcf15b1b1c7ed712a2c6fadaec7412ea8", + "type": "github" + }, + "original": { + "owner": "hercules-ci", + "repo": "flake-parts", + "type": "github" + } + }, + "flake-utils": { + "inputs": { + "systems": "systems" + }, + "locked": { + "lastModified": 1689068808, + "narHash": "sha256-6ixXo3wt24N/melDWjq70UuHQLxGV8jZvooRanIHXw0=", + "owner": "numtide", + "repo": "flake-utils", + "rev": "919d646de7be200f3bf08cb76ae1f09402b6f9b4", + "type": "github" + }, + "original": { + "owner": "numtide", + "repo": "flake-utils", + "type": "github" + } + }, + "flake-utils_2": { + "inputs": { + "systems": "systems_2" + }, + "locked": { + "lastModified": 1710146030, + "narHash": "sha256-SZ5L6eA7HJ/nmkzGG7/ISclqe6oZdOZTNoesiInkXPQ=", + "owner": "numtide", + "repo": "flake-utils", + "rev": "b1d9ab70662946ef0850d488da1c9019f3a9752a", + "type": "github" + }, + "original": { + "owner": "numtide", + "repo": "flake-utils", + "type": "github" + } + }, + "gitignore": { + "inputs": { + "nixpkgs": [ + "devenv", + "pre-commit-hooks", + "nixpkgs" + ] + }, + "locked": { + "lastModified": 1709087332, + "narHash": "sha256-HG2cCnktfHsKV0s4XW83gU3F57gaTljL9KNSuG6bnQs=", + "owner": "hercules-ci", + "repo": "gitignore.nix", + "rev": "637db329424fd7e46cf4185293b9cc8c88c95394", + "type": "github" + }, + "original": { + "owner": "hercules-ci", + "repo": "gitignore.nix", + "type": "github" + } + }, + "nix": { + "inputs": { + "flake-compat": "flake-compat", + "nixpkgs": [ + "devenv", + "cachix", + "devenv", + "nixpkgs" + ], + "nixpkgs-regression": "nixpkgs-regression" + }, + "locked": { + "lastModified": 1712911606, + "narHash": "sha256-BGvBhepCufsjcUkXnEEXhEVjwdJAwPglCC2+bInc794=", + "owner": "domenkozar", + "repo": "nix", + "rev": "b24a9318ea3f3600c1e24b4a00691ee912d4de12", + "type": "github" + }, + "original": { + "owner": "domenkozar", + "ref": "devenv-2.21", + "repo": "nix", + "type": "github" + } + }, + "nix-github-actions": { + "inputs": { + "nixpkgs": [ + "devenv", + "cachix", + "devenv", + "poetry2nix", + "nixpkgs" + ] + }, + "locked": { + "lastModified": 1688870561, + "narHash": "sha256-4UYkifnPEw1nAzqqPOTL2MvWtm3sNGw1UTYTalkTcGY=", + "owner": "nix-community", + "repo": "nix-github-actions", + "rev": "165b1650b753316aa7f1787f3005a8d2da0f5301", + "type": "github" + }, + "original": { + "owner": "nix-community", + "repo": "nix-github-actions", + "type": "github" + } + }, + "nix_2": { + "inputs": { + "flake-compat": [ + "devenv", + "flake-compat" + ], + "nixpkgs": [ + "devenv", + "nixpkgs" + ], + "nixpkgs-regression": "nixpkgs-regression_2" + }, + "locked": { + "lastModified": 1712911606, + "narHash": "sha256-BGvBhepCufsjcUkXnEEXhEVjwdJAwPglCC2+bInc794=", + "owner": "domenkozar", + "repo": "nix", + "rev": "b24a9318ea3f3600c1e24b4a00691ee912d4de12", + "type": "github" + }, + "original": { + "owner": "domenkozar", + "ref": "devenv-2.21", + "repo": "nix", + "type": "github" + } + }, + "nixpkgs": { + "locked": { + "lastModified": 1692808169, + "narHash": "sha256-x9Opq06rIiwdwGeK2Ykj69dNc2IvUH1fY55Wm7atwrE=", + "owner": "NixOS", + "repo": "nixpkgs", + "rev": "9201b5ff357e781bf014d0330d18555695df7ba8", + "type": "github" + }, + "original": { + "owner": "NixOS", + "ref": "nixpkgs-unstable", + "repo": "nixpkgs", + "type": "github" + } + }, + "nixpkgs-lib": { + "locked": { + "lastModified": 1717284937, + "narHash": "sha256-lIbdfCsf8LMFloheeE6N31+BMIeixqyQWbSr2vk79EQ=", + "type": "tarball", + "url": "https://github.com/NixOS/nixpkgs/archive/eb9ceca17df2ea50a250b6b27f7bf6ab0186f198.tar.gz" + }, + "original": { + "type": "tarball", + "url": "https://github.com/NixOS/nixpkgs/archive/eb9ceca17df2ea50a250b6b27f7bf6ab0186f198.tar.gz" + } + }, + "nixpkgs-regression": { + "locked": { + "lastModified": 1643052045, + "narHash": "sha256-uGJ0VXIhWKGXxkeNnq4TvV3CIOkUJ3PAoLZ3HMzNVMw=", + "owner": "NixOS", + "repo": "nixpkgs", + "rev": "215d4d0fd80ca5163643b03a33fde804a29cc1e2", + "type": "github" + }, + "original": { + "owner": "NixOS", + "repo": "nixpkgs", + "rev": "215d4d0fd80ca5163643b03a33fde804a29cc1e2", + "type": "github" + } + }, + "nixpkgs-regression_2": { + "locked": { + "lastModified": 1643052045, + "narHash": "sha256-uGJ0VXIhWKGXxkeNnq4TvV3CIOkUJ3PAoLZ3HMzNVMw=", + "owner": "NixOS", + "repo": "nixpkgs", + "rev": "215d4d0fd80ca5163643b03a33fde804a29cc1e2", + "type": "github" + }, + "original": { + "owner": "NixOS", + "repo": "nixpkgs", + "rev": "215d4d0fd80ca5163643b03a33fde804a29cc1e2", + "type": "github" + } + }, + "nixpkgs-stable": { + "locked": { + "lastModified": 1710695816, + "narHash": "sha256-3Eh7fhEID17pv9ZxrPwCLfqXnYP006RKzSs0JptsN84=", + "owner": "NixOS", + "repo": "nixpkgs", + "rev": "614b4613980a522ba49f0d194531beddbb7220d3", + "type": "github" + }, + "original": { + "owner": "NixOS", + "ref": "nixos-23.11", + "repo": "nixpkgs", + "type": "github" + } + }, + "nixpkgs_2": { + "locked": { + "lastModified": 1713361204, + "narHash": "sha256-TA6EDunWTkc5FvDCqU3W2T3SFn0gRZqh6D/hJnM02MM=", + "owner": "cachix", + "repo": "devenv-nixpkgs", + "rev": "285676e87ad9f0ca23d8714a6ab61e7e027020c6", + "type": "github" + }, + "original": { + "owner": "cachix", + "ref": "rolling", + "repo": "devenv-nixpkgs", + "type": "github" + } + }, + "nixpkgs_3": { + "locked": { + "lastModified": 1717112898, + "narHash": "sha256-7R2ZvOnvd9h8fDd65p0JnB7wXfUvreox3xFdYWd1BnY=", + "owner": "NixOS", + "repo": "nixpkgs", + "rev": "6132b0f6e344ce2fe34fc051b72fb46e34f668e0", + "type": "github" + }, + "original": { + "owner": "NixOS", + "ref": "nixpkgs-unstable", + "repo": "nixpkgs", + "type": "github" + } + }, + "poetry2nix": { + "inputs": { + "flake-utils": "flake-utils", + "nix-github-actions": "nix-github-actions", + "nixpkgs": [ + "devenv", + "cachix", + "devenv", + "nixpkgs" + ] + }, + "locked": { + "lastModified": 1692876271, + "narHash": "sha256-IXfZEkI0Mal5y1jr6IRWMqK8GW2/f28xJenZIPQqkY0=", + "owner": "nix-community", + "repo": "poetry2nix", + "rev": "d5006be9c2c2417dafb2e2e5034d83fabd207ee3", + "type": "github" + }, + "original": { + "owner": "nix-community", + "repo": "poetry2nix", + "type": "github" + } + }, + "pre-commit-hooks": { + "inputs": { + "flake-compat": [ + "devenv", + "flake-compat" + ], + "flake-utils": "flake-utils_2", + "gitignore": "gitignore", + "nixpkgs": [ + "devenv", + "nixpkgs" + ], + "nixpkgs-stable": "nixpkgs-stable" + }, + "locked": { + "lastModified": 1713775815, + "narHash": "sha256-Wu9cdYTnGQQwtT20QQMg7jzkANKQjwBD9iccfGKkfls=", + "owner": "cachix", + "repo": "pre-commit-hooks.nix", + "rev": "2ac4dcbf55ed43f3be0bae15e181f08a57af24a4", + "type": "github" + }, + "original": { + "owner": "cachix", + "repo": "pre-commit-hooks.nix", + "type": "github" + } + }, + "root": { + "inputs": { + "devenv": "devenv", + "flake-parts": "flake-parts", + "nixpkgs": "nixpkgs_3" + } + }, + "systems": { + "locked": { + "lastModified": 1681028828, + "narHash": "sha256-Vy1rq5AaRuLzOxct8nz4T6wlgyUR7zLU309k9mBC768=", + "owner": "nix-systems", + "repo": "default", + "rev": "da67096a3b9bf56a91d16901293e51ba5b49a27e", + "type": "github" + }, + "original": { + "owner": "nix-systems", + "repo": "default", + "type": "github" + } + }, + "systems_2": { + "locked": { + "lastModified": 1681028828, + "narHash": "sha256-Vy1rq5AaRuLzOxct8nz4T6wlgyUR7zLU309k9mBC768=", + "owner": "nix-systems", + "repo": "default", + "rev": "da67096a3b9bf56a91d16901293e51ba5b49a27e", + "type": "github" + }, + "original": { + "owner": "nix-systems", + "repo": "default", + "type": "github" + } + } + }, + "root": "root", + "version": 7 +} diff --git a/vendor/github.com/go-viper/mapstructure/v2/flake.nix b/vendor/github.com/go-viper/mapstructure/v2/flake.nix new file mode 100644 index 00000000..4ed0f533 --- /dev/null +++ b/vendor/github.com/go-viper/mapstructure/v2/flake.nix @@ -0,0 +1,39 @@ +{ + inputs = { + nixpkgs.url = "github:NixOS/nixpkgs/nixpkgs-unstable"; + flake-parts.url = "github:hercules-ci/flake-parts"; + devenv.url = "github:cachix/devenv"; + }; + + outputs = inputs@{ flake-parts, ... }: + flake-parts.lib.mkFlake { inherit inputs; } { + imports = [ + inputs.devenv.flakeModule + ]; + + systems = [ "x86_64-linux" "x86_64-darwin" "aarch64-darwin" ]; + + perSystem = { config, self', inputs', pkgs, system, ... }: rec { + devenv.shells = { + default = { + languages = { + go.enable = true; + }; + + pre-commit.hooks = { + nixpkgs-fmt.enable = true; + }; + + packages = with pkgs; [ + golangci-lint + ]; + + # https://github.com/cachix/devenv/issues/528#issuecomment-1556108767 + containers = pkgs.lib.mkForce { }; + }; + + ci = devenv.shells.default; + }; + }; + }; +} diff --git a/vendor/github.com/go-viper/mapstructure/v2/internal/errors/errors.go b/vendor/github.com/go-viper/mapstructure/v2/internal/errors/errors.go new file mode 100644 index 00000000..d1c15e47 --- /dev/null +++ b/vendor/github.com/go-viper/mapstructure/v2/internal/errors/errors.go @@ -0,0 +1,11 @@ +package errors + +import "errors" + +func New(text string) error { + return errors.New(text) +} + +func As(err error, target interface{}) bool { + return errors.As(err, target) +} diff --git a/vendor/github.com/go-viper/mapstructure/v2/internal/errors/join.go b/vendor/github.com/go-viper/mapstructure/v2/internal/errors/join.go new file mode 100644 index 00000000..d74e3a0b --- /dev/null +++ b/vendor/github.com/go-viper/mapstructure/v2/internal/errors/join.go @@ -0,0 +1,9 @@ +//go:build go1.20 + +package errors + +import "errors" + +func Join(errs ...error) error { + return errors.Join(errs...) +} diff --git a/vendor/github.com/go-viper/mapstructure/v2/internal/errors/join_go1_19.go b/vendor/github.com/go-viper/mapstructure/v2/internal/errors/join_go1_19.go new file mode 100644 index 00000000..700b4022 --- /dev/null +++ b/vendor/github.com/go-viper/mapstructure/v2/internal/errors/join_go1_19.go @@ -0,0 +1,61 @@ +//go:build !go1.20 + +// Copyright 2022 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package errors + +// Join returns an error that wraps the given errors. +// Any nil error values are discarded. +// Join returns nil if every value in errs is nil. +// The error formats as the concatenation of the strings obtained +// by calling the Error method of each element of errs, with a newline +// between each string. +// +// A non-nil error returned by Join implements the Unwrap() []error method. +func Join(errs ...error) error { + n := 0 + for _, err := range errs { + if err != nil { + n++ + } + } + if n == 0 { + return nil + } + e := &joinError{ + errs: make([]error, 0, n), + } + for _, err := range errs { + if err != nil { + e.errs = append(e.errs, err) + } + } + return e +} + +type joinError struct { + errs []error +} + +func (e *joinError) Error() string { + // Since Join returns nil if every value in errs is nil, + // e.errs cannot be empty. + if len(e.errs) == 1 { + return e.errs[0].Error() + } + + b := []byte(e.errs[0].Error()) + for _, err := range e.errs[1:] { + b = append(b, '\n') + b = append(b, err.Error()...) + } + // At this point, b has at least one byte '\n'. + // return unsafe.String(&b[0], len(b)) + return string(b) +} + +func (e *joinError) Unwrap() []error { + return e.errs +} diff --git a/vendor/github.com/mitchellh/mapstructure/mapstructure.go b/vendor/github.com/go-viper/mapstructure/v2/mapstructure.go similarity index 87% rename from vendor/github.com/mitchellh/mapstructure/mapstructure.go rename to vendor/github.com/go-viper/mapstructure/v2/mapstructure.go index 1efb22ac..e77e63ba 100644 --- a/vendor/github.com/mitchellh/mapstructure/mapstructure.go +++ b/vendor/github.com/go-viper/mapstructure/v2/mapstructure.go @@ -9,84 +9,84 @@ // // The simplest function to start with is Decode. // -// Field Tags +// # Field Tags // // When decoding to a struct, mapstructure will use the field name by // default to perform the mapping. For example, if a struct has a field // "Username" then mapstructure will look for a key in the source value // of "username" (case insensitive). // -// type User struct { -// Username string -// } +// type User struct { +// Username string +// } // // You can change the behavior of mapstructure by using struct tags. // The default struct tag that mapstructure looks for is "mapstructure" // but you can customize it using DecoderConfig. // -// Renaming Fields +// # Renaming Fields // // To rename the key that mapstructure looks for, use the "mapstructure" // tag and set a value directly. For example, to change the "username" example // above to "user": // -// type User struct { -// Username string `mapstructure:"user"` -// } +// type User struct { +// Username string `mapstructure:"user"` +// } // -// Embedded Structs and Squashing +// # Embedded Structs and Squashing // // Embedded structs are treated as if they're another field with that name. // By default, the two structs below are equivalent when decoding with // mapstructure: // -// type Person struct { -// Name string -// } +// type Person struct { +// Name string +// } // -// type Friend struct { -// Person -// } +// type Friend struct { +// Person +// } // -// type Friend struct { -// Person Person -// } +// type Friend struct { +// Person Person +// } // // This would require an input that looks like below: // -// map[string]interface{}{ -// "person": map[string]interface{}{"name": "alice"}, -// } +// map[string]interface{}{ +// "person": map[string]interface{}{"name": "alice"}, +// } // // If your "person" value is NOT nested, then you can append ",squash" to // your tag value and mapstructure will treat it as if the embedded struct // were part of the struct directly. Example: // -// type Friend struct { -// Person `mapstructure:",squash"` -// } +// type Friend struct { +// Person `mapstructure:",squash"` +// } // // Now the following input would be accepted: // -// map[string]interface{}{ -// "name": "alice", -// } +// map[string]interface{}{ +// "name": "alice", +// } // // When decoding from a struct to a map, the squash tag squashes the struct // fields into a single map. Using the example structs from above: // -// Friend{Person: Person{Name: "alice"}} +// Friend{Person: Person{Name: "alice"}} // // Will be decoded into a map: // -// map[string]interface{}{ -// "name": "alice", -// } +// map[string]interface{}{ +// "name": "alice", +// } // // DecoderConfig has a field that changes the behavior of mapstructure // to always squash embedded structs. // -// Remainder Values +// # Remainder Values // // If there are any unmapped keys in the source value, mapstructure by // default will silently ignore them. You can error by setting ErrorUnused @@ -98,20 +98,20 @@ // probably be a "map[string]interface{}" or "map[interface{}]interface{}". // See example below: // -// type Friend struct { -// Name string -// Other map[string]interface{} `mapstructure:",remain"` -// } +// type Friend struct { +// Name string +// Other map[string]interface{} `mapstructure:",remain"` +// } // // Given the input below, Other would be populated with the other // values that weren't used (everything but "name"): // -// map[string]interface{}{ -// "name": "bob", -// "address": "123 Maple St.", -// } +// map[string]interface{}{ +// "name": "bob", +// "address": "123 Maple St.", +// } // -// Omit Empty Values +// # Omit Empty Values // // When decoding from a struct to any other value, you may use the // ",omitempty" suffix on your tag to omit that value if it equates to @@ -122,37 +122,37 @@ // field value is zero and a numeric type, the field is empty, and it won't // be encoded into the destination type. // -// type Source struct { -// Age int `mapstructure:",omitempty"` -// } +// type Source struct { +// Age int `mapstructure:",omitempty"` +// } // -// Unexported fields +// # Unexported fields // // Since unexported (private) struct fields cannot be set outside the package // where they are defined, the decoder will simply skip them. // // For this output type definition: // -// type Exported struct { -// private string // this unexported field will be skipped -// Public string -// } +// type Exported struct { +// private string // this unexported field will be skipped +// Public string +// } // // Using this map as input: // -// map[string]interface{}{ -// "private": "I will be ignored", -// "Public": "I made it through!", -// } +// map[string]interface{}{ +// "private": "I will be ignored", +// "Public": "I made it through!", +// } // // The following struct will be decoded: // -// type Exported struct { -// private: "" // field is left with an empty string (zero value) -// Public: "I made it through!" -// } +// type Exported struct { +// private: "" // field is left with an empty string (zero value) +// Public: "I made it through!" +// } // -// Other Configuration +// # Other Configuration // // mapstructure is highly configurable. See the DecoderConfig struct // for other features and options that are supported. @@ -160,12 +160,13 @@ package mapstructure import ( "encoding/json" - "errors" "fmt" "reflect" "sort" "strconv" "strings" + + "github.com/go-viper/mapstructure/v2/internal/errors" ) // DecodeHookFunc is the callback function that can be used for @@ -265,6 +266,10 @@ type DecoderConfig struct { // defaults to "mapstructure" TagName string + // The option of the value in the tag that indicates a field should + // be squashed. This defaults to "squash". + SquashTagOption string + // IgnoreUntaggedFields ignores all struct fields without explicit // TagName, comparable to `mapstructure:"-"` as default behaviour. IgnoreUntaggedFields bool @@ -273,6 +278,10 @@ type DecoderConfig struct { // field name or tag. Defaults to `strings.EqualFold`. This can be used // to implement case-sensitive tag values, support snake casing, etc. MatchName func(mapKey, fieldName string) bool + + // DecodeNil, if set to true, will cause the DecodeHook (if present) to run + // even if the input is nil. This can be used to provide default values. + DecodeNil bool } // A Decoder takes a raw interface value and turns it into structured @@ -282,7 +291,8 @@ type DecoderConfig struct { // structure. The top-level Decode method is just a convenience that sets // up the most basic Decoder. type Decoder struct { - config *DecoderConfig + config *DecoderConfig + cachedDecodeHook func(from reflect.Value, to reflect.Value) (interface{}, error) } // Metadata contains information about decoding a structure that @@ -400,6 +410,10 @@ func NewDecoder(config *DecoderConfig) (*Decoder, error) { config.TagName = "mapstructure" } + if config.SquashTagOption == "" { + config.SquashTagOption = "squash" + } + if config.MatchName == nil { config.MatchName = strings.EqualFold } @@ -407,6 +421,9 @@ func NewDecoder(config *DecoderConfig) (*Decoder, error) { result := &Decoder{ config: config, } + if config.DecodeHook != nil { + result.cachedDecodeHook = cachedDecodeHook(config.DecodeHook) + } return result, nil } @@ -414,22 +431,37 @@ func NewDecoder(config *DecoderConfig) (*Decoder, error) { // Decode decodes the given raw interface to the target pointer specified // by the configuration. func (d *Decoder) Decode(input interface{}) error { - return d.decode("", input, reflect.ValueOf(d.config.Result).Elem()) + err := d.decode("", input, reflect.ValueOf(d.config.Result).Elem()) + + // Retain some of the original behavior when multiple errors ocurr + var joinedErr interface{ Unwrap() []error } + if errors.As(err, &joinedErr) { + return fmt.Errorf("decoding failed due to the following error(s):\n\n%w", err) + } + + return err +} + +// isNil returns true if the input is nil or a typed nil pointer. +func isNil(input interface{}) bool { + if input == nil { + return true + } + val := reflect.ValueOf(input) + return val.Kind() == reflect.Ptr && val.IsNil() } // Decodes an unknown data type into a specific reflection value. func (d *Decoder) decode(name string, input interface{}, outVal reflect.Value) error { - var inputVal reflect.Value - if input != nil { - inputVal = reflect.ValueOf(input) - - // We need to check here if input is a typed nil. Typed nils won't - // match the "input == nil" below so we check that here. - if inputVal.Kind() == reflect.Ptr && inputVal.IsNil() { - input = nil - } + var ( + inputVal = reflect.ValueOf(input) + outputKind = getKind(outVal) + decodeNil = d.config.DecodeNil && d.cachedDecodeHook != nil + ) + if isNil(input) { + // Typed nils won't match the "input == nil" below, so reset input. + input = nil } - if input == nil { // If the data is nil, then we don't set anything, unless ZeroFields is set // to true. @@ -440,30 +472,46 @@ func (d *Decoder) decode(name string, input interface{}, outVal reflect.Value) e d.config.Metadata.Keys = append(d.config.Metadata.Keys, name) } } - return nil - } - - if !inputVal.IsValid() { - // If the input value is invalid, then we just set the value - // to be the zero value. - outVal.Set(reflect.Zero(outVal.Type())) - if d.config.Metadata != nil && name != "" { - d.config.Metadata.Keys = append(d.config.Metadata.Keys, name) + if !decodeNil { + return nil + } + } + if !inputVal.IsValid() { + if !decodeNil { + // If the input value is invalid, then we just set the value + // to be the zero value. + outVal.Set(reflect.Zero(outVal.Type())) + if d.config.Metadata != nil && name != "" { + d.config.Metadata.Keys = append(d.config.Metadata.Keys, name) + } + return nil + } + // Hooks need a valid inputVal, so reset it to zero value of outVal type. + switch outputKind { + case reflect.Struct, reflect.Map: + var mapVal map[string]interface{} + inputVal = reflect.ValueOf(mapVal) // create nil map pointer + case reflect.Slice, reflect.Array: + var sliceVal []interface{} + inputVal = reflect.ValueOf(sliceVal) // create nil slice pointer + default: + inputVal = reflect.Zero(outVal.Type()) } - return nil } - if d.config.DecodeHook != nil { + if d.cachedDecodeHook != nil { // We have a DecodeHook, so let's pre-process the input. var err error - input, err = DecodeHookExec(d.config.DecodeHook, inputVal, outVal) + input, err = d.cachedDecodeHook(inputVal, outVal) if err != nil { - return fmt.Errorf("error decoding '%s': %s", name, err) + return fmt.Errorf("error decoding '%s': %w", name, err) } } + if isNil(input) { + return nil + } var err error - outputKind := getKind(outVal) addMetaKey := true switch outputKind { case reflect.Bool: @@ -478,6 +526,8 @@ func (d *Decoder) decode(name string, input interface{}, outVal reflect.Value) e err = d.decodeUint(name, input, outVal) case reflect.Float32: err = d.decodeFloat(name, input, outVal) + case reflect.Complex64: + err = d.decodeComplex(name, input, outVal) case reflect.Struct: err = d.decodeStruct(name, input, outVal) case reflect.Map: @@ -742,8 +792,8 @@ func (d *Decoder) decodeBool(name string, data interface{}, val reflect.Value) e } default: return fmt.Errorf( - "'%s' expected type '%s', got unconvertible type '%s', value: '%v'", - name, val.Type(), dataVal.Type(), data) + "'%s' expected type '%s', got unconvertible type '%#v', value: '%#v'", + name, val, dataVal, data) } return nil @@ -796,6 +846,22 @@ func (d *Decoder) decodeFloat(name string, data interface{}, val reflect.Value) return nil } +func (d *Decoder) decodeComplex(name string, data interface{}, val reflect.Value) error { + dataVal := reflect.Indirect(reflect.ValueOf(data)) + dataKind := getKind(dataVal) + + switch { + case dataKind == reflect.Complex64: + val.SetComplex(dataVal.Complex()) + default: + return fmt.Errorf( + "'%s' expected type '%s', got unconvertible type '%s', value: '%v'", + name, val.Type(), dataVal.Type(), data) + } + + return nil +} + func (d *Decoder) decodeMap(name string, data interface{}, val reflect.Value) error { valType := val.Type() valKeyType := valType.Key() @@ -811,8 +877,14 @@ func (d *Decoder) decodeMap(name string, data interface{}, val reflect.Value) er valMap = reflect.MakeMap(mapType) } + dataVal := reflect.ValueOf(data) + + // Resolve any levels of indirection + for dataVal.Kind() == reflect.Pointer { + dataVal = reflect.Indirect(dataVal) + } + // Check input type and based on the input type jump to the proper func - dataVal := reflect.Indirect(reflect.ValueOf(data)) switch dataVal.Kind() { case reflect.Map: return d.decodeMapFromMap(name, dataVal, val, valMap) @@ -857,7 +929,7 @@ func (d *Decoder) decodeMapFromMap(name string, dataVal reflect.Value, val refle valElemType := valType.Elem() // Accumulate errors - errors := make([]string, 0) + var errs []error // If the input data is empty, then we just match what the input data is. if dataVal.Len() == 0 { @@ -879,7 +951,7 @@ func (d *Decoder) decodeMapFromMap(name string, dataVal reflect.Value, val refle // First decode the key into the proper type currentKey := reflect.Indirect(reflect.New(valKeyType)) if err := d.decode(fieldName, k.Interface(), currentKey); err != nil { - errors = appendErrors(errors, err) + errs = append(errs, err) continue } @@ -887,7 +959,7 @@ func (d *Decoder) decodeMapFromMap(name string, dataVal reflect.Value, val refle v := dataVal.MapIndex(k).Interface() currentVal := reflect.Indirect(reflect.New(valElemType)) if err := d.decode(fieldName, v, currentVal); err != nil { - errors = appendErrors(errors, err) + errs = append(errs, err) continue } @@ -897,12 +969,7 @@ func (d *Decoder) decodeMapFromMap(name string, dataVal reflect.Value, val refle // Set the built up map to the value val.Set(valMap) - // If we had errors, return those - if len(errors) > 0 { - return &Error{errors} - } - - return nil + return errors.Join(errs...) } func (d *Decoder) decodeMapFromStruct(name string, dataVal reflect.Value, val reflect.Value, valMap reflect.Value) error { @@ -945,7 +1012,7 @@ func (d *Decoder) decodeMapFromStruct(name string, dataVal reflect.Value, val re } // If "squash" is specified in the tag, we squash the field down. - squash = squash || strings.Index(tagValue[index+1:], "squash") != -1 + squash = squash || strings.Contains(tagValue[index+1:], d.config.SquashTagOption) if squash { // When squashing, the embedded type can be a pointer to a struct. if v.Kind() == reflect.Ptr && v.Elem().Kind() == reflect.Struct { @@ -956,6 +1023,18 @@ func (d *Decoder) decodeMapFromStruct(name string, dataVal reflect.Value, val re if v.Kind() != reflect.Struct { return fmt.Errorf("cannot squash non-struct type '%s'", v.Type()) } + } else { + if strings.Index(tagValue[index+1:], "remain") != -1 { + if v.Kind() != reflect.Map { + return fmt.Errorf("error remain-tag field with invalid type: '%s'", v.Type()) + } + + ptr := v.MapRange() + for ptr.Next() { + valMap.SetMapIndex(ptr.Key(), ptr.Value()) + } + continue + } } if keyNameTagValue := tagValue[:index]; keyNameTagValue != "" { keyName = keyNameTagValue @@ -1123,10 +1202,12 @@ func (d *Decoder) decodeSlice(name string, data interface{}, val reflect.Value) if valSlice.IsNil() || d.config.ZeroFields { // Make a new slice to hold our result, same size as the original data. valSlice = reflect.MakeSlice(sliceType, dataVal.Len(), dataVal.Len()) + } else if valSlice.Len() > dataVal.Len() { + valSlice = valSlice.Slice(0, dataVal.Len()) } // Accumulate any errors - errors := make([]string, 0) + var errs []error for i := 0; i < dataVal.Len(); i++ { currentData := dataVal.Index(i).Interface() @@ -1137,19 +1218,14 @@ func (d *Decoder) decodeSlice(name string, data interface{}, val reflect.Value) fieldName := name + "[" + strconv.Itoa(i) + "]" if err := d.decode(fieldName, currentData, currentField); err != nil { - errors = appendErrors(errors, err) + errs = append(errs, err) } } // Finally, set the value to the slice we built up val.Set(valSlice) - // If there were errors, we return those - if len(errors) > 0 { - return &Error{errors} - } - - return nil + return errors.Join(errs...) } func (d *Decoder) decodeArray(name string, data interface{}, val reflect.Value) error { @@ -1161,7 +1237,7 @@ func (d *Decoder) decodeArray(name string, data interface{}, val reflect.Value) valArray := val - if valArray.Interface() == reflect.Zero(valArray.Type()).Interface() || d.config.ZeroFields { + if isComparable(valArray) && valArray.Interface() == reflect.Zero(valArray.Type()).Interface() || d.config.ZeroFields { // Check input type if dataValKind != reflect.Array && dataValKind != reflect.Slice { if d.config.WeaklyTypedInput { @@ -1188,7 +1264,6 @@ func (d *Decoder) decodeArray(name string, data interface{}, val reflect.Value) if dataVal.Len() > arrayType.Len() { return fmt.Errorf( "'%s': expected source data to have length less or equal to %d, got %d", name, arrayType.Len(), dataVal.Len()) - } // Make a new array to hold our result, same size as the original data. @@ -1196,7 +1271,7 @@ func (d *Decoder) decodeArray(name string, data interface{}, val reflect.Value) } // Accumulate any errors - errors := make([]string, 0) + var errs []error for i := 0; i < dataVal.Len(); i++ { currentData := dataVal.Index(i).Interface() @@ -1204,19 +1279,14 @@ func (d *Decoder) decodeArray(name string, data interface{}, val reflect.Value) fieldName := name + "[" + strconv.Itoa(i) + "]" if err := d.decode(fieldName, currentData, currentField); err != nil { - errors = appendErrors(errors, err) + errs = append(errs, err) } } // Finally, set the value to the array we built up val.Set(valArray) - // If there were errors, we return those - if len(errors) > 0 { - return &Error{errors} - } - - return nil + return errors.Join(errs...) } func (d *Decoder) decodeStruct(name string, data interface{}, val reflect.Value) error { @@ -1278,7 +1348,8 @@ func (d *Decoder) decodeStructFromMap(name string, dataVal, val reflect.Value) e } targetValKeysUnused := make(map[interface{}]struct{}) - errors := make([]string, 0) + + var errs []error // This slice will keep track of all the structs we'll be decoding. // There can be more than one struct if there are embedded structs @@ -1319,7 +1390,7 @@ func (d *Decoder) decodeStructFromMap(name string, dataVal, val reflect.Value) e // We always parse the tags cause we're looking for other tags too tagParts := strings.Split(fieldType.Tag.Get(d.config.TagName), ",") for _, tag := range tagParts[1:] { - if tag == "squash" { + if tag == d.config.SquashTagOption { squash = true break } @@ -1331,11 +1402,15 @@ func (d *Decoder) decodeStructFromMap(name string, dataVal, val reflect.Value) e } if squash { - if fieldVal.Kind() != reflect.Struct { - errors = appendErrors(errors, - fmt.Errorf("%s: unsupported type for squash: %s", fieldType.Name, fieldVal.Kind())) - } else { + switch fieldVal.Kind() { + case reflect.Struct: structs = append(structs, fieldVal) + case reflect.Interface: + if !fieldVal.IsNil() { + structs = append(structs, fieldVal.Elem().Elem()) + } + default: + errs = append(errs, fmt.Errorf("%s: unsupported type for squash: %s", fieldType.Name, fieldVal.Kind())) } continue } @@ -1356,6 +1431,9 @@ func (d *Decoder) decodeStructFromMap(name string, dataVal, val reflect.Value) e fieldName := field.Name tagValue := field.Tag.Get(d.config.TagName) + if tagValue == "" && d.config.IgnoreUntaggedFields { + continue + } tagValue = strings.SplitN(tagValue, ",", 2)[0] if tagValue != "" { fieldName = tagValue @@ -1409,7 +1487,7 @@ func (d *Decoder) decodeStructFromMap(name string, dataVal, val reflect.Value) e } if err := d.decode(fieldName, rawMapVal.Interface(), fieldValue); err != nil { - errors = appendErrors(errors, err) + errs = append(errs, err) } } @@ -1424,7 +1502,7 @@ func (d *Decoder) decodeStructFromMap(name string, dataVal, val reflect.Value) e // Decode it as-if we were just decoding this map onto our map. if err := d.decodeMap(name, remain, remainField.val); err != nil { - errors = appendErrors(errors, err) + errs = append(errs, err) } // Set the map to nil so we have none so that the next check will @@ -1440,7 +1518,7 @@ func (d *Decoder) decodeStructFromMap(name string, dataVal, val reflect.Value) e sort.Strings(keys) err := fmt.Errorf("'%s' has invalid keys: %s", name, strings.Join(keys, ", ")) - errors = appendErrors(errors, err) + errs = append(errs, err) } if d.config.ErrorUnset && len(targetValKeysUnused) > 0 { @@ -1451,11 +1529,11 @@ func (d *Decoder) decodeStructFromMap(name string, dataVal, val reflect.Value) e sort.Strings(keys) err := fmt.Errorf("'%s' has unset fields: %s", name, strings.Join(keys, ", ")) - errors = appendErrors(errors, err) + errs = append(errs, err) } - if len(errors) > 0 { - return &Error{errors} + if err := errors.Join(errs...); err != nil { + return err } // Add the unused keys to the list of unused keys if we're tracking metadata @@ -1509,6 +1587,8 @@ func getKind(val reflect.Value) reflect.Kind { return reflect.Uint case kind >= reflect.Float32 && kind <= reflect.Float64: return reflect.Float32 + case kind >= reflect.Complex64 && kind <= reflect.Complex128: + return reflect.Complex64 default: return kind } diff --git a/vendor/github.com/go-viper/mapstructure/v2/reflect_go1_19.go b/vendor/github.com/go-viper/mapstructure/v2/reflect_go1_19.go new file mode 100644 index 00000000..d0913fff --- /dev/null +++ b/vendor/github.com/go-viper/mapstructure/v2/reflect_go1_19.go @@ -0,0 +1,44 @@ +//go:build !go1.20 + +package mapstructure + +import "reflect" + +func isComparable(v reflect.Value) bool { + k := v.Kind() + switch k { + case reflect.Invalid: + return false + + case reflect.Array: + switch v.Type().Elem().Kind() { + case reflect.Interface, reflect.Array, reflect.Struct: + for i := 0; i < v.Type().Len(); i++ { + // if !v.Index(i).Comparable() { + if !isComparable(v.Index(i)) { + return false + } + } + return true + } + return v.Type().Comparable() + + case reflect.Interface: + // return v.Elem().Comparable() + return isComparable(v.Elem()) + + case reflect.Struct: + for i := 0; i < v.NumField(); i++ { + return false + + // if !v.Field(i).Comparable() { + if !isComparable(v.Field(i)) { + return false + } + } + return true + + default: + return v.Type().Comparable() + } +} diff --git a/vendor/github.com/go-viper/mapstructure/v2/reflect_go1_20.go b/vendor/github.com/go-viper/mapstructure/v2/reflect_go1_20.go new file mode 100644 index 00000000..f8255a1b --- /dev/null +++ b/vendor/github.com/go-viper/mapstructure/v2/reflect_go1_20.go @@ -0,0 +1,10 @@ +//go:build go1.20 + +package mapstructure + +import "reflect" + +// TODO: remove once we drop support for Go <1.20 +func isComparable(v reflect.Value) bool { + return v.Comparable() +} diff --git a/vendor/github.com/goccy/go-json/internal/decoder/compile.go b/vendor/github.com/goccy/go-json/internal/decoder/compile.go index fab64376..8ad50936 100644 --- a/vendor/github.com/goccy/go-json/internal/decoder/compile.go +++ b/vendor/github.com/goccy/go-json/internal/decoder/compile.go @@ -5,6 +5,7 @@ import ( "fmt" "reflect" "strings" + "sync" "sync/atomic" "unicode" "unsafe" @@ -17,22 +18,27 @@ var ( typeAddr *runtime.TypeAddr cachedDecoderMap unsafe.Pointer // map[uintptr]decoder cachedDecoder []Decoder + initOnce sync.Once ) -func init() { - typeAddr = runtime.AnalyzeTypeAddr() - if typeAddr == nil { - typeAddr = &runtime.TypeAddr{} - } - cachedDecoder = make([]Decoder, typeAddr.AddrRange>>typeAddr.AddrShift+1) +func initDecoder() { + initOnce.Do(func() { + typeAddr = runtime.AnalyzeTypeAddr() + if typeAddr == nil { + typeAddr = &runtime.TypeAddr{} + } + cachedDecoder = make([]Decoder, typeAddr.AddrRange>>typeAddr.AddrShift+1) + }) } func loadDecoderMap() map[uintptr]Decoder { + initDecoder() p := atomic.LoadPointer(&cachedDecoderMap) return *(*map[uintptr]Decoder)(unsafe.Pointer(&p)) } func storeDecoder(typ uintptr, dec Decoder, m map[uintptr]Decoder) { + initDecoder() newDecoderMap := make(map[uintptr]Decoder, len(m)+1) newDecoderMap[typ] = dec diff --git a/vendor/github.com/goccy/go-json/internal/decoder/compile_norace.go b/vendor/github.com/goccy/go-json/internal/decoder/compile_norace.go index eb7e2b13..025ca85b 100644 --- a/vendor/github.com/goccy/go-json/internal/decoder/compile_norace.go +++ b/vendor/github.com/goccy/go-json/internal/decoder/compile_norace.go @@ -10,6 +10,7 @@ import ( ) func CompileToGetDecoder(typ *runtime.Type) (Decoder, error) { + initDecoder() typeptr := uintptr(unsafe.Pointer(typ)) if typeptr > typeAddr.MaxTypeAddr { return compileToGetDecoderSlowPath(typeptr, typ) diff --git a/vendor/github.com/goccy/go-json/internal/decoder/compile_race.go b/vendor/github.com/goccy/go-json/internal/decoder/compile_race.go index 49cdda4a..023b817c 100644 --- a/vendor/github.com/goccy/go-json/internal/decoder/compile_race.go +++ b/vendor/github.com/goccy/go-json/internal/decoder/compile_race.go @@ -13,6 +13,7 @@ import ( var decMu sync.RWMutex func CompileToGetDecoder(typ *runtime.Type) (Decoder, error) { + initDecoder() typeptr := uintptr(unsafe.Pointer(typ)) if typeptr > typeAddr.MaxTypeAddr { return compileToGetDecoderSlowPath(typeptr, typ) diff --git a/vendor/github.com/goccy/go-json/internal/encoder/compiler.go b/vendor/github.com/goccy/go-json/internal/encoder/compiler.go index 37b7aa38..b1076368 100644 --- a/vendor/github.com/goccy/go-json/internal/encoder/compiler.go +++ b/vendor/github.com/goccy/go-json/internal/encoder/compiler.go @@ -5,6 +5,7 @@ import ( "encoding" "encoding/json" "reflect" + "sync" "sync/atomic" "unsafe" @@ -24,14 +25,17 @@ var ( cachedOpcodeSets []*OpcodeSet cachedOpcodeMap unsafe.Pointer // map[uintptr]*OpcodeSet typeAddr *runtime.TypeAddr + initEncoderOnce sync.Once ) -func init() { - typeAddr = runtime.AnalyzeTypeAddr() - if typeAddr == nil { - typeAddr = &runtime.TypeAddr{} - } - cachedOpcodeSets = make([]*OpcodeSet, typeAddr.AddrRange>>typeAddr.AddrShift+1) +func initEncoder() { + initEncoderOnce.Do(func() { + typeAddr = runtime.AnalyzeTypeAddr() + if typeAddr == nil { + typeAddr = &runtime.TypeAddr{} + } + cachedOpcodeSets = make([]*OpcodeSet, typeAddr.AddrRange>>typeAddr.AddrShift+1) + }) } func loadOpcodeMap() map[uintptr]*OpcodeSet { diff --git a/vendor/github.com/goccy/go-json/internal/encoder/compiler_norace.go b/vendor/github.com/goccy/go-json/internal/encoder/compiler_norace.go index 20c93cbf..b6f45a49 100644 --- a/vendor/github.com/goccy/go-json/internal/encoder/compiler_norace.go +++ b/vendor/github.com/goccy/go-json/internal/encoder/compiler_norace.go @@ -4,6 +4,7 @@ package encoder func CompileToGetCodeSet(ctx *RuntimeContext, typeptr uintptr) (*OpcodeSet, error) { + initEncoder() if typeptr > typeAddr.MaxTypeAddr || typeptr < typeAddr.BaseTypeAddr { codeSet, err := compileToGetCodeSetSlowPath(typeptr) if err != nil { diff --git a/vendor/github.com/goccy/go-json/internal/encoder/compiler_race.go b/vendor/github.com/goccy/go-json/internal/encoder/compiler_race.go index 13ba23fd..47b482f7 100644 --- a/vendor/github.com/goccy/go-json/internal/encoder/compiler_race.go +++ b/vendor/github.com/goccy/go-json/internal/encoder/compiler_race.go @@ -10,6 +10,7 @@ import ( var setsMu sync.RWMutex func CompileToGetCodeSet(ctx *RuntimeContext, typeptr uintptr) (*OpcodeSet, error) { + initEncoder() if typeptr > typeAddr.MaxTypeAddr || typeptr < typeAddr.BaseTypeAddr { codeSet, err := compileToGetCodeSetSlowPath(typeptr) if err != nil { diff --git a/vendor/github.com/goccy/go-json/internal/encoder/encoder.go b/vendor/github.com/goccy/go-json/internal/encoder/encoder.go index 14eb6a0d..b436f5b2 100644 --- a/vendor/github.com/goccy/go-json/internal/encoder/encoder.go +++ b/vendor/github.com/goccy/go-json/internal/encoder/encoder.go @@ -406,6 +406,11 @@ func AppendMarshalJSON(ctx *RuntimeContext, code *Opcode, b []byte, v interface{ rv = newV } } + + if rv.Kind() == reflect.Ptr && rv.IsNil() { + return AppendNull(ctx, b), nil + } + v = rv.Interface() var bb []byte if (code.Flags & MarshalerContextFlags) != 0 { diff --git a/vendor/github.com/golang-jwt/jwt/.gitignore b/vendor/github.com/golang-jwt/jwt/.gitignore deleted file mode 100644 index 09573e01..00000000 --- a/vendor/github.com/golang-jwt/jwt/.gitignore +++ /dev/null @@ -1,4 +0,0 @@ -.DS_Store -bin -.idea/ - diff --git a/vendor/github.com/golang-jwt/jwt/LICENSE b/vendor/github.com/golang-jwt/jwt/LICENSE deleted file mode 100644 index 35dbc252..00000000 --- a/vendor/github.com/golang-jwt/jwt/LICENSE +++ /dev/null @@ -1,9 +0,0 @@ -Copyright (c) 2012 Dave Grijalva -Copyright (c) 2021 golang-jwt maintainers - -Permission is hereby granted, free of charge, to any person obtaining a copy of this software and associated documentation files (the "Software"), to deal in the Software without restriction, including without limitation the rights to use, copy, modify, merge, publish, distribute, sublicense, and/or sell copies of the Software, and to permit persons to whom the Software is furnished to do so, subject to the following conditions: - -The above copyright notice and this permission notice shall be included in all copies or substantial portions of the Software. - -THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. - diff --git a/vendor/github.com/golang-jwt/jwt/MIGRATION_GUIDE.md b/vendor/github.com/golang-jwt/jwt/MIGRATION_GUIDE.md deleted file mode 100644 index c4efbd2a..00000000 --- a/vendor/github.com/golang-jwt/jwt/MIGRATION_GUIDE.md +++ /dev/null @@ -1,22 +0,0 @@ -## Migration Guide (v3.2.1) - -Starting from [v3.2.1](https://github.com/golang-jwt/jwt/releases/tag/v3.2.1]), the import path has changed from `github.com/dgrijalva/jwt-go` to `github.com/golang-jwt/jwt`. Future releases will be using the `github.com/golang-jwt/jwt` import path and continue the existing versioning scheme of `v3.x.x+incompatible`. Backwards-compatible patches and fixes will be done on the `v3` release branch, where as new build-breaking features will be developed in a `v4` release, possibly including a SIV-style import path. - -### go.mod replacement - -In a first step, the easiest way is to use `go mod edit` to issue a replacement. - -``` -go mod edit -replace github.com/dgrijalva/jwt-go=github.com/golang-jwt/jwt@v3.2.1+incompatible -go mod tidy -``` - -This will still keep the old import path in your code but replace it with the new package and also introduce a new indirect dependency to `github.com/golang-jwt/jwt`. Try to compile your project; it should still work. - -### Cleanup - -If your code still consistently builds, you can replace all occurences of `github.com/dgrijalva/jwt-go` with `github.com/golang-jwt/jwt`, either manually or by using tools such as `sed`. Finally, the `replace` directive in the `go.mod` file can be removed. - -## Older releases (before v3.2.0) - -The original migration guide for older releases can be found at https://github.com/dgrijalva/jwt-go/blob/master/MIGRATION_GUIDE.md. \ No newline at end of file diff --git a/vendor/github.com/golang-jwt/jwt/README.md b/vendor/github.com/golang-jwt/jwt/README.md deleted file mode 100644 index 9b653e46..00000000 --- a/vendor/github.com/golang-jwt/jwt/README.md +++ /dev/null @@ -1,113 +0,0 @@ -# jwt-go - -[![build](https://github.com/golang-jwt/jwt/actions/workflows/build.yml/badge.svg)](https://github.com/golang-jwt/jwt/actions/workflows/build.yml) -[![Go Reference](https://pkg.go.dev/badge/github.com/golang-jwt/jwt.svg)](https://pkg.go.dev/github.com/golang-jwt/jwt) - -A [go](http://www.golang.org) (or 'golang' for search engine friendliness) implementation of [JSON Web Tokens](https://datatracker.ietf.org/doc/html/rfc7519). - -**IMPORT PATH CHANGE:** Starting from [v3.2.1](https://github.com/golang-jwt/jwt/releases/tag/v3.2.1), the import path has changed from `github.com/dgrijalva/jwt-go` to `github.com/golang-jwt/jwt`. After the original author of the library suggested migrating the maintenance of `jwt-go`, a dedicated team of open source maintainers decided to clone the existing library into this repository. See [dgrijalva/jwt-go#462](https://github.com/dgrijalva/jwt-go/issues/462) for a detailed discussion on this topic. - -Future releases will be using the `github.com/golang-jwt/jwt` import path and continue the existing versioning scheme of `v3.x.x+incompatible`. Backwards-compatible patches and fixes will be done on the `v3` release branch, where as new build-breaking features will be developed in a `v4` release, possibly including a SIV-style import path. - -**SECURITY NOTICE:** Some older versions of Go have a security issue in the crypto/elliptic. Recommendation is to upgrade to at least 1.15 See issue [dgrijalva/jwt-go#216](https://github.com/dgrijalva/jwt-go/issues/216) for more detail. - -**SECURITY NOTICE:** It's important that you [validate the `alg` presented is what you expect](https://auth0.com/blog/critical-vulnerabilities-in-json-web-token-libraries/). This library attempts to make it easy to do the right thing by requiring key types match the expected alg, but you should take the extra step to verify it in your usage. See the examples provided. - -### Supported Go versions - -Our support of Go versions is aligned with Go's [version release policy](https://golang.org/doc/devel/release#policy). -So we will support a major version of Go until there are two newer major releases. -We no longer support building jwt-go with unsupported Go versions, as these contain security vulnerabilities -which will not be fixed. - -## What the heck is a JWT? - -JWT.io has [a great introduction](https://jwt.io/introduction) to JSON Web Tokens. - -In short, it's a signed JSON object that does something useful (for example, authentication). It's commonly used for `Bearer` tokens in Oauth 2. A token is made of three parts, separated by `.`'s. The first two parts are JSON objects, that have been [base64url](https://datatracker.ietf.org/doc/html/rfc4648) encoded. The last part is the signature, encoded the same way. - -The first part is called the header. It contains the necessary information for verifying the last part, the signature. For example, which encryption method was used for signing and what key was used. - -The part in the middle is the interesting bit. It's called the Claims and contains the actual stuff you care about. Refer to [RFC 7519](https://datatracker.ietf.org/doc/html/rfc7519) for information about reserved keys and the proper way to add your own. - -## What's in the box? - -This library supports the parsing and verification as well as the generation and signing of JWTs. Current supported signing algorithms are HMAC SHA, RSA, RSA-PSS, and ECDSA, though hooks are present for adding your own. - -## Examples - -See [the project documentation](https://pkg.go.dev/github.com/golang-jwt/jwt) for examples of usage: - -* [Simple example of parsing and validating a token](https://pkg.go.dev/github.com/golang-jwt/jwt#example-Parse-Hmac) -* [Simple example of building and signing a token](https://pkg.go.dev/github.com/golang-jwt/jwt#example-New-Hmac) -* [Directory of Examples](https://pkg.go.dev/github.com/golang-jwt/jwt#pkg-examples) - -## Extensions - -This library publishes all the necessary components for adding your own signing methods. Simply implement the `SigningMethod` interface and register a factory method using `RegisterSigningMethod`. - -Here's an example of an extension that integrates with multiple Google Cloud Platform signing tools (AppEngine, IAM API, Cloud KMS): https://github.com/someone1/gcp-jwt-go - -## Compliance - -This library was last reviewed to comply with [RTF 7519](https://datatracker.ietf.org/doc/html/rfc7519) dated May 2015 with a few notable differences: - -* In order to protect against accidental use of [Unsecured JWTs](https://datatracker.ietf.org/doc/html/rfc7519#section-6), tokens using `alg=none` will only be accepted if the constant `jwt.UnsafeAllowNoneSignatureType` is provided as the key. - -## Project Status & Versioning - -This library is considered production ready. Feedback and feature requests are appreciated. The API should be considered stable. There should be very few backwards-incompatible changes outside of major version updates (and only with good reason). - -This project uses [Semantic Versioning 2.0.0](http://semver.org). Accepted pull requests will land on `main`. Periodically, versions will be tagged from `main`. You can find all the releases on [the project releases page](https://github.com/golang-jwt/jwt/releases). - -While we try to make it obvious when we make breaking changes, there isn't a great mechanism for pushing announcements out to users. You may want to use this alternative package include: `gopkg.in/golang-jwt/jwt.v3`. It will do the right thing WRT semantic versioning. - -**BREAKING CHANGES:*** -* Version 3.0.0 includes _a lot_ of changes from the 2.x line, including a few that break the API. We've tried to break as few things as possible, so there should just be a few type signature changes. A full list of breaking changes is available in `VERSION_HISTORY.md`. See `MIGRATION_GUIDE.md` for more information on updating your code. - -## Usage Tips - -### Signing vs Encryption - -A token is simply a JSON object that is signed by its author. this tells you exactly two things about the data: - -* The author of the token was in the possession of the signing secret -* The data has not been modified since it was signed - -It's important to know that JWT does not provide encryption, which means anyone who has access to the token can read its contents. If you need to protect (encrypt) the data, there is a companion spec, `JWE`, that provides this functionality. JWE is currently outside the scope of this library. - -### Choosing a Signing Method - -There are several signing methods available, and you should probably take the time to learn about the various options before choosing one. The principal design decision is most likely going to be symmetric vs asymmetric. - -Symmetric signing methods, such as HSA, use only a single secret. This is probably the simplest signing method to use since any `[]byte` can be used as a valid secret. They are also slightly computationally faster to use, though this rarely is enough to matter. Symmetric signing methods work the best when both producers and consumers of tokens are trusted, or even the same system. Since the same secret is used to both sign and validate tokens, you can't easily distribute the key for validation. - -Asymmetric signing methods, such as RSA, use different keys for signing and verifying tokens. This makes it possible to produce tokens with a private key, and allow any consumer to access the public key for verification. - -### Signing Methods and Key Types - -Each signing method expects a different object type for its signing keys. See the package documentation for details. Here are the most common ones: - -* The [HMAC signing method](https://pkg.go.dev/github.com/golang-jwt/jwt#SigningMethodHMAC) (`HS256`,`HS384`,`HS512`) expect `[]byte` values for signing and validation -* The [RSA signing method](https://pkg.go.dev/github.com/golang-jwt/jwt#SigningMethodRSA) (`RS256`,`RS384`,`RS512`) expect `*rsa.PrivateKey` for signing and `*rsa.PublicKey` for validation -* The [ECDSA signing method](https://pkg.go.dev/github.com/golang-jwt/jwt#SigningMethodECDSA) (`ES256`,`ES384`,`ES512`) expect `*ecdsa.PrivateKey` for signing and `*ecdsa.PublicKey` for validation - -### JWT and OAuth - -It's worth mentioning that OAuth and JWT are not the same thing. A JWT token is simply a signed JSON object. It can be used anywhere such a thing is useful. There is some confusion, though, as JWT is the most common type of bearer token used in OAuth2 authentication. - -Without going too far down the rabbit hole, here's a description of the interaction of these technologies: - -* OAuth is a protocol for allowing an identity provider to be separate from the service a user is logging in to. For example, whenever you use Facebook to log into a different service (Yelp, Spotify, etc), you are using OAuth. -* OAuth defines several options for passing around authentication data. One popular method is called a "bearer token". A bearer token is simply a string that _should_ only be held by an authenticated user. Thus, simply presenting this token proves your identity. You can probably derive from here why a JWT might make a good bearer token. -* Because bearer tokens are used for authentication, it's important they're kept secret. This is why transactions that use bearer tokens typically happen over SSL. - -### Troubleshooting - -This library uses descriptive error messages whenever possible. If you are not getting the expected result, have a look at the errors. The most common place people get stuck is providing the correct type of key to the parser. See the above section on signing methods and key types. - -## More - -Documentation can be found [on pkg.go.dev](https://pkg.go.dev/github.com/golang-jwt/jwt). - -The command line utility included in this project (cmd/jwt) provides a straightforward example of token creation and parsing as well as a useful tool for debugging your own integration. You'll also find several implementation examples in the documentation. diff --git a/vendor/github.com/golang-jwt/jwt/VERSION_HISTORY.md b/vendor/github.com/golang-jwt/jwt/VERSION_HISTORY.md deleted file mode 100644 index 637f2ba6..00000000 --- a/vendor/github.com/golang-jwt/jwt/VERSION_HISTORY.md +++ /dev/null @@ -1,131 +0,0 @@ -## `jwt-go` Version History - -#### 3.2.2 - -* Starting from this release, we are adopting the policy to support the most 2 recent versions of Go currently available. By the time of this release, this is Go 1.15 and 1.16 ([#28](https://github.com/golang-jwt/jwt/pull/28)). -* Fixed a potential issue that could occur when the verification of `exp`, `iat` or `nbf` was not required and contained invalid contents, i.e. non-numeric/date. Thanks for @thaJeztah for making us aware of that and @giorgos-f3 for originally reporting it to the formtech fork ([#40](https://github.com/golang-jwt/jwt/pull/40)). -* Added support for EdDSA / ED25519 ([#36](https://github.com/golang-jwt/jwt/pull/36)). -* Optimized allocations ([#33](https://github.com/golang-jwt/jwt/pull/33)). - -#### 3.2.1 - -* **Import Path Change**: See MIGRATION_GUIDE.md for tips on updating your code - * Changed the import path from `github.com/dgrijalva/jwt-go` to `github.com/golang-jwt/jwt` -* Fixed type confusing issue between `string` and `[]string` in `VerifyAudience` ([#12](https://github.com/golang-jwt/jwt/pull/12)). This fixes CVE-2020-26160 - -#### 3.2.0 - -* Added method `ParseUnverified` to allow users to split up the tasks of parsing and validation -* HMAC signing method returns `ErrInvalidKeyType` instead of `ErrInvalidKey` where appropriate -* Added options to `request.ParseFromRequest`, which allows for an arbitrary list of modifiers to parsing behavior. Initial set include `WithClaims` and `WithParser`. Existing usage of this function will continue to work as before. -* Deprecated `ParseFromRequestWithClaims` to simplify API in the future. - -#### 3.1.0 - -* Improvements to `jwt` command line tool -* Added `SkipClaimsValidation` option to `Parser` -* Documentation updates - -#### 3.0.0 - -* **Compatibility Breaking Changes**: See MIGRATION_GUIDE.md for tips on updating your code - * Dropped support for `[]byte` keys when using RSA signing methods. This convenience feature could contribute to security vulnerabilities involving mismatched key types with signing methods. - * `ParseFromRequest` has been moved to `request` subpackage and usage has changed - * The `Claims` property on `Token` is now type `Claims` instead of `map[string]interface{}`. The default value is type `MapClaims`, which is an alias to `map[string]interface{}`. This makes it possible to use a custom type when decoding claims. -* Other Additions and Changes - * Added `Claims` interface type to allow users to decode the claims into a custom type - * Added `ParseWithClaims`, which takes a third argument of type `Claims`. Use this function instead of `Parse` if you have a custom type you'd like to decode into. - * Dramatically improved the functionality and flexibility of `ParseFromRequest`, which is now in the `request` subpackage - * Added `ParseFromRequestWithClaims` which is the `FromRequest` equivalent of `ParseWithClaims` - * Added new interface type `Extractor`, which is used for extracting JWT strings from http requests. Used with `ParseFromRequest` and `ParseFromRequestWithClaims`. - * Added several new, more specific, validation errors to error type bitmask - * Moved examples from README to executable example files - * Signing method registry is now thread safe - * Added new property to `ValidationError`, which contains the raw error returned by calls made by parse/verify (such as those returned by keyfunc or json parser) - -#### 2.7.0 - -This will likely be the last backwards compatible release before 3.0.0, excluding essential bug fixes. - -* Added new option `-show` to the `jwt` command that will just output the decoded token without verifying -* Error text for expired tokens includes how long it's been expired -* Fixed incorrect error returned from `ParseRSAPublicKeyFromPEM` -* Documentation updates - -#### 2.6.0 - -* Exposed inner error within ValidationError -* Fixed validation errors when using UseJSONNumber flag -* Added several unit tests - -#### 2.5.0 - -* Added support for signing method none. You shouldn't use this. The API tries to make this clear. -* Updated/fixed some documentation -* Added more helpful error message when trying to parse tokens that begin with `BEARER ` - -#### 2.4.0 - -* Added new type, Parser, to allow for configuration of various parsing parameters - * You can now specify a list of valid signing methods. Anything outside this set will be rejected. - * You can now opt to use the `json.Number` type instead of `float64` when parsing token JSON -* Added support for [Travis CI](https://travis-ci.org/dgrijalva/jwt-go) -* Fixed some bugs with ECDSA parsing - -#### 2.3.0 - -* Added support for ECDSA signing methods -* Added support for RSA PSS signing methods (requires go v1.4) - -#### 2.2.0 - -* Gracefully handle a `nil` `Keyfunc` being passed to `Parse`. Result will now be the parsed token and an error, instead of a panic. - -#### 2.1.0 - -Backwards compatible API change that was missed in 2.0.0. - -* The `SignedString` method on `Token` now takes `interface{}` instead of `[]byte` - -#### 2.0.0 - -There were two major reasons for breaking backwards compatibility with this update. The first was a refactor required to expand the width of the RSA and HMAC-SHA signing implementations. There will likely be no required code changes to support this change. - -The second update, while unfortunately requiring a small change in integration, is required to open up this library to other signing methods. Not all keys used for all signing methods have a single standard on-disk representation. Requiring `[]byte` as the type for all keys proved too limiting. Additionally, this implementation allows for pre-parsed tokens to be reused, which might matter in an application that parses a high volume of tokens with a small set of keys. Backwards compatibilty has been maintained for passing `[]byte` to the RSA signing methods, but they will also accept `*rsa.PublicKey` and `*rsa.PrivateKey`. - -It is likely the only integration change required here will be to change `func(t *jwt.Token) ([]byte, error)` to `func(t *jwt.Token) (interface{}, error)` when calling `Parse`. - -* **Compatibility Breaking Changes** - * `SigningMethodHS256` is now `*SigningMethodHMAC` instead of `type struct` - * `SigningMethodRS256` is now `*SigningMethodRSA` instead of `type struct` - * `KeyFunc` now returns `interface{}` instead of `[]byte` - * `SigningMethod.Sign` now takes `interface{}` instead of `[]byte` for the key - * `SigningMethod.Verify` now takes `interface{}` instead of `[]byte` for the key -* Renamed type `SigningMethodHS256` to `SigningMethodHMAC`. Specific sizes are now just instances of this type. - * Added public package global `SigningMethodHS256` - * Added public package global `SigningMethodHS384` - * Added public package global `SigningMethodHS512` -* Renamed type `SigningMethodRS256` to `SigningMethodRSA`. Specific sizes are now just instances of this type. - * Added public package global `SigningMethodRS256` - * Added public package global `SigningMethodRS384` - * Added public package global `SigningMethodRS512` -* Moved sample private key for HMAC tests from an inline value to a file on disk. Value is unchanged. -* Refactored the RSA implementation to be easier to read -* Exposed helper methods `ParseRSAPrivateKeyFromPEM` and `ParseRSAPublicKeyFromPEM` - -#### 1.0.2 - -* Fixed bug in parsing public keys from certificates -* Added more tests around the parsing of keys for RS256 -* Code refactoring in RS256 implementation. No functional changes - -#### 1.0.1 - -* Fixed panic if RS256 signing method was passed an invalid key - -#### 1.0.0 - -* First versioned release -* API stabilized -* Supports creating, signing, parsing, and validating JWT tokens -* Supports RS256 and HS256 signing methods diff --git a/vendor/github.com/golang-jwt/jwt/claims.go b/vendor/github.com/golang-jwt/jwt/claims.go deleted file mode 100644 index f1dba3cb..00000000 --- a/vendor/github.com/golang-jwt/jwt/claims.go +++ /dev/null @@ -1,146 +0,0 @@ -package jwt - -import ( - "crypto/subtle" - "fmt" - "time" -) - -// For a type to be a Claims object, it must just have a Valid method that determines -// if the token is invalid for any supported reason -type Claims interface { - Valid() error -} - -// Structured version of Claims Section, as referenced at -// https://tools.ietf.org/html/rfc7519#section-4.1 -// See examples for how to use this with your own claim types -type StandardClaims struct { - Audience string `json:"aud,omitempty"` - ExpiresAt int64 `json:"exp,omitempty"` - Id string `json:"jti,omitempty"` - IssuedAt int64 `json:"iat,omitempty"` - Issuer string `json:"iss,omitempty"` - NotBefore int64 `json:"nbf,omitempty"` - Subject string `json:"sub,omitempty"` -} - -// Validates time based claims "exp, iat, nbf". -// There is no accounting for clock skew. -// As well, if any of the above claims are not in the token, it will still -// be considered a valid claim. -func (c StandardClaims) Valid() error { - vErr := new(ValidationError) - now := TimeFunc().Unix() - - // The claims below are optional, by default, so if they are set to the - // default value in Go, let's not fail the verification for them. - if !c.VerifyExpiresAt(now, false) { - delta := time.Unix(now, 0).Sub(time.Unix(c.ExpiresAt, 0)) - vErr.Inner = fmt.Errorf("token is expired by %v", delta) - vErr.Errors |= ValidationErrorExpired - } - - if !c.VerifyIssuedAt(now, false) { - vErr.Inner = fmt.Errorf("Token used before issued") - vErr.Errors |= ValidationErrorIssuedAt - } - - if !c.VerifyNotBefore(now, false) { - vErr.Inner = fmt.Errorf("token is not valid yet") - vErr.Errors |= ValidationErrorNotValidYet - } - - if vErr.valid() { - return nil - } - - return vErr -} - -// Compares the aud claim against cmp. -// If required is false, this method will return true if the value matches or is unset -func (c *StandardClaims) VerifyAudience(cmp string, req bool) bool { - return verifyAud([]string{c.Audience}, cmp, req) -} - -// Compares the exp claim against cmp. -// If required is false, this method will return true if the value matches or is unset -func (c *StandardClaims) VerifyExpiresAt(cmp int64, req bool) bool { - return verifyExp(c.ExpiresAt, cmp, req) -} - -// Compares the iat claim against cmp. -// If required is false, this method will return true if the value matches or is unset -func (c *StandardClaims) VerifyIssuedAt(cmp int64, req bool) bool { - return verifyIat(c.IssuedAt, cmp, req) -} - -// Compares the iss claim against cmp. -// If required is false, this method will return true if the value matches or is unset -func (c *StandardClaims) VerifyIssuer(cmp string, req bool) bool { - return verifyIss(c.Issuer, cmp, req) -} - -// Compares the nbf claim against cmp. -// If required is false, this method will return true if the value matches or is unset -func (c *StandardClaims) VerifyNotBefore(cmp int64, req bool) bool { - return verifyNbf(c.NotBefore, cmp, req) -} - -// ----- helpers - -func verifyAud(aud []string, cmp string, required bool) bool { - if len(aud) == 0 { - return !required - } - // use a var here to keep constant time compare when looping over a number of claims - result := false - - var stringClaims string - for _, a := range aud { - if subtle.ConstantTimeCompare([]byte(a), []byte(cmp)) != 0 { - result = true - } - stringClaims = stringClaims + a - } - - // case where "" is sent in one or many aud claims - if len(stringClaims) == 0 { - return !required - } - - return result -} - -func verifyExp(exp int64, now int64, required bool) bool { - if exp == 0 { - return !required - } - return now <= exp -} - -func verifyIat(iat int64, now int64, required bool) bool { - if iat == 0 { - return !required - } - return now >= iat -} - -func verifyIss(iss string, cmp string, required bool) bool { - if iss == "" { - return !required - } - if subtle.ConstantTimeCompare([]byte(iss), []byte(cmp)) != 0 { - return true - } else { - return false - } -} - -func verifyNbf(nbf int64, now int64, required bool) bool { - if nbf == 0 { - return !required - } - return now >= nbf -} diff --git a/vendor/github.com/golang-jwt/jwt/doc.go b/vendor/github.com/golang-jwt/jwt/doc.go deleted file mode 100644 index a86dc1a3..00000000 --- a/vendor/github.com/golang-jwt/jwt/doc.go +++ /dev/null @@ -1,4 +0,0 @@ -// Package jwt is a Go implementation of JSON Web Tokens: http://self-issued.info/docs/draft-jones-json-web-token.html -// -// See README.md for more info. -package jwt diff --git a/vendor/github.com/golang-jwt/jwt/ecdsa.go b/vendor/github.com/golang-jwt/jwt/ecdsa.go deleted file mode 100644 index 15e23435..00000000 --- a/vendor/github.com/golang-jwt/jwt/ecdsa.go +++ /dev/null @@ -1,142 +0,0 @@ -package jwt - -import ( - "crypto" - "crypto/ecdsa" - "crypto/rand" - "errors" - "math/big" -) - -var ( - // Sadly this is missing from crypto/ecdsa compared to crypto/rsa - ErrECDSAVerification = errors.New("crypto/ecdsa: verification error") -) - -// Implements the ECDSA family of signing methods signing methods -// Expects *ecdsa.PrivateKey for signing and *ecdsa.PublicKey for verification -type SigningMethodECDSA struct { - Name string - Hash crypto.Hash - KeySize int - CurveBits int -} - -// Specific instances for EC256 and company -var ( - SigningMethodES256 *SigningMethodECDSA - SigningMethodES384 *SigningMethodECDSA - SigningMethodES512 *SigningMethodECDSA -) - -func init() { - // ES256 - SigningMethodES256 = &SigningMethodECDSA{"ES256", crypto.SHA256, 32, 256} - RegisterSigningMethod(SigningMethodES256.Alg(), func() SigningMethod { - return SigningMethodES256 - }) - - // ES384 - SigningMethodES384 = &SigningMethodECDSA{"ES384", crypto.SHA384, 48, 384} - RegisterSigningMethod(SigningMethodES384.Alg(), func() SigningMethod { - return SigningMethodES384 - }) - - // ES512 - SigningMethodES512 = &SigningMethodECDSA{"ES512", crypto.SHA512, 66, 521} - RegisterSigningMethod(SigningMethodES512.Alg(), func() SigningMethod { - return SigningMethodES512 - }) -} - -func (m *SigningMethodECDSA) Alg() string { - return m.Name -} - -// Implements the Verify method from SigningMethod -// For this verify method, key must be an ecdsa.PublicKey struct -func (m *SigningMethodECDSA) Verify(signingString, signature string, key interface{}) error { - var err error - - // Decode the signature - var sig []byte - if sig, err = DecodeSegment(signature); err != nil { - return err - } - - // Get the key - var ecdsaKey *ecdsa.PublicKey - switch k := key.(type) { - case *ecdsa.PublicKey: - ecdsaKey = k - default: - return ErrInvalidKeyType - } - - if len(sig) != 2*m.KeySize { - return ErrECDSAVerification - } - - r := big.NewInt(0).SetBytes(sig[:m.KeySize]) - s := big.NewInt(0).SetBytes(sig[m.KeySize:]) - - // Create hasher - if !m.Hash.Available() { - return ErrHashUnavailable - } - hasher := m.Hash.New() - hasher.Write([]byte(signingString)) - - // Verify the signature - if verifystatus := ecdsa.Verify(ecdsaKey, hasher.Sum(nil), r, s); verifystatus { - return nil - } - - return ErrECDSAVerification -} - -// Implements the Sign method from SigningMethod -// For this signing method, key must be an ecdsa.PrivateKey struct -func (m *SigningMethodECDSA) Sign(signingString string, key interface{}) (string, error) { - // Get the key - var ecdsaKey *ecdsa.PrivateKey - switch k := key.(type) { - case *ecdsa.PrivateKey: - ecdsaKey = k - default: - return "", ErrInvalidKeyType - } - - // Create the hasher - if !m.Hash.Available() { - return "", ErrHashUnavailable - } - - hasher := m.Hash.New() - hasher.Write([]byte(signingString)) - - // Sign the string and return r, s - if r, s, err := ecdsa.Sign(rand.Reader, ecdsaKey, hasher.Sum(nil)); err == nil { - curveBits := ecdsaKey.Curve.Params().BitSize - - if m.CurveBits != curveBits { - return "", ErrInvalidKey - } - - keyBytes := curveBits / 8 - if curveBits%8 > 0 { - keyBytes += 1 - } - - // We serialize the outputs (r and s) into big-endian byte arrays - // padded with zeros on the left to make sure the sizes work out. - // Output must be 2*keyBytes long. - out := make([]byte, 2*keyBytes) - r.FillBytes(out[0:keyBytes]) // r is assigned to the first half of output. - s.FillBytes(out[keyBytes:]) // s is assigned to the second half of output. - - return EncodeSegment(out), nil - } else { - return "", err - } -} diff --git a/vendor/github.com/golang-jwt/jwt/ecdsa_utils.go b/vendor/github.com/golang-jwt/jwt/ecdsa_utils.go deleted file mode 100644 index db9f4be7..00000000 --- a/vendor/github.com/golang-jwt/jwt/ecdsa_utils.go +++ /dev/null @@ -1,69 +0,0 @@ -package jwt - -import ( - "crypto/ecdsa" - "crypto/x509" - "encoding/pem" - "errors" -) - -var ( - ErrNotECPublicKey = errors.New("Key is not a valid ECDSA public key") - ErrNotECPrivateKey = errors.New("Key is not a valid ECDSA private key") -) - -// Parse PEM encoded Elliptic Curve Private Key Structure -func ParseECPrivateKeyFromPEM(key []byte) (*ecdsa.PrivateKey, error) { - var err error - - // Parse PEM block - var block *pem.Block - if block, _ = pem.Decode(key); block == nil { - return nil, ErrKeyMustBePEMEncoded - } - - // Parse the key - var parsedKey interface{} - if parsedKey, err = x509.ParseECPrivateKey(block.Bytes); err != nil { - if parsedKey, err = x509.ParsePKCS8PrivateKey(block.Bytes); err != nil { - return nil, err - } - } - - var pkey *ecdsa.PrivateKey - var ok bool - if pkey, ok = parsedKey.(*ecdsa.PrivateKey); !ok { - return nil, ErrNotECPrivateKey - } - - return pkey, nil -} - -// Parse PEM encoded PKCS1 or PKCS8 public key -func ParseECPublicKeyFromPEM(key []byte) (*ecdsa.PublicKey, error) { - var err error - - // Parse PEM block - var block *pem.Block - if block, _ = pem.Decode(key); block == nil { - return nil, ErrKeyMustBePEMEncoded - } - - // Parse the key - var parsedKey interface{} - if parsedKey, err = x509.ParsePKIXPublicKey(block.Bytes); err != nil { - if cert, err := x509.ParseCertificate(block.Bytes); err == nil { - parsedKey = cert.PublicKey - } else { - return nil, err - } - } - - var pkey *ecdsa.PublicKey - var ok bool - if pkey, ok = parsedKey.(*ecdsa.PublicKey); !ok { - return nil, ErrNotECPublicKey - } - - return pkey, nil -} diff --git a/vendor/github.com/golang-jwt/jwt/ed25519.go b/vendor/github.com/golang-jwt/jwt/ed25519.go deleted file mode 100644 index a2f8ddbe..00000000 --- a/vendor/github.com/golang-jwt/jwt/ed25519.go +++ /dev/null @@ -1,81 +0,0 @@ -package jwt - -import ( - "errors" - - "crypto/ed25519" -) - -var ( - ErrEd25519Verification = errors.New("ed25519: verification error") -) - -// Implements the EdDSA family -// Expects ed25519.PrivateKey for signing and ed25519.PublicKey for verification -type SigningMethodEd25519 struct{} - -// Specific instance for EdDSA -var ( - SigningMethodEdDSA *SigningMethodEd25519 -) - -func init() { - SigningMethodEdDSA = &SigningMethodEd25519{} - RegisterSigningMethod(SigningMethodEdDSA.Alg(), func() SigningMethod { - return SigningMethodEdDSA - }) -} - -func (m *SigningMethodEd25519) Alg() string { - return "EdDSA" -} - -// Implements the Verify method from SigningMethod -// For this verify method, key must be an ed25519.PublicKey -func (m *SigningMethodEd25519) Verify(signingString, signature string, key interface{}) error { - var err error - var ed25519Key ed25519.PublicKey - var ok bool - - if ed25519Key, ok = key.(ed25519.PublicKey); !ok { - return ErrInvalidKeyType - } - - if len(ed25519Key) != ed25519.PublicKeySize { - return ErrInvalidKey - } - - // Decode the signature - var sig []byte - if sig, err = DecodeSegment(signature); err != nil { - return err - } - - // Verify the signature - if !ed25519.Verify(ed25519Key, []byte(signingString), sig) { - return ErrEd25519Verification - } - - return nil -} - -// Implements the Sign method from SigningMethod -// For this signing method, key must be an ed25519.PrivateKey -func (m *SigningMethodEd25519) Sign(signingString string, key interface{}) (string, error) { - var ed25519Key ed25519.PrivateKey - var ok bool - - if ed25519Key, ok = key.(ed25519.PrivateKey); !ok { - return "", ErrInvalidKeyType - } - - // ed25519.Sign panics if private key not equal to ed25519.PrivateKeySize - // this allows to avoid recover usage - if len(ed25519Key) != ed25519.PrivateKeySize { - return "", ErrInvalidKey - } - - // Sign the string and return the encoded result - sig := ed25519.Sign(ed25519Key, []byte(signingString)) - return EncodeSegment(sig), nil -} diff --git a/vendor/github.com/golang-jwt/jwt/ed25519_utils.go b/vendor/github.com/golang-jwt/jwt/ed25519_utils.go deleted file mode 100644 index c6357275..00000000 --- a/vendor/github.com/golang-jwt/jwt/ed25519_utils.go +++ /dev/null @@ -1,64 +0,0 @@ -package jwt - -import ( - "crypto" - "crypto/ed25519" - "crypto/x509" - "encoding/pem" - "errors" -) - -var ( - ErrNotEdPrivateKey = errors.New("Key is not a valid Ed25519 private key") - ErrNotEdPublicKey = errors.New("Key is not a valid Ed25519 public key") -) - -// Parse PEM-encoded Edwards curve private key -func ParseEdPrivateKeyFromPEM(key []byte) (crypto.PrivateKey, error) { - var err error - - // Parse PEM block - var block *pem.Block - if block, _ = pem.Decode(key); block == nil { - return nil, ErrKeyMustBePEMEncoded - } - - // Parse the key - var parsedKey interface{} - if parsedKey, err = x509.ParsePKCS8PrivateKey(block.Bytes); err != nil { - return nil, err - } - - var pkey ed25519.PrivateKey - var ok bool - if pkey, ok = parsedKey.(ed25519.PrivateKey); !ok { - return nil, ErrNotEdPrivateKey - } - - return pkey, nil -} - -// Parse PEM-encoded Edwards curve public key -func ParseEdPublicKeyFromPEM(key []byte) (crypto.PublicKey, error) { - var err error - - // Parse PEM block - var block *pem.Block - if block, _ = pem.Decode(key); block == nil { - return nil, ErrKeyMustBePEMEncoded - } - - // Parse the key - var parsedKey interface{} - if parsedKey, err = x509.ParsePKIXPublicKey(block.Bytes); err != nil { - return nil, err - } - - var pkey ed25519.PublicKey - var ok bool - if pkey, ok = parsedKey.(ed25519.PublicKey); !ok { - return nil, ErrNotEdPublicKey - } - - return pkey, nil -} diff --git a/vendor/github.com/golang-jwt/jwt/errors.go b/vendor/github.com/golang-jwt/jwt/errors.go deleted file mode 100644 index 1c93024a..00000000 --- a/vendor/github.com/golang-jwt/jwt/errors.go +++ /dev/null @@ -1,59 +0,0 @@ -package jwt - -import ( - "errors" -) - -// Error constants -var ( - ErrInvalidKey = errors.New("key is invalid") - ErrInvalidKeyType = errors.New("key is of invalid type") - ErrHashUnavailable = errors.New("the requested hash function is unavailable") -) - -// The errors that might occur when parsing and validating a token -const ( - ValidationErrorMalformed uint32 = 1 << iota // Token is malformed - ValidationErrorUnverifiable // Token could not be verified because of signing problems - ValidationErrorSignatureInvalid // Signature validation failed - - // Standard Claim validation errors - ValidationErrorAudience // AUD validation failed - ValidationErrorExpired // EXP validation failed - ValidationErrorIssuedAt // IAT validation failed - ValidationErrorIssuer // ISS validation failed - ValidationErrorNotValidYet // NBF validation failed - ValidationErrorId // JTI validation failed - ValidationErrorClaimsInvalid // Generic claims validation error -) - -// Helper for constructing a ValidationError with a string error message -func NewValidationError(errorText string, errorFlags uint32) *ValidationError { - return &ValidationError{ - text: errorText, - Errors: errorFlags, - } -} - -// The error from Parse if token is not valid -type ValidationError struct { - Inner error // stores the error returned by external dependencies, i.e.: KeyFunc - Errors uint32 // bitfield. see ValidationError... constants - text string // errors that do not have a valid error just have text -} - -// Validation error is an error type -func (e ValidationError) Error() string { - if e.Inner != nil { - return e.Inner.Error() - } else if e.text != "" { - return e.text - } else { - return "token is invalid" - } -} - -// No errors -func (e *ValidationError) valid() bool { - return e.Errors == 0 -} diff --git a/vendor/github.com/golang-jwt/jwt/hmac.go b/vendor/github.com/golang-jwt/jwt/hmac.go deleted file mode 100644 index addbe5d4..00000000 --- a/vendor/github.com/golang-jwt/jwt/hmac.go +++ /dev/null @@ -1,95 +0,0 @@ -package jwt - -import ( - "crypto" - "crypto/hmac" - "errors" -) - -// Implements the HMAC-SHA family of signing methods signing methods -// Expects key type of []byte for both signing and validation -type SigningMethodHMAC struct { - Name string - Hash crypto.Hash -} - -// Specific instances for HS256 and company -var ( - SigningMethodHS256 *SigningMethodHMAC - SigningMethodHS384 *SigningMethodHMAC - SigningMethodHS512 *SigningMethodHMAC - ErrSignatureInvalid = errors.New("signature is invalid") -) - -func init() { - // HS256 - SigningMethodHS256 = &SigningMethodHMAC{"HS256", crypto.SHA256} - RegisterSigningMethod(SigningMethodHS256.Alg(), func() SigningMethod { - return SigningMethodHS256 - }) - - // HS384 - SigningMethodHS384 = &SigningMethodHMAC{"HS384", crypto.SHA384} - RegisterSigningMethod(SigningMethodHS384.Alg(), func() SigningMethod { - return SigningMethodHS384 - }) - - // HS512 - SigningMethodHS512 = &SigningMethodHMAC{"HS512", crypto.SHA512} - RegisterSigningMethod(SigningMethodHS512.Alg(), func() SigningMethod { - return SigningMethodHS512 - }) -} - -func (m *SigningMethodHMAC) Alg() string { - return m.Name -} - -// Verify the signature of HSXXX tokens. Returns nil if the signature is valid. -func (m *SigningMethodHMAC) Verify(signingString, signature string, key interface{}) error { - // Verify the key is the right type - keyBytes, ok := key.([]byte) - if !ok { - return ErrInvalidKeyType - } - - // Decode signature, for comparison - sig, err := DecodeSegment(signature) - if err != nil { - return err - } - - // Can we use the specified hashing method? - if !m.Hash.Available() { - return ErrHashUnavailable - } - - // This signing method is symmetric, so we validate the signature - // by reproducing the signature from the signing string and key, then - // comparing that against the provided signature. - hasher := hmac.New(m.Hash.New, keyBytes) - hasher.Write([]byte(signingString)) - if !hmac.Equal(sig, hasher.Sum(nil)) { - return ErrSignatureInvalid - } - - // No validation errors. Signature is good. - return nil -} - -// Implements the Sign method from SigningMethod for this signing method. -// Key must be []byte -func (m *SigningMethodHMAC) Sign(signingString string, key interface{}) (string, error) { - if keyBytes, ok := key.([]byte); ok { - if !m.Hash.Available() { - return "", ErrHashUnavailable - } - - hasher := hmac.New(m.Hash.New, keyBytes) - hasher.Write([]byte(signingString)) - - return EncodeSegment(hasher.Sum(nil)), nil - } - - return "", ErrInvalidKeyType -} diff --git a/vendor/github.com/golang-jwt/jwt/map_claims.go b/vendor/github.com/golang-jwt/jwt/map_claims.go deleted file mode 100644 index 72c79f92..00000000 --- a/vendor/github.com/golang-jwt/jwt/map_claims.go +++ /dev/null @@ -1,120 +0,0 @@ -package jwt - -import ( - "encoding/json" - "errors" - // "fmt" -) - -// Claims type that uses the map[string]interface{} for JSON decoding -// This is the default claims type if you don't supply one -type MapClaims map[string]interface{} - -// VerifyAudience Compares the aud claim against cmp. -// If required is false, this method will return true if the value matches or is unset -func (m MapClaims) VerifyAudience(cmp string, req bool) bool { - var aud []string - switch v := m["aud"].(type) { - case string: - aud = append(aud, v) - case []string: - aud = v - case []interface{}: - for _, a := range v { - vs, ok := a.(string) - if !ok { - return false - } - aud = append(aud, vs) - } - } - return verifyAud(aud, cmp, req) -} - -// Compares the exp claim against cmp. -// If required is false, this method will return true if the value matches or is unset -func (m MapClaims) VerifyExpiresAt(cmp int64, req bool) bool { - exp, ok := m["exp"] - if !ok { - return !req - } - switch expType := exp.(type) { - case float64: - return verifyExp(int64(expType), cmp, req) - case json.Number: - v, _ := expType.Int64() - return verifyExp(v, cmp, req) - } - return false -} - -// Compares the iat claim against cmp. -// If required is false, this method will return true if the value matches or is unset -func (m MapClaims) VerifyIssuedAt(cmp int64, req bool) bool { - iat, ok := m["iat"] - if !ok { - return !req - } - switch iatType := iat.(type) { - case float64: - return verifyIat(int64(iatType), cmp, req) - case json.Number: - v, _ := iatType.Int64() - return verifyIat(v, cmp, req) - } - return false -} - -// Compares the iss claim against cmp. -// If required is false, this method will return true if the value matches or is unset -func (m MapClaims) VerifyIssuer(cmp string, req bool) bool { - iss, _ := m["iss"].(string) - return verifyIss(iss, cmp, req) -} - -// Compares the nbf claim against cmp. -// If required is false, this method will return true if the value matches or is unset -func (m MapClaims) VerifyNotBefore(cmp int64, req bool) bool { - nbf, ok := m["nbf"] - if !ok { - return !req - } - switch nbfType := nbf.(type) { - case float64: - return verifyNbf(int64(nbfType), cmp, req) - case json.Number: - v, _ := nbfType.Int64() - return verifyNbf(v, cmp, req) - } - return false -} - -// Validates time based claims "exp, iat, nbf". -// There is no accounting for clock skew. -// As well, if any of the above claims are not in the token, it will still -// be considered a valid claim. -func (m MapClaims) Valid() error { - vErr := new(ValidationError) - now := TimeFunc().Unix() - - if !m.VerifyExpiresAt(now, false) { - vErr.Inner = errors.New("Token is expired") - vErr.Errors |= ValidationErrorExpired - } - - if !m.VerifyIssuedAt(now, false) { - vErr.Inner = errors.New("Token used before issued") - vErr.Errors |= ValidationErrorIssuedAt - } - - if !m.VerifyNotBefore(now, false) { - vErr.Inner = errors.New("Token is not valid yet") - vErr.Errors |= ValidationErrorNotValidYet - } - - if vErr.valid() { - return nil - } - - return vErr -} diff --git a/vendor/github.com/golang-jwt/jwt/none.go b/vendor/github.com/golang-jwt/jwt/none.go deleted file mode 100644 index f04d189d..00000000 --- a/vendor/github.com/golang-jwt/jwt/none.go +++ /dev/null @@ -1,52 +0,0 @@ -package jwt - -// Implements the none signing method. This is required by the spec -// but you probably should never use it. -var SigningMethodNone *signingMethodNone - -const UnsafeAllowNoneSignatureType unsafeNoneMagicConstant = "none signing method allowed" - -var NoneSignatureTypeDisallowedError error - -type signingMethodNone struct{} -type unsafeNoneMagicConstant string - -func init() { - SigningMethodNone = &signingMethodNone{} - NoneSignatureTypeDisallowedError = NewValidationError("'none' signature type is not allowed", ValidationErrorSignatureInvalid) - - RegisterSigningMethod(SigningMethodNone.Alg(), func() SigningMethod { - return SigningMethodNone - }) -} - -func (m *signingMethodNone) Alg() string { - return "none" -} - -// Only allow 'none' alg type if UnsafeAllowNoneSignatureType is specified as the key -func (m *signingMethodNone) Verify(signingString, signature string, key interface{}) (err error) { - // Key must be UnsafeAllowNoneSignatureType to prevent accidentally - // accepting 'none' signing method - if _, ok := key.(unsafeNoneMagicConstant); !ok { - return NoneSignatureTypeDisallowedError - } - // If signing method is none, signature must be an empty string - if signature != "" { - return NewValidationError( - "'none' signing method with non-empty signature", - ValidationErrorSignatureInvalid, - ) - } - - // Accept 'none' signing method. - return nil -} - -// Only allow 'none' signing if UnsafeAllowNoneSignatureType is specified as the key -func (m *signingMethodNone) Sign(signingString string, key interface{}) (string, error) { - if _, ok := key.(unsafeNoneMagicConstant); ok { - return "", nil - } - return "", NoneSignatureTypeDisallowedError -} diff --git a/vendor/github.com/golang-jwt/jwt/parser.go b/vendor/github.com/golang-jwt/jwt/parser.go deleted file mode 100644 index d6901d9a..00000000 --- a/vendor/github.com/golang-jwt/jwt/parser.go +++ /dev/null @@ -1,148 +0,0 @@ -package jwt - -import ( - "bytes" - "encoding/json" - "fmt" - "strings" -) - -type Parser struct { - ValidMethods []string // If populated, only these methods will be considered valid - UseJSONNumber bool // Use JSON Number format in JSON decoder - SkipClaimsValidation bool // Skip claims validation during token parsing -} - -// Parse, validate, and return a token. -// keyFunc will receive the parsed token and should return the key for validating. -// If everything is kosher, err will be nil -func (p *Parser) Parse(tokenString string, keyFunc Keyfunc) (*Token, error) { - return p.ParseWithClaims(tokenString, MapClaims{}, keyFunc) -} - -func (p *Parser) ParseWithClaims(tokenString string, claims Claims, keyFunc Keyfunc) (*Token, error) { - token, parts, err := p.ParseUnverified(tokenString, claims) - if err != nil { - return token, err - } - - // Verify signing method is in the required set - if p.ValidMethods != nil { - var signingMethodValid = false - var alg = token.Method.Alg() - for _, m := range p.ValidMethods { - if m == alg { - signingMethodValid = true - break - } - } - if !signingMethodValid { - // signing method is not in the listed set - return token, NewValidationError(fmt.Sprintf("signing method %v is invalid", alg), ValidationErrorSignatureInvalid) - } - } - - // Lookup key - var key interface{} - if keyFunc == nil { - // keyFunc was not provided. short circuiting validation - return token, NewValidationError("no Keyfunc was provided.", ValidationErrorUnverifiable) - } - if key, err = keyFunc(token); err != nil { - // keyFunc returned an error - if ve, ok := err.(*ValidationError); ok { - return token, ve - } - return token, &ValidationError{Inner: err, Errors: ValidationErrorUnverifiable} - } - - vErr := &ValidationError{} - - // Validate Claims - if !p.SkipClaimsValidation { - if err := token.Claims.Valid(); err != nil { - - // If the Claims Valid returned an error, check if it is a validation error, - // If it was another error type, create a ValidationError with a generic ClaimsInvalid flag set - if e, ok := err.(*ValidationError); !ok { - vErr = &ValidationError{Inner: err, Errors: ValidationErrorClaimsInvalid} - } else { - vErr = e - } - } - } - - // Perform validation - token.Signature = parts[2] - if err = token.Method.Verify(strings.Join(parts[0:2], "."), token.Signature, key); err != nil { - vErr.Inner = err - vErr.Errors |= ValidationErrorSignatureInvalid - } - - if vErr.valid() { - token.Valid = true - return token, nil - } - - return token, vErr -} - -// WARNING: Don't use this method unless you know what you're doing -// -// This method parses the token but doesn't validate the signature. It's only -// ever useful in cases where you know the signature is valid (because it has -// been checked previously in the stack) and you want to extract values from -// it. -func (p *Parser) ParseUnverified(tokenString string, claims Claims) (token *Token, parts []string, err error) { - parts = strings.Split(tokenString, ".") - if len(parts) != 3 { - return nil, parts, NewValidationError("token contains an invalid number of segments", ValidationErrorMalformed) - } - - token = &Token{Raw: tokenString} - - // parse Header - var headerBytes []byte - if headerBytes, err = DecodeSegment(parts[0]); err != nil { - if strings.HasPrefix(strings.ToLower(tokenString), "bearer ") { - return token, parts, NewValidationError("tokenstring should not contain 'bearer '", ValidationErrorMalformed) - } - return token, parts, &ValidationError{Inner: err, Errors: ValidationErrorMalformed} - } - if err = json.Unmarshal(headerBytes, &token.Header); err != nil { - return token, parts, &ValidationError{Inner: err, Errors: ValidationErrorMalformed} - } - - // parse Claims - var claimBytes []byte - token.Claims = claims - - if claimBytes, err = DecodeSegment(parts[1]); err != nil { - return token, parts, &ValidationError{Inner: err, Errors: ValidationErrorMalformed} - } - dec := json.NewDecoder(bytes.NewBuffer(claimBytes)) - if p.UseJSONNumber { - dec.UseNumber() - } - // JSON Decode. Special case for map type to avoid weird pointer behavior - if c, ok := token.Claims.(MapClaims); ok { - err = dec.Decode(&c) - } else { - err = dec.Decode(&claims) - } - // Handle decode error - if err != nil { - return token, parts, &ValidationError{Inner: err, Errors: ValidationErrorMalformed} - } - - // Lookup signature method - if method, ok := token.Header["alg"].(string); ok { - if token.Method = GetSigningMethod(method); token.Method == nil { - return token, parts, NewValidationError("signing method (alg) is unavailable.", ValidationErrorUnverifiable) - } - } else { - return token, parts, NewValidationError("signing method (alg) is unspecified.", ValidationErrorUnverifiable) - } - - return token, parts, nil -} diff --git a/vendor/github.com/golang-jwt/jwt/rsa.go b/vendor/github.com/golang-jwt/jwt/rsa.go deleted file mode 100644 index e4caf1ca..00000000 --- a/vendor/github.com/golang-jwt/jwt/rsa.go +++ /dev/null @@ -1,101 +0,0 @@ -package jwt - -import ( - "crypto" - "crypto/rand" - "crypto/rsa" -) - -// Implements the RSA family of signing methods signing methods -// Expects *rsa.PrivateKey for signing and *rsa.PublicKey for validation -type SigningMethodRSA struct { - Name string - Hash crypto.Hash -} - -// Specific instances for RS256 and company -var ( - SigningMethodRS256 *SigningMethodRSA - SigningMethodRS384 *SigningMethodRSA - SigningMethodRS512 *SigningMethodRSA -) - -func init() { - // RS256 - SigningMethodRS256 = &SigningMethodRSA{"RS256", crypto.SHA256} - RegisterSigningMethod(SigningMethodRS256.Alg(), func() SigningMethod { - return SigningMethodRS256 - }) - - // RS384 - SigningMethodRS384 = &SigningMethodRSA{"RS384", crypto.SHA384} - RegisterSigningMethod(SigningMethodRS384.Alg(), func() SigningMethod { - return SigningMethodRS384 - }) - - // RS512 - SigningMethodRS512 = &SigningMethodRSA{"RS512", crypto.SHA512} - RegisterSigningMethod(SigningMethodRS512.Alg(), func() SigningMethod { - return SigningMethodRS512 - }) -} - -func (m *SigningMethodRSA) Alg() string { - return m.Name -} - -// Implements the Verify method from SigningMethod -// For this signing method, must be an *rsa.PublicKey structure. -func (m *SigningMethodRSA) Verify(signingString, signature string, key interface{}) error { - var err error - - // Decode the signature - var sig []byte - if sig, err = DecodeSegment(signature); err != nil { - return err - } - - var rsaKey *rsa.PublicKey - var ok bool - - if rsaKey, ok = key.(*rsa.PublicKey); !ok { - return ErrInvalidKeyType - } - - // Create hasher - if !m.Hash.Available() { - return ErrHashUnavailable - } - hasher := m.Hash.New() - hasher.Write([]byte(signingString)) - - // Verify the signature - return rsa.VerifyPKCS1v15(rsaKey, m.Hash, hasher.Sum(nil), sig) -} - -// Implements the Sign method from SigningMethod -// For this signing method, must be an *rsa.PrivateKey structure. -func (m *SigningMethodRSA) Sign(signingString string, key interface{}) (string, error) { - var rsaKey *rsa.PrivateKey - var ok bool - - // Validate type of key - if rsaKey, ok = key.(*rsa.PrivateKey); !ok { - return "", ErrInvalidKey - } - - // Create the hasher - if !m.Hash.Available() { - return "", ErrHashUnavailable - } - - hasher := m.Hash.New() - hasher.Write([]byte(signingString)) - - // Sign the string and return the encoded bytes - if sigBytes, err := rsa.SignPKCS1v15(rand.Reader, rsaKey, m.Hash, hasher.Sum(nil)); err == nil { - return EncodeSegment(sigBytes), nil - } else { - return "", err - } -} diff --git a/vendor/github.com/golang-jwt/jwt/rsa_pss.go b/vendor/github.com/golang-jwt/jwt/rsa_pss.go deleted file mode 100644 index c0147086..00000000 --- a/vendor/github.com/golang-jwt/jwt/rsa_pss.go +++ /dev/null @@ -1,142 +0,0 @@ -// +build go1.4 - -package jwt - -import ( - "crypto" - "crypto/rand" - "crypto/rsa" -) - -// Implements the RSAPSS family of signing methods signing methods -type SigningMethodRSAPSS struct { - *SigningMethodRSA - Options *rsa.PSSOptions - // VerifyOptions is optional. If set overrides Options for rsa.VerifyPPS. - // Used to accept tokens signed with rsa.PSSSaltLengthAuto, what doesn't follow - // https://tools.ietf.org/html/rfc7518#section-3.5 but was used previously. - // See https://github.com/dgrijalva/jwt-go/issues/285#issuecomment-437451244 for details. - VerifyOptions *rsa.PSSOptions -} - -// Specific instances for RS/PS and company. -var ( - SigningMethodPS256 *SigningMethodRSAPSS - SigningMethodPS384 *SigningMethodRSAPSS - SigningMethodPS512 *SigningMethodRSAPSS -) - -func init() { - // PS256 - SigningMethodPS256 = &SigningMethodRSAPSS{ - SigningMethodRSA: &SigningMethodRSA{ - Name: "PS256", - Hash: crypto.SHA256, - }, - Options: &rsa.PSSOptions{ - SaltLength: rsa.PSSSaltLengthEqualsHash, - }, - VerifyOptions: &rsa.PSSOptions{ - SaltLength: rsa.PSSSaltLengthAuto, - }, - } - RegisterSigningMethod(SigningMethodPS256.Alg(), func() SigningMethod { - return SigningMethodPS256 - }) - - // PS384 - SigningMethodPS384 = &SigningMethodRSAPSS{ - SigningMethodRSA: &SigningMethodRSA{ - Name: "PS384", - Hash: crypto.SHA384, - }, - Options: &rsa.PSSOptions{ - SaltLength: rsa.PSSSaltLengthEqualsHash, - }, - VerifyOptions: &rsa.PSSOptions{ - SaltLength: rsa.PSSSaltLengthAuto, - }, - } - RegisterSigningMethod(SigningMethodPS384.Alg(), func() SigningMethod { - return SigningMethodPS384 - }) - - // PS512 - SigningMethodPS512 = &SigningMethodRSAPSS{ - SigningMethodRSA: &SigningMethodRSA{ - Name: "PS512", - Hash: crypto.SHA512, - }, - Options: &rsa.PSSOptions{ - SaltLength: rsa.PSSSaltLengthEqualsHash, - }, - VerifyOptions: &rsa.PSSOptions{ - SaltLength: rsa.PSSSaltLengthAuto, - }, - } - RegisterSigningMethod(SigningMethodPS512.Alg(), func() SigningMethod { - return SigningMethodPS512 - }) -} - -// Implements the Verify method from SigningMethod -// For this verify method, key must be an rsa.PublicKey struct -func (m *SigningMethodRSAPSS) Verify(signingString, signature string, key interface{}) error { - var err error - - // Decode the signature - var sig []byte - if sig, err = DecodeSegment(signature); err != nil { - return err - } - - var rsaKey *rsa.PublicKey - switch k := key.(type) { - case *rsa.PublicKey: - rsaKey = k - default: - return ErrInvalidKey - } - - // Create hasher - if !m.Hash.Available() { - return ErrHashUnavailable - } - hasher := m.Hash.New() - hasher.Write([]byte(signingString)) - - opts := m.Options - if m.VerifyOptions != nil { - opts = m.VerifyOptions - } - - return rsa.VerifyPSS(rsaKey, m.Hash, hasher.Sum(nil), sig, opts) -} - -// Implements the Sign method from SigningMethod -// For this signing method, key must be an rsa.PrivateKey struct -func (m *SigningMethodRSAPSS) Sign(signingString string, key interface{}) (string, error) { - var rsaKey *rsa.PrivateKey - - switch k := key.(type) { - case *rsa.PrivateKey: - rsaKey = k - default: - return "", ErrInvalidKeyType - } - - // Create the hasher - if !m.Hash.Available() { - return "", ErrHashUnavailable - } - - hasher := m.Hash.New() - hasher.Write([]byte(signingString)) - - // Sign the string and return the encoded bytes - if sigBytes, err := rsa.SignPSS(rand.Reader, rsaKey, m.Hash, hasher.Sum(nil), m.Options); err == nil { - return EncodeSegment(sigBytes), nil - } else { - return "", err - } -} diff --git a/vendor/github.com/golang-jwt/jwt/rsa_utils.go b/vendor/github.com/golang-jwt/jwt/rsa_utils.go deleted file mode 100644 index 14c78c29..00000000 --- a/vendor/github.com/golang-jwt/jwt/rsa_utils.go +++ /dev/null @@ -1,101 +0,0 @@ -package jwt - -import ( - "crypto/rsa" - "crypto/x509" - "encoding/pem" - "errors" -) - -var ( - ErrKeyMustBePEMEncoded = errors.New("Invalid Key: Key must be a PEM encoded PKCS1 or PKCS8 key") - ErrNotRSAPrivateKey = errors.New("Key is not a valid RSA private key") - ErrNotRSAPublicKey = errors.New("Key is not a valid RSA public key") -) - -// Parse PEM encoded PKCS1 or PKCS8 private key -func ParseRSAPrivateKeyFromPEM(key []byte) (*rsa.PrivateKey, error) { - var err error - - // Parse PEM block - var block *pem.Block - if block, _ = pem.Decode(key); block == nil { - return nil, ErrKeyMustBePEMEncoded - } - - var parsedKey interface{} - if parsedKey, err = x509.ParsePKCS1PrivateKey(block.Bytes); err != nil { - if parsedKey, err = x509.ParsePKCS8PrivateKey(block.Bytes); err != nil { - return nil, err - } - } - - var pkey *rsa.PrivateKey - var ok bool - if pkey, ok = parsedKey.(*rsa.PrivateKey); !ok { - return nil, ErrNotRSAPrivateKey - } - - return pkey, nil -} - -// Parse PEM encoded PKCS1 or PKCS8 private key protected with password -func ParseRSAPrivateKeyFromPEMWithPassword(key []byte, password string) (*rsa.PrivateKey, error) { - var err error - - // Parse PEM block - var block *pem.Block - if block, _ = pem.Decode(key); block == nil { - return nil, ErrKeyMustBePEMEncoded - } - - var parsedKey interface{} - - var blockDecrypted []byte - if blockDecrypted, err = x509.DecryptPEMBlock(block, []byte(password)); err != nil { - return nil, err - } - - if parsedKey, err = x509.ParsePKCS1PrivateKey(blockDecrypted); err != nil { - if parsedKey, err = x509.ParsePKCS8PrivateKey(blockDecrypted); err != nil { - return nil, err - } - } - - var pkey *rsa.PrivateKey - var ok bool - if pkey, ok = parsedKey.(*rsa.PrivateKey); !ok { - return nil, ErrNotRSAPrivateKey - } - - return pkey, nil -} - -// Parse PEM encoded PKCS1 or PKCS8 public key -func ParseRSAPublicKeyFromPEM(key []byte) (*rsa.PublicKey, error) { - var err error - - // Parse PEM block - var block *pem.Block - if block, _ = pem.Decode(key); block == nil { - return nil, ErrKeyMustBePEMEncoded - } - - // Parse the key - var parsedKey interface{} - if parsedKey, err = x509.ParsePKIXPublicKey(block.Bytes); err != nil { - if cert, err := x509.ParseCertificate(block.Bytes); err == nil { - parsedKey = cert.PublicKey - } else { - return nil, err - } - } - - var pkey *rsa.PublicKey - var ok bool - if pkey, ok = parsedKey.(*rsa.PublicKey); !ok { - return nil, ErrNotRSAPublicKey - } - - return pkey, nil -} diff --git a/vendor/github.com/golang-jwt/jwt/signing_method.go b/vendor/github.com/golang-jwt/jwt/signing_method.go deleted file mode 100644 index ed1f212b..00000000 --- a/vendor/github.com/golang-jwt/jwt/signing_method.go +++ /dev/null @@ -1,35 +0,0 @@ -package jwt - -import ( - "sync" -) - -var signingMethods = map[string]func() SigningMethod{} -var signingMethodLock = new(sync.RWMutex) - -// Implement SigningMethod to add new methods for signing or verifying tokens. -type SigningMethod interface { - Verify(signingString, signature string, key interface{}) error // Returns nil if signature is valid - Sign(signingString string, key interface{}) (string, error) // Returns encoded signature or error - Alg() string // returns the alg identifier for this method (example: 'HS256') -} - -// Register the "alg" name and a factory function for signing method. -// This is typically done during init() in the method's implementation -func RegisterSigningMethod(alg string, f func() SigningMethod) { - signingMethodLock.Lock() - defer signingMethodLock.Unlock() - - signingMethods[alg] = f -} - -// Get a signing method from an "alg" string -func GetSigningMethod(alg string) (method SigningMethod) { - signingMethodLock.RLock() - defer signingMethodLock.RUnlock() - - if methodF, ok := signingMethods[alg]; ok { - method = methodF() - } - return -} diff --git a/vendor/github.com/golang-jwt/jwt/token.go b/vendor/github.com/golang-jwt/jwt/token.go deleted file mode 100644 index 6b30ced1..00000000 --- a/vendor/github.com/golang-jwt/jwt/token.go +++ /dev/null @@ -1,104 +0,0 @@ -package jwt - -import ( - "encoding/base64" - "encoding/json" - "strings" - "time" -) - -// TimeFunc provides the current time when parsing token to validate "exp" claim (expiration time). -// You can override it to use another time value. This is useful for testing or if your -// server uses a different time zone than your tokens. -var TimeFunc = time.Now - -// Parse methods use this callback function to supply -// the key for verification. The function receives the parsed, -// but unverified Token. This allows you to use properties in the -// Header of the token (such as `kid`) to identify which key to use. -type Keyfunc func(*Token) (interface{}, error) - -// A JWT Token. Different fields will be used depending on whether you're -// creating or parsing/verifying a token. -type Token struct { - Raw string // The raw token. Populated when you Parse a token - Method SigningMethod // The signing method used or to be used - Header map[string]interface{} // The first segment of the token - Claims Claims // The second segment of the token - Signature string // The third segment of the token. Populated when you Parse a token - Valid bool // Is the token valid? Populated when you Parse/Verify a token -} - -// Create a new Token. Takes a signing method -func New(method SigningMethod) *Token { - return NewWithClaims(method, MapClaims{}) -} - -func NewWithClaims(method SigningMethod, claims Claims) *Token { - return &Token{ - Header: map[string]interface{}{ - "typ": "JWT", - "alg": method.Alg(), - }, - Claims: claims, - Method: method, - } -} - -// Get the complete, signed token -func (t *Token) SignedString(key interface{}) (string, error) { - var sig, sstr string - var err error - if sstr, err = t.SigningString(); err != nil { - return "", err - } - if sig, err = t.Method.Sign(sstr, key); err != nil { - return "", err - } - return strings.Join([]string{sstr, sig}, "."), nil -} - -// Generate the signing string. This is the -// most expensive part of the whole deal. Unless you -// need this for something special, just go straight for -// the SignedString. -func (t *Token) SigningString() (string, error) { - var err error - parts := make([]string, 2) - for i := range parts { - var jsonValue []byte - if i == 0 { - if jsonValue, err = json.Marshal(t.Header); err != nil { - return "", err - } - } else { - if jsonValue, err = json.Marshal(t.Claims); err != nil { - return "", err - } - } - - parts[i] = EncodeSegment(jsonValue) - } - return strings.Join(parts, "."), nil -} - -// Parse, validate, and return a token. -// keyFunc will receive the parsed token and should return the key for validating. -// If everything is kosher, err will be nil -func Parse(tokenString string, keyFunc Keyfunc) (*Token, error) { - return new(Parser).Parse(tokenString, keyFunc) -} - -func ParseWithClaims(tokenString string, claims Claims, keyFunc Keyfunc) (*Token, error) { - return new(Parser).ParseWithClaims(tokenString, claims, keyFunc) -} - -// Encode JWT specific base64url encoding with padding stripped -func EncodeSegment(seg []byte) string { - return base64.RawURLEncoding.EncodeToString(seg) -} - -// Decode JWT specific base64url encoding with padding stripped -func DecodeSegment(seg string) ([]byte, error) { - return base64.RawURLEncoding.DecodeString(seg) -} diff --git a/vendor/github.com/golang-jwt/jwt/v4/parser.go b/vendor/github.com/golang-jwt/jwt/v4/parser.go index c0a6f692..9dd36e5a 100644 --- a/vendor/github.com/golang-jwt/jwt/v4/parser.go +++ b/vendor/github.com/golang-jwt/jwt/v4/parser.go @@ -36,19 +36,21 @@ func NewParser(options ...ParserOption) *Parser { return p } -// Parse parses, validates, verifies the signature and returns the parsed token. -// keyFunc will receive the parsed token and should return the key for validating. +// Parse parses, validates, verifies the signature and returns the parsed token. keyFunc will +// receive the parsed token and should return the key for validating. func (p *Parser) Parse(tokenString string, keyFunc Keyfunc) (*Token, error) { return p.ParseWithClaims(tokenString, MapClaims{}, keyFunc) } -// ParseWithClaims parses, validates, and verifies like Parse, but supplies a default object implementing the Claims -// interface. This provides default values which can be overridden and allows a caller to use their own type, rather -// than the default MapClaims implementation of Claims. +// ParseWithClaims parses, validates, and verifies like Parse, but supplies a default object +// implementing the Claims interface. This provides default values which can be overridden and +// allows a caller to use their own type, rather than the default MapClaims implementation of +// Claims. // -// Note: If you provide a custom claim implementation that embeds one of the standard claims (such as RegisteredClaims), -// make sure that a) you either embed a non-pointer version of the claims or b) if you are using a pointer, allocate the -// proper memory for it before passing in the overall claims, otherwise you might run into a panic. +// Note: If you provide a custom claim implementation that embeds one of the standard claims (such +// as RegisteredClaims), make sure that a) you either embed a non-pointer version of the claims or +// b) if you are using a pointer, allocate the proper memory for it before passing in the overall +// claims, otherwise you might run into a panic. func (p *Parser) ParseWithClaims(tokenString string, claims Claims, keyFunc Keyfunc) (*Token, error) { token, parts, err := p.ParseUnverified(tokenString, claims) if err != nil { @@ -85,12 +87,17 @@ func (p *Parser) ParseWithClaims(tokenString string, claims Claims, keyFunc Keyf return token, &ValidationError{Inner: err, Errors: ValidationErrorUnverifiable} } + // Perform validation + token.Signature = parts[2] + if err := token.Method.Verify(strings.Join(parts[0:2], "."), token.Signature, key); err != nil { + return token, &ValidationError{Inner: err, Errors: ValidationErrorSignatureInvalid} + } + vErr := &ValidationError{} // Validate Claims if !p.SkipClaimsValidation { if err := token.Claims.Valid(); err != nil { - // If the Claims Valid returned an error, check if it is a validation error, // If it was another error type, create a ValidationError with a generic ClaimsInvalid flag set if e, ok := err.(*ValidationError); !ok { @@ -98,22 +105,14 @@ func (p *Parser) ParseWithClaims(tokenString string, claims Claims, keyFunc Keyf } else { vErr = e } + return token, vErr } } - // Perform validation - token.Signature = parts[2] - if err = token.Method.Verify(strings.Join(parts[0:2], "."), token.Signature, key); err != nil { - vErr.Inner = err - vErr.Errors |= ValidationErrorSignatureInvalid - } + // No errors so far, token is valid. + token.Valid = true - if vErr.valid() { - token.Valid = true - return token, nil - } - - return token, vErr + return token, nil } // ParseUnverified parses the token but doesn't validate the signature. diff --git a/vendor/github.com/hashicorp/go-metrics/.gitignore b/vendor/github.com/hashicorp/go-metrics/.gitignore new file mode 100644 index 00000000..e5750f57 --- /dev/null +++ b/vendor/github.com/hashicorp/go-metrics/.gitignore @@ -0,0 +1,26 @@ +# Compiled Object files, Static and Dynamic libs (Shared Objects) +*.o +*.a +*.so + +# Folders +_obj +_test + +# Architecture specific extensions/prefixes +*.[568vq] +[568vq].out + +*.cgo1.go +*.cgo2.c +_cgo_defun.c +_cgo_gotypes.go +_cgo_export.* + +_testmain.go + +*.exe + +/metrics.out + +.idea diff --git a/vendor/github.com/hashicorp/go-metrics/.travis.yml b/vendor/github.com/hashicorp/go-metrics/.travis.yml new file mode 100644 index 00000000..24faeac3 --- /dev/null +++ b/vendor/github.com/hashicorp/go-metrics/.travis.yml @@ -0,0 +1,16 @@ +# Copyright (c) HashiCorp, Inc. +# SPDX-License-Identifier: MIT + +language: go + +go: + - "1.x" + +env: + - GO111MODULE=on + +install: + - go get ./... + +script: + - go test ./... diff --git a/vendor/github.com/hashicorp/go-metrics/LICENSE b/vendor/github.com/hashicorp/go-metrics/LICENSE new file mode 100644 index 00000000..800f14ba --- /dev/null +++ b/vendor/github.com/hashicorp/go-metrics/LICENSE @@ -0,0 +1,18 @@ +Copyright (c) 2013 HashiCorp, Inc. + +Permission is hereby granted, free of charge, to any person obtaining a copy of +this software and associated documentation files (the "Software"), to deal in +the Software without restriction, including without limitation the rights to +use, copy, modify, merge, publish, distribute, sublicense, and/or sell copies of +the Software, and to permit persons to whom the Software is furnished to do so, +subject to the following conditions: + +The above copyright notice and this permission notice shall be included in all +copies or substantial portions of the Software. + +THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR +IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, FITNESS +FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS OR +COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER +IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN +CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. diff --git a/vendor/github.com/hashicorp/go-metrics/README.md b/vendor/github.com/hashicorp/go-metrics/README.md new file mode 100644 index 00000000..763fc5eb --- /dev/null +++ b/vendor/github.com/hashicorp/go-metrics/README.md @@ -0,0 +1,131 @@ +go-metrics +========== + +This library provides a `metrics` package which can be used to instrument code, +expose application metrics, and profile runtime performance in a flexible manner. + +Current API: [![GoDoc](https://godoc.org/github.com/hashicorp/go-metrics?status.svg)](https://godoc.org/github.com/hashicorp/go-metrics) + +Sinks +----- + +The `metrics` package makes use of a `MetricSink` interface to support delivery +to any type of backend. Currently the following sinks are provided: + +* StatsiteSink : Sinks to a [statsite](https://github.com/statsite/statsite/) instance (TCP) +* StatsdSink: Sinks to a [StatsD](https://github.com/statsd/statsd/) / statsite instance (UDP) +* PrometheusSink: Sinks to a [Prometheus](http://prometheus.io/) metrics endpoint (exposed via HTTP for scrapes) +* InmemSink : Provides in-memory aggregation, can be used to export stats +* FanoutSink : Sinks to multiple sinks. Enables writing to multiple statsite instances for example. +* BlackholeSink : Sinks to nowhere + +In addition to the sinks, the `InmemSignal` can be used to catch a signal, +and dump a formatted output of recent metrics. For example, when a process gets +a SIGUSR1, it can dump to stderr recent performance metrics for debugging. + +Labels +------ + +Most metrics do have an equivalent ending with `WithLabels`, such methods +allow to push metrics with labels and use some features of underlying Sinks +(ex: translated into Prometheus labels). + +Since some of these labels may increase the cardinality of metrics, the +library allows filtering labels using a allow/block list filtering system +which is global to all metrics. + +* If `Config.AllowedLabels` is not nil, then only labels specified in this value will be sent to underlying Sink, otherwise, all labels are sent by default. +* If `Config.BlockedLabels` is not nil, any label specified in this value will not be sent to underlying Sinks. + +By default, both `Config.AllowedLabels` and `Config.BlockedLabels` are nil, meaning that +no tags are filtered at all, but it allows a user to globally block some tags with high +cardinality at the application level. + +Backwards Compatibility +----------------------- +v0.5.0 of the library renamed the Go module from `github.com/armon/go-metrics` to `github.com/hashicorp/go-metrics`. +While this did not introduce any breaking changes to the API, the change did subtly break backwards compatibility. + +In essence, Go treats a renamed module as entirely distinct and will happily compile both modules into the same binary. +Due to most uses of the go-metrics library involving emitting metrics via the global metrics handler, having two global +metrics handlers could cause a subset of metrics to be effectively lost. As an example, if your application configures +go-metrics exporting via the `armon` namespace, then any metrics sent to go-metrics via the `hashicorp` namespaced module +will never get exported. + +Eventually all usage of `armon/go-metrics` should be replaced with usage of `hashicorp/go-metrics`. However, a single +point-in-time coordinated update across all libraries that an application may depend on isn't always feasible. To facilitate migrations, +a `github.com/hashicorp/go-metrics/compat` package has been introduced. This package and sub-packages are API compatible with +`armon/go-metrics`. Libraries should be updated to use this package for emitting metrics via the global handlers. Internally, +the package will route metrics to either `armon/go-metrics` or `hashicorp/go-metrics`. This is achieved at a global level +within an application via the use of Go build tags. + +**Build Tags** +* `armonmetrics` - Using this tag will cause metrics to be routed to `armon/go-metrics` +* `hashicorpmetrics` - Using this tag will cause all metrics to be routed to `hashicorp/go-metrics` + +If no build tag is specified, the default behavior is to use `armon/go-metrics`. The overall migration path would be as follows: + +1. Upgrade libraries using `armon/go-metrics` to consume `hashicorp/go-metrics/compat` instead. +2. Update library dependencies of applications that use `armon/go-metrics`. + * This doesn't need to be one big atomic update but can be slower due to the default behavior remaining unaltered. + * At this point all metrics will still be emitted to `armon/go-metrics` +3. Update the application to use `hashicorp/go-metrics` + * Replace all application imports of `github.com/armon/go-metrics` with `github.com/hashicorp/go-metrics` + * Libraries are unaltered at this stage. + * Instrument your build system to build with the `hashicorpmetrics` tag. + +Your migration is effectively finished and your application is now exclusively using `hashicorp/go-metrics`. A future release of the library +will change the default behavior to use `hashicorp/go-metrics` instead of `armon/go-metrics`. At that point in time, any application that +needs more time before performing the migration must instrument their build system to include the `armonmetrics` tag. A subsequent release +after that will eventually remove the compatibility layer all together. The rough timeline for this will be mid-2025 for changing the default +behavior and then the end of 2025 for removal of the compatibility layer. + + +Examples +-------- + +Here is an example of using the package: + +```go +func SlowMethod() { + // Profiling the runtime of a method + defer metrics.MeasureSince([]string{"SlowMethod"}, time.Now()) +} + +// Configure a statsite sink as the global metrics sink +sink, _ := metrics.NewStatsiteSink("statsite:8125") +metrics.NewGlobal(metrics.DefaultConfig("service-name"), sink) + +// Emit a Key/Value pair +metrics.EmitKey([]string{"questions", "meaning of life"}, 42) +``` + +Here is an example of setting up a signal handler: + +```go +// Setup the inmem sink and signal handler +inm := metrics.NewInmemSink(10*time.Second, time.Minute) +sig := metrics.DefaultInmemSignal(inm) +metrics.NewGlobal(metrics.DefaultConfig("service-name"), inm) + +// Run some code +inm.SetGauge([]string{"foo"}, 42) +inm.EmitKey([]string{"bar"}, 30) + +inm.IncrCounter([]string{"baz"}, 42) +inm.IncrCounter([]string{"baz"}, 1) +inm.IncrCounter([]string{"baz"}, 80) + +inm.AddSample([]string{"method", "wow"}, 42) +inm.AddSample([]string{"method", "wow"}, 100) +inm.AddSample([]string{"method", "wow"}, 22) + +.... +``` + +When a signal comes in, output like the following will be dumped to stderr: + + [2014-01-28 14:57:33.04 -0800 PST][G] 'foo': 42.000 + [2014-01-28 14:57:33.04 -0800 PST][P] 'bar': 30.000 + [2014-01-28 14:57:33.04 -0800 PST][C] 'baz': Count: 3 Min: 1.000 Mean: 41.000 Max: 80.000 Stddev: 39.509 + [2014-01-28 14:57:33.04 -0800 PST][S] 'method.wow': Count: 3 Min: 22.000 Mean: 54.667 Max: 100.000 Stddev: 40.513 diff --git a/vendor/github.com/hashicorp/go-metrics/compat/armon.go b/vendor/github.com/hashicorp/go-metrics/compat/armon.go new file mode 100644 index 00000000..f59d96ce --- /dev/null +++ b/vendor/github.com/hashicorp/go-metrics/compat/armon.go @@ -0,0 +1,129 @@ +//go:build armonmetrics || ignore || !hashicorpmetrics +// +build armonmetrics ignore !hashicorpmetrics + +package metrics + +import ( + "io" + "net/url" + "syscall" + "time" + + "github.com/armon/go-metrics" +) + +const ( + // DefaultSignal is used with DefaultInmemSignal + DefaultSignal = metrics.DefaultSignal +) + +func AddSample(key []string, val float32) { + metrics.AddSample(key, val) +} +func AddSampleWithLabels(key []string, val float32, labels []Label) { + metrics.AddSampleWithLabels(key, val, labels) +} +func EmitKey(key []string, val float32) { + metrics.EmitKey(key, val) +} +func IncrCounter(key []string, val float32) { + metrics.IncrCounter(key, val) +} +func IncrCounterWithLabels(key []string, val float32, labels []Label) { + metrics.IncrCounterWithLabels(key, val, labels) +} +func MeasureSince(key []string, start time.Time) { + metrics.MeasureSince(key, start) +} +func MeasureSinceWithLabels(key []string, start time.Time, labels []Label) { + metrics.MeasureSinceWithLabels(key, start, labels) +} +func SetGauge(key []string, val float32) { + metrics.SetGauge(key, val) +} +func SetGaugeWithLabels(key []string, val float32, labels []Label) { + metrics.SetGaugeWithLabels(key, val, labels) +} +func Shutdown() { + metrics.Shutdown() +} +func UpdateFilter(allow, block []string) { + metrics.UpdateFilter(allow, block) +} +func UpdateFilterAndLabels(allow, block, allowedLabels, blockedLabels []string) { + metrics.UpdateFilterAndLabels(allow, block, allowedLabels, blockedLabels) +} + +type AggregateSample = metrics.AggregateSample +type BlackholeSink = metrics.BlackholeSink +type Config = metrics.Config +type Encoder = metrics.Encoder +type FanoutSink = metrics.FanoutSink +type GaugeValue = metrics.GaugeValue +type InmemSignal = metrics.InmemSignal +type InmemSink = metrics.InmemSink +type IntervalMetrics = metrics.IntervalMetrics +type Label = metrics.Label +type MetricSink = metrics.MetricSink +type Metrics = metrics.Metrics +type MetricsSummary = metrics.MetricsSummary +type PointValue = metrics.PointValue +type SampledValue = metrics.SampledValue +type ShutdownSink = metrics.ShutdownSink +type StatsdSink = metrics.StatsdSink +type StatsiteSink = metrics.StatsiteSink + +func DefaultConfig(serviceName string) *Config { + return metrics.DefaultConfig(serviceName) +} + +func DefaultInmemSignal(inmem *InmemSink) *InmemSignal { + return metrics.DefaultInmemSignal(inmem) +} +func NewInmemSignal(inmem *InmemSink, sig syscall.Signal, w io.Writer) *InmemSignal { + return metrics.NewInmemSignal(inmem, sig, w) +} + +func NewInmemSink(interval, retain time.Duration) *InmemSink { + return metrics.NewInmemSink(interval, retain) +} + +func NewIntervalMetrics(intv time.Time) *IntervalMetrics { + return metrics.NewIntervalMetrics(intv) +} + +func NewInmemSinkFromURL(u *url.URL) (MetricSink, error) { + return metrics.NewInmemSinkFromURL(u) +} + +func NewMetricSinkFromURL(urlStr string) (MetricSink, error) { + return metrics.NewMetricSinkFromURL(urlStr) +} + +func NewStatsdSinkFromURL(u *url.URL) (MetricSink, error) { + return metrics.NewStatsdSinkFromURL(u) +} + +func NewStatsiteSinkFromURL(u *url.URL) (MetricSink, error) { + return metrics.NewStatsiteSinkFromURL(u) +} + +func Default() *Metrics { + return metrics.Default() +} + +func New(conf *Config, sink MetricSink) (*Metrics, error) { + return metrics.New(conf, sink) +} + +func NewGlobal(conf *Config, sink MetricSink) (*Metrics, error) { + return metrics.NewGlobal(conf, sink) +} + +func NewStatsdSink(addr string) (*StatsdSink, error) { + return metrics.NewStatsdSink(addr) +} + +func NewStatsiteSink(addr string) (*StatsiteSink, error) { + return metrics.NewStatsiteSink(addr) +} diff --git a/vendor/github.com/hashicorp/go-metrics/compat/hashicorp.go b/vendor/github.com/hashicorp/go-metrics/compat/hashicorp.go new file mode 100644 index 00000000..144578f9 --- /dev/null +++ b/vendor/github.com/hashicorp/go-metrics/compat/hashicorp.go @@ -0,0 +1,129 @@ +//go:build hashicorpmetrics +// +build hashicorpmetrics + +package metrics + +import ( + "io" + "net/url" + "syscall" + "time" + + "github.com/hashicorp/go-metrics" +) + +const ( + // DefaultSignal is used with DefaultInmemSignal + DefaultSignal = metrics.DefaultSignal +) + +func AddSample(key []string, val float32) { + metrics.AddSample(key, val) +} +func AddSampleWithLabels(key []string, val float32, labels []Label) { + metrics.AddSampleWithLabels(key, val, labels) +} +func EmitKey(key []string, val float32) { + metrics.EmitKey(key, val) +} +func IncrCounter(key []string, val float32) { + metrics.IncrCounter(key, val) +} +func IncrCounterWithLabels(key []string, val float32, labels []Label) { + metrics.IncrCounterWithLabels(key, val, labels) +} +func MeasureSince(key []string, start time.Time) { + metrics.MeasureSince(key, start) +} +func MeasureSinceWithLabels(key []string, start time.Time, labels []Label) { + metrics.MeasureSinceWithLabels(key, start, labels) +} +func SetGauge(key []string, val float32) { + metrics.SetGauge(key, val) +} +func SetGaugeWithLabels(key []string, val float32, labels []Label) { + metrics.SetGaugeWithLabels(key, val, labels) +} +func Shutdown() { + metrics.Shutdown() +} +func UpdateFilter(allow, block []string) { + metrics.UpdateFilter(allow, block) +} +func UpdateFilterAndLabels(allow, block, allowedLabels, blockedLabels []string) { + metrics.UpdateFilterAndLabels(allow, block, allowedLabels, blockedLabels) +} + +type AggregateSample = metrics.AggregateSample +type BlackholeSink = metrics.BlackholeSink +type Config = metrics.Config +type Encoder = metrics.Encoder +type FanoutSink = metrics.FanoutSink +type GaugeValue = metrics.GaugeValue +type InmemSignal = metrics.InmemSignal +type InmemSink = metrics.InmemSink +type IntervalMetrics = metrics.IntervalMetrics +type Label = metrics.Label +type MetricSink = metrics.MetricSink +type Metrics = metrics.Metrics +type MetricsSummary = metrics.MetricsSummary +type PointValue = metrics.PointValue +type SampledValue = metrics.SampledValue +type ShutdownSink = metrics.ShutdownSink +type StatsdSink = metrics.StatsdSink +type StatsiteSink = metrics.StatsiteSink + +func DefaultConfig(serviceName string) *Config { + return metrics.DefaultConfig(serviceName) +} + +func DefaultInmemSignal(inmem *InmemSink) *InmemSignal { + return metrics.DefaultInmemSignal(inmem) +} +func NewInmemSignal(inmem *InmemSink, sig syscall.Signal, w io.Writer) *InmemSignal { + return metrics.NewInmemSignal(inmem, sig, w) +} + +func NewInmemSink(interval, retain time.Duration) *InmemSink { + return metrics.NewInmemSink(interval, retain) +} + +func NewIntervalMetrics(intv time.Time) *IntervalMetrics { + return metrics.NewIntervalMetrics(intv) +} + +func NewInmemSinkFromURL(u *url.URL) (MetricSink, error) { + return metrics.NewInmemSinkFromURL(u) +} + +func NewMetricSinkFromURL(urlStr string) (MetricSink, error) { + return metrics.NewMetricSinkFromURL(urlStr) +} + +func NewStatsdSinkFromURL(u *url.URL) (MetricSink, error) { + return metrics.NewStatsdSinkFromURL(u) +} + +func NewStatsiteSinkFromURL(u *url.URL) (MetricSink, error) { + return metrics.NewStatsiteSinkFromURL(u) +} + +func Default() *Metrics { + return metrics.Default() +} + +func New(conf *Config, sink MetricSink) (*Metrics, error) { + return metrics.New(conf, sink) +} + +func NewGlobal(conf *Config, sink MetricSink) (*Metrics, error) { + return metrics.NewGlobal(conf, sink) +} + +func NewStatsdSink(addr string) (*StatsdSink, error) { + return metrics.NewStatsdSink(addr) +} + +func NewStatsiteSink(addr string) (*StatsiteSink, error) { + return metrics.NewStatsiteSink(addr) +} diff --git a/vendor/github.com/hashicorp/go-metrics/const_js.go b/vendor/github.com/hashicorp/go-metrics/const_js.go new file mode 100644 index 00000000..3fa3f725 --- /dev/null +++ b/vendor/github.com/hashicorp/go-metrics/const_js.go @@ -0,0 +1,9 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MIT + +package metrics + +const ( + // DefaultSignal is used with DefaultInmemSignal + DefaultSignal = 0x1e +) diff --git a/vendor/github.com/hashicorp/go-metrics/const_unix.go b/vendor/github.com/hashicorp/go-metrics/const_unix.go new file mode 100644 index 00000000..6df46d2e --- /dev/null +++ b/vendor/github.com/hashicorp/go-metrics/const_unix.go @@ -0,0 +1,16 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MIT + +//go:build !windows && !js +// +build !windows,!js + +package metrics + +import ( + "syscall" +) + +const ( + // DefaultSignal is used with DefaultInmemSignal + DefaultSignal = syscall.SIGUSR1 +) diff --git a/vendor/github.com/hashicorp/go-metrics/const_windows.go b/vendor/github.com/hashicorp/go-metrics/const_windows.go new file mode 100644 index 00000000..11cb785f --- /dev/null +++ b/vendor/github.com/hashicorp/go-metrics/const_windows.go @@ -0,0 +1,16 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MIT + +// +build windows + +package metrics + +import ( + "syscall" +) + +const ( + // DefaultSignal is used with DefaultInmemSignal + // Windows has no SIGUSR1, use SIGBREAK + DefaultSignal = syscall.Signal(21) +) diff --git a/vendor/github.com/hashicorp/go-metrics/inmem.go b/vendor/github.com/hashicorp/go-metrics/inmem.go new file mode 100644 index 00000000..721a8b9e --- /dev/null +++ b/vendor/github.com/hashicorp/go-metrics/inmem.go @@ -0,0 +1,363 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MIT + +package metrics + +import ( + "bytes" + "fmt" + "math" + "net/url" + "strings" + "sync" + "time" +) + +var spaceReplacer = strings.NewReplacer(" ", "_") + +// InmemSink provides a MetricSink that does in-memory aggregation +// without sending metrics over a network. It can be embedded within +// an application to provide profiling information. +type InmemSink struct { + // How long is each aggregation interval + interval time.Duration + + // Retain controls how many metrics interval we keep + retain time.Duration + + // maxIntervals is the maximum length of intervals. + // It is retain / interval. + maxIntervals int + + // intervals is a slice of the retained intervals + intervals []*IntervalMetrics + intervalLock sync.RWMutex + + rateDenom float64 +} + +// IntervalMetrics stores the aggregated metrics +// for a specific interval +type IntervalMetrics struct { + sync.RWMutex + + // The start time of the interval + Interval time.Time + + // Gauges maps the key to the last set value + Gauges map[string]GaugeValue + + // PrecisionGauges maps the key to the last set value + PrecisionGauges map[string]PrecisionGaugeValue + + // Points maps the string to the list of emitted values + // from EmitKey + Points map[string][]float32 + + // Counters maps the string key to a sum of the counter + // values + Counters map[string]SampledValue + + // Samples maps the key to an AggregateSample, + // which has the rolled up view of a sample + Samples map[string]SampledValue + + // done is closed when this interval has ended, and a new IntervalMetrics + // has been created to receive any future metrics. + done chan struct{} +} + +// NewIntervalMetrics creates a new IntervalMetrics for a given interval +func NewIntervalMetrics(intv time.Time) *IntervalMetrics { + return &IntervalMetrics{ + Interval: intv, + Gauges: make(map[string]GaugeValue), + PrecisionGauges: make(map[string]PrecisionGaugeValue), + Points: make(map[string][]float32), + Counters: make(map[string]SampledValue), + Samples: make(map[string]SampledValue), + done: make(chan struct{}), + } +} + +// AggregateSample is used to hold aggregate metrics +// about a sample +type AggregateSample struct { + Count int // The count of emitted pairs + Rate float64 // The values rate per time unit (usually 1 second) + Sum float64 // The sum of values + SumSq float64 `json:"-"` // The sum of squared values + Min float64 // Minimum value + Max float64 // Maximum value + LastUpdated time.Time `json:"-"` // When value was last updated +} + +// Computes a Stddev of the values +func (a *AggregateSample) Stddev() float64 { + num := (float64(a.Count) * a.SumSq) - math.Pow(a.Sum, 2) + div := float64(a.Count * (a.Count - 1)) + if div == 0 { + return 0 + } + return math.Sqrt(num / div) +} + +// Computes a mean of the values +func (a *AggregateSample) Mean() float64 { + if a.Count == 0 { + return 0 + } + return a.Sum / float64(a.Count) +} + +// Ingest is used to update a sample +func (a *AggregateSample) Ingest(v float64, rateDenom float64) { + a.Count++ + a.Sum += v + a.SumSq += (v * v) + if v < a.Min || a.Count == 1 { + a.Min = v + } + if v > a.Max || a.Count == 1 { + a.Max = v + } + a.Rate = float64(a.Sum) / rateDenom + a.LastUpdated = time.Now() +} + +func (a *AggregateSample) String() string { + if a.Count == 0 { + return "Count: 0" + } else if a.Stddev() == 0 { + return fmt.Sprintf("Count: %d Sum: %0.3f LastUpdated: %s", a.Count, a.Sum, a.LastUpdated) + } else { + return fmt.Sprintf("Count: %d Min: %0.3f Mean: %0.3f Max: %0.3f Stddev: %0.3f Sum: %0.3f LastUpdated: %s", + a.Count, a.Min, a.Mean(), a.Max, a.Stddev(), a.Sum, a.LastUpdated) + } +} + +// NewInmemSinkFromURL creates an InmemSink from a URL. It is used +// (and tested) from NewMetricSinkFromURL. +func NewInmemSinkFromURL(u *url.URL) (MetricSink, error) { + params := u.Query() + + interval, err := time.ParseDuration(params.Get("interval")) + if err != nil { + return nil, fmt.Errorf("Bad 'interval' param: %s", err) + } + + retain, err := time.ParseDuration(params.Get("retain")) + if err != nil { + return nil, fmt.Errorf("Bad 'retain' param: %s", err) + } + + return NewInmemSink(interval, retain), nil +} + +// NewInmemSink is used to construct a new in-memory sink. +// Uses an aggregation interval and maximum retention period. +func NewInmemSink(interval, retain time.Duration) *InmemSink { + rateTimeUnit := time.Second + i := &InmemSink{ + interval: interval, + retain: retain, + maxIntervals: int(retain / interval), + rateDenom: float64(interval.Nanoseconds()) / float64(rateTimeUnit.Nanoseconds()), + } + i.intervals = make([]*IntervalMetrics, 0, i.maxIntervals) + return i +} + +func (i *InmemSink) SetGauge(key []string, val float32) { + i.SetGaugeWithLabels(key, val, nil) +} + +func (i *InmemSink) SetGaugeWithLabels(key []string, val float32, labels []Label) { + k, name := i.flattenKeyLabels(key, labels) + intv := i.getInterval() + + intv.Lock() + defer intv.Unlock() + intv.Gauges[k] = GaugeValue{Name: name, Value: val, Labels: labels} +} + +func (i *InmemSink) SetPrecisionGauge(key []string, val float64) { + i.SetPrecisionGaugeWithLabels(key, val, nil) +} + +func (i *InmemSink) SetPrecisionGaugeWithLabels(key []string, val float64, labels []Label) { + k, name := i.flattenKeyLabels(key, labels) + intv := i.getInterval() + + intv.Lock() + defer intv.Unlock() + intv.PrecisionGauges[k] = PrecisionGaugeValue{Name: name, Value: val, Labels: labels} +} + +func (i *InmemSink) EmitKey(key []string, val float32) { + k := i.flattenKey(key) + intv := i.getInterval() + + intv.Lock() + defer intv.Unlock() + vals := intv.Points[k] + intv.Points[k] = append(vals, val) +} + +func (i *InmemSink) IncrCounter(key []string, val float32) { + i.IncrCounterWithLabels(key, val, nil) +} + +func (i *InmemSink) IncrCounterWithLabels(key []string, val float32, labels []Label) { + k, name := i.flattenKeyLabels(key, labels) + intv := i.getInterval() + + intv.Lock() + defer intv.Unlock() + + agg, ok := intv.Counters[k] + if !ok { + agg = SampledValue{ + Name: name, + AggregateSample: &AggregateSample{}, + Labels: labels, + } + intv.Counters[k] = agg + } + agg.Ingest(float64(val), i.rateDenom) +} + +func (i *InmemSink) AddSample(key []string, val float32) { + i.AddSampleWithLabels(key, val, nil) +} + +func (i *InmemSink) AddSampleWithLabels(key []string, val float32, labels []Label) { + k, name := i.flattenKeyLabels(key, labels) + intv := i.getInterval() + + intv.Lock() + defer intv.Unlock() + + agg, ok := intv.Samples[k] + if !ok { + agg = SampledValue{ + Name: name, + AggregateSample: &AggregateSample{}, + Labels: labels, + } + intv.Samples[k] = agg + } + agg.Ingest(float64(val), i.rateDenom) +} + +// Data is used to retrieve all the aggregated metrics +// Intervals may be in use, and a read lock should be acquired +func (i *InmemSink) Data() []*IntervalMetrics { + // Get the current interval, forces creation + i.getInterval() + + i.intervalLock.RLock() + defer i.intervalLock.RUnlock() + + n := len(i.intervals) + intervals := make([]*IntervalMetrics, n) + + copy(intervals[:n-1], i.intervals[:n-1]) + current := i.intervals[n-1] + + // make its own copy for current interval + intervals[n-1] = &IntervalMetrics{} + copyCurrent := intervals[n-1] + current.RLock() + *copyCurrent = *current + // RWMutex is not safe to copy, so create a new instance on the copy + copyCurrent.RWMutex = sync.RWMutex{} + + copyCurrent.Gauges = make(map[string]GaugeValue, len(current.Gauges)) + for k, v := range current.Gauges { + copyCurrent.Gauges[k] = v + } + copyCurrent.PrecisionGauges = make(map[string]PrecisionGaugeValue, len(current.PrecisionGauges)) + for k, v := range current.PrecisionGauges { + copyCurrent.PrecisionGauges[k] = v + } + // saved values will be not change, just copy its link + copyCurrent.Points = make(map[string][]float32, len(current.Points)) + for k, v := range current.Points { + copyCurrent.Points[k] = v + } + copyCurrent.Counters = make(map[string]SampledValue, len(current.Counters)) + for k, v := range current.Counters { + copyCurrent.Counters[k] = v.deepCopy() + } + copyCurrent.Samples = make(map[string]SampledValue, len(current.Samples)) + for k, v := range current.Samples { + copyCurrent.Samples[k] = v.deepCopy() + } + current.RUnlock() + + return intervals +} + +// getInterval returns the current interval. A new interval is created if no +// previous interval exists, or if the current time is beyond the window for the +// current interval. +func (i *InmemSink) getInterval() *IntervalMetrics { + intv := time.Now().Truncate(i.interval) + + // Attempt to return the existing interval first, because it only requires + // a read lock. + i.intervalLock.RLock() + n := len(i.intervals) + if n > 0 && i.intervals[n-1].Interval == intv { + defer i.intervalLock.RUnlock() + return i.intervals[n-1] + } + i.intervalLock.RUnlock() + + i.intervalLock.Lock() + defer i.intervalLock.Unlock() + + // Re-check for an existing interval now that the lock is re-acquired. + n = len(i.intervals) + if n > 0 && i.intervals[n-1].Interval == intv { + return i.intervals[n-1] + } + + current := NewIntervalMetrics(intv) + i.intervals = append(i.intervals, current) + if n > 0 { + close(i.intervals[n-1].done) + } + + n++ + // Prune old intervals if the count exceeds the max. + if n >= i.maxIntervals { + copy(i.intervals[0:], i.intervals[n-i.maxIntervals:]) + i.intervals = i.intervals[:i.maxIntervals] + } + return current +} + +// Flattens the key for formatting, removes spaces +func (i *InmemSink) flattenKey(parts []string) string { + buf := &bytes.Buffer{} + + joined := strings.Join(parts, ".") + + spaceReplacer.WriteString(buf, joined) + + return buf.String() +} + +// Flattens the key for formatting along with its labels, removes spaces +func (i *InmemSink) flattenKeyLabels(parts []string, labels []Label) (string, string) { + key := i.flattenKey(parts) + buf := bytes.NewBufferString(key) + + for _, label := range labels { + spaceReplacer.WriteString(buf, fmt.Sprintf(";%s=%s", label.Name, label.Value)) + } + + return buf.String(), key +} diff --git a/vendor/github.com/hashicorp/go-metrics/inmem_endpoint.go b/vendor/github.com/hashicorp/go-metrics/inmem_endpoint.go new file mode 100644 index 00000000..2fc06389 --- /dev/null +++ b/vendor/github.com/hashicorp/go-metrics/inmem_endpoint.go @@ -0,0 +1,190 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MIT + +package metrics + +import ( + "context" + "fmt" + "net/http" + "sort" + "time" +) + +// MetricsSummary holds a roll-up of metrics info for a given interval +type MetricsSummary struct { + Timestamp string + Gauges []GaugeValue + PrecisionGauges []PrecisionGaugeValue + Points []PointValue + Counters []SampledValue + Samples []SampledValue +} + +type GaugeValue struct { + Name string + Hash string `json:"-"` + Value float32 + + Labels []Label `json:"-"` + DisplayLabels map[string]string `json:"Labels"` +} + +type PrecisionGaugeValue struct { + Name string + Hash string `json:"-"` + Value float64 + + Labels []Label `json:"-"` + DisplayLabels map[string]string `json:"Labels"` +} + +type PointValue struct { + Name string + Points []float32 +} + +type SampledValue struct { + Name string + Hash string `json:"-"` + *AggregateSample + Mean float64 + Stddev float64 + + Labels []Label `json:"-"` + DisplayLabels map[string]string `json:"Labels"` +} + +// deepCopy allocates a new instance of AggregateSample +func (source *SampledValue) deepCopy() SampledValue { + dest := *source + if source.AggregateSample != nil { + dest.AggregateSample = &AggregateSample{} + *dest.AggregateSample = *source.AggregateSample + } + return dest +} + +// DisplayMetrics returns a summary of the metrics from the most recent finished interval. +func (i *InmemSink) DisplayMetrics(resp http.ResponseWriter, req *http.Request) (interface{}, error) { + data := i.Data() + + var interval *IntervalMetrics + n := len(data) + switch { + case n == 0: + return nil, fmt.Errorf("no metric intervals have been initialized yet") + case n == 1: + // Show the current interval if it's all we have + interval = data[0] + default: + // Show the most recent finished interval if we have one + interval = data[n-2] + } + + return newMetricSummaryFromInterval(interval), nil +} + +func newMetricSummaryFromInterval(interval *IntervalMetrics) MetricsSummary { + interval.RLock() + defer interval.RUnlock() + + summary := MetricsSummary{ + Timestamp: interval.Interval.Round(time.Second).UTC().String(), + Gauges: make([]GaugeValue, 0, len(interval.Gauges)), + PrecisionGauges: make([]PrecisionGaugeValue, 0, len(interval.PrecisionGauges)), + Points: make([]PointValue, 0, len(interval.Points)), + } + + // Format and sort the output of each metric type, so it gets displayed in a + // deterministic order. + for name, points := range interval.Points { + summary.Points = append(summary.Points, PointValue{name, points}) + } + sort.Slice(summary.Points, func(i, j int) bool { + return summary.Points[i].Name < summary.Points[j].Name + }) + + for hash, value := range interval.Gauges { + value.Hash = hash + value.DisplayLabels = make(map[string]string) + for _, label := range value.Labels { + value.DisplayLabels[label.Name] = label.Value + } + value.Labels = nil + + summary.Gauges = append(summary.Gauges, value) + } + sort.Slice(summary.Gauges, func(i, j int) bool { + return summary.Gauges[i].Hash < summary.Gauges[j].Hash + }) + + for hash, value := range interval.PrecisionGauges { + value.Hash = hash + value.DisplayLabels = make(map[string]string) + for _, label := range value.Labels { + value.DisplayLabels[label.Name] = label.Value + } + value.Labels = nil + + summary.PrecisionGauges = append(summary.PrecisionGauges, value) + } + sort.Slice(summary.PrecisionGauges, func(i, j int) bool { + return summary.PrecisionGauges[i].Hash < summary.PrecisionGauges[j].Hash + }) + + summary.Counters = formatSamples(interval.Counters) + summary.Samples = formatSamples(interval.Samples) + + return summary +} + +func formatSamples(source map[string]SampledValue) []SampledValue { + output := make([]SampledValue, 0, len(source)) + for hash, sample := range source { + displayLabels := make(map[string]string) + for _, label := range sample.Labels { + displayLabels[label.Name] = label.Value + } + + output = append(output, SampledValue{ + Name: sample.Name, + Hash: hash, + AggregateSample: sample.AggregateSample, + Mean: sample.AggregateSample.Mean(), + Stddev: sample.AggregateSample.Stddev(), + DisplayLabels: displayLabels, + }) + } + sort.Slice(output, func(i, j int) bool { + return output[i].Hash < output[j].Hash + }) + + return output +} + +type Encoder interface { + Encode(interface{}) error +} + +// Stream writes metrics using encoder.Encode each time an interval ends. Runs +// until the request context is cancelled, or the encoder returns an error. +// The caller is responsible for logging any errors from encoder. +func (i *InmemSink) Stream(ctx context.Context, encoder Encoder) { + interval := i.getInterval() + + for { + select { + case <-interval.done: + summary := newMetricSummaryFromInterval(interval) + if err := encoder.Encode(summary); err != nil { + return + } + + // update interval to the next one + interval = i.getInterval() + case <-ctx.Done(): + return + } + } +} diff --git a/vendor/github.com/hashicorp/go-metrics/inmem_signal.go b/vendor/github.com/hashicorp/go-metrics/inmem_signal.go new file mode 100644 index 00000000..2711c258 --- /dev/null +++ b/vendor/github.com/hashicorp/go-metrics/inmem_signal.go @@ -0,0 +1,124 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MIT + +package metrics + +import ( + "bytes" + "fmt" + "io" + "os" + "os/signal" + "strings" + "sync" + "syscall" +) + +// InmemSignal is used to listen for a given signal, and when received, +// to dump the current metrics from the InmemSink to an io.Writer +type InmemSignal struct { + signal syscall.Signal + inm *InmemSink + w io.Writer + sigCh chan os.Signal + + stop bool + stopCh chan struct{} + stopLock sync.Mutex +} + +// NewInmemSignal creates a new InmemSignal which listens for a given signal, +// and dumps the current metrics out to a writer +func NewInmemSignal(inmem *InmemSink, sig syscall.Signal, w io.Writer) *InmemSignal { + i := &InmemSignal{ + signal: sig, + inm: inmem, + w: w, + sigCh: make(chan os.Signal, 1), + stopCh: make(chan struct{}), + } + signal.Notify(i.sigCh, sig) + go i.run() + return i +} + +// DefaultInmemSignal returns a new InmemSignal that responds to SIGUSR1 +// and writes output to stderr. Windows uses SIGBREAK +func DefaultInmemSignal(inmem *InmemSink) *InmemSignal { + return NewInmemSignal(inmem, DefaultSignal, os.Stderr) +} + +// Stop is used to stop the InmemSignal from listening +func (i *InmemSignal) Stop() { + i.stopLock.Lock() + defer i.stopLock.Unlock() + + if i.stop { + return + } + i.stop = true + close(i.stopCh) + signal.Stop(i.sigCh) +} + +// run is a long running routine that handles signals +func (i *InmemSignal) run() { + for { + select { + case <-i.sigCh: + i.dumpStats() + case <-i.stopCh: + return + } + } +} + +// dumpStats is used to dump the data to output writer +func (i *InmemSignal) dumpStats() { + buf := bytes.NewBuffer(nil) + + data := i.inm.Data() + // Skip the last period which is still being aggregated + for j := 0; j < len(data)-1; j++ { + intv := data[j] + intv.RLock() + for _, val := range intv.Gauges { + name := i.flattenLabels(val.Name, val.Labels) + fmt.Fprintf(buf, "[%v][G] '%s': %0.3f\n", intv.Interval, name, val.Value) + } + for _, val := range intv.PrecisionGauges { + name := i.flattenLabels(val.Name, val.Labels) + fmt.Fprintf(buf, "[%v][G] '%s': %0.3f\n", intv.Interval, name, val.Value) + } + for name, vals := range intv.Points { + for _, val := range vals { + fmt.Fprintf(buf, "[%v][P] '%s': %0.3f\n", intv.Interval, name, val) + } + } + for _, agg := range intv.Counters { + name := i.flattenLabels(agg.Name, agg.Labels) + fmt.Fprintf(buf, "[%v][C] '%s': %s\n", intv.Interval, name, agg.AggregateSample) + } + for _, agg := range intv.Samples { + name := i.flattenLabels(agg.Name, agg.Labels) + fmt.Fprintf(buf, "[%v][S] '%s': %s\n", intv.Interval, name, agg.AggregateSample) + } + intv.RUnlock() + } + + // Write out the bytes + i.w.Write(buf.Bytes()) +} + +// Flattens the key for formatting along with its labels, removes spaces +func (i *InmemSignal) flattenLabels(name string, labels []Label) string { + buf := bytes.NewBufferString(name) + replacer := strings.NewReplacer(" ", "_", ":", "_") + + for _, label := range labels { + replacer.WriteString(buf, ".") + replacer.WriteString(buf, label.Value) + } + + return buf.String() +} diff --git a/vendor/github.com/hashicorp/go-metrics/metrics.go b/vendor/github.com/hashicorp/go-metrics/metrics.go new file mode 100644 index 00000000..34478865 --- /dev/null +++ b/vendor/github.com/hashicorp/go-metrics/metrics.go @@ -0,0 +1,336 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MIT + +package metrics + +import ( + "runtime" + "strings" + "time" + + iradix "github.com/hashicorp/go-immutable-radix" +) + +type Label struct { + Name string + Value string +} + +func (m *Metrics) SetGauge(key []string, val float32) { + m.SetGaugeWithLabels(key, val, nil) +} + +func (m *Metrics) SetGaugeWithLabels(key []string, val float32, labels []Label) { + if m.HostName != "" { + if m.EnableHostnameLabel { + labels = append(labels, Label{"host", m.HostName}) + } else if m.EnableHostname { + key = insert(0, m.HostName, key) + } + } + if m.EnableTypePrefix { + key = insert(0, "gauge", key) + } + if m.ServiceName != "" { + if m.EnableServiceLabel { + labels = append(labels, Label{"service", m.ServiceName}) + } else { + key = insert(0, m.ServiceName, key) + } + } + allowed, labelsFiltered := m.allowMetric(key, labels) + if !allowed { + return + } + m.sink.SetGaugeWithLabels(key, val, labelsFiltered) +} + +func (m *Metrics) SetPrecisionGauge(key []string, val float64) { + m.SetPrecisionGaugeWithLabels(key, val, nil) +} + +func (m *Metrics) SetPrecisionGaugeWithLabels(key []string, val float64, labels []Label) { + if m.HostName != "" { + if m.EnableHostnameLabel { + labels = append(labels, Label{"host", m.HostName}) + } else if m.EnableHostname { + key = insert(0, m.HostName, key) + } + } + if m.EnableTypePrefix { + key = insert(0, "gauge", key) + } + if m.ServiceName != "" { + if m.EnableServiceLabel { + labels = append(labels, Label{"service", m.ServiceName}) + } else { + key = insert(0, m.ServiceName, key) + } + } + allowed, labelsFiltered := m.allowMetric(key, labels) + if !allowed { + return + } + sink, ok := m.sink.(PrecisionGaugeMetricSink) + if !ok { + // Sink does not implement PrecisionGaugeMetricSink. + } else { + sink.SetPrecisionGaugeWithLabels(key, val, labelsFiltered) + } +} + +func (m *Metrics) EmitKey(key []string, val float32) { + if m.EnableTypePrefix { + key = insert(0, "kv", key) + } + if m.ServiceName != "" { + key = insert(0, m.ServiceName, key) + } + allowed, _ := m.allowMetric(key, nil) + if !allowed { + return + } + m.sink.EmitKey(key, val) +} + +func (m *Metrics) IncrCounter(key []string, val float32) { + m.IncrCounterWithLabels(key, val, nil) +} + +func (m *Metrics) IncrCounterWithLabels(key []string, val float32, labels []Label) { + if m.HostName != "" && m.EnableHostnameLabel { + labels = append(labels, Label{"host", m.HostName}) + } + if m.EnableTypePrefix { + key = insert(0, "counter", key) + } + if m.ServiceName != "" { + if m.EnableServiceLabel { + labels = append(labels, Label{"service", m.ServiceName}) + } else { + key = insert(0, m.ServiceName, key) + } + } + allowed, labelsFiltered := m.allowMetric(key, labels) + if !allowed { + return + } + m.sink.IncrCounterWithLabels(key, val, labelsFiltered) +} + +func (m *Metrics) AddSample(key []string, val float32) { + m.AddSampleWithLabels(key, val, nil) +} + +func (m *Metrics) AddSampleWithLabels(key []string, val float32, labels []Label) { + if m.HostName != "" && m.EnableHostnameLabel { + labels = append(labels, Label{"host", m.HostName}) + } + if m.EnableTypePrefix { + key = insert(0, "sample", key) + } + if m.ServiceName != "" { + if m.EnableServiceLabel { + labels = append(labels, Label{"service", m.ServiceName}) + } else { + key = insert(0, m.ServiceName, key) + } + } + allowed, labelsFiltered := m.allowMetric(key, labels) + if !allowed { + return + } + m.sink.AddSampleWithLabels(key, val, labelsFiltered) +} + +func (m *Metrics) MeasureSince(key []string, start time.Time) { + m.MeasureSinceWithLabels(key, start, nil) +} + +func (m *Metrics) MeasureSinceWithLabels(key []string, start time.Time, labels []Label) { + if m.HostName != "" && m.EnableHostnameLabel { + labels = append(labels, Label{"host", m.HostName}) + } + if m.EnableTypePrefix { + key = insert(0, "timer", key) + } + if m.ServiceName != "" { + if m.EnableServiceLabel { + labels = append(labels, Label{"service", m.ServiceName}) + } else { + key = insert(0, m.ServiceName, key) + } + } + allowed, labelsFiltered := m.allowMetric(key, labels) + if !allowed { + return + } + now := time.Now() + elapsed := now.Sub(start) + msec := float32(elapsed.Nanoseconds()) / float32(m.TimerGranularity) + m.sink.AddSampleWithLabels(key, msec, labelsFiltered) +} + +// UpdateFilter overwrites the existing filter with the given rules. +func (m *Metrics) UpdateFilter(allow, block []string) { + m.UpdateFilterAndLabels(allow, block, m.AllowedLabels, m.BlockedLabels) +} + +// UpdateFilterAndLabels overwrites the existing filter with the given rules. +func (m *Metrics) UpdateFilterAndLabels(allow, block, allowedLabels, blockedLabels []string) { + m.filterLock.Lock() + defer m.filterLock.Unlock() + + m.AllowedPrefixes = allow + m.BlockedPrefixes = block + + if allowedLabels == nil { + // Having a white list means we take only elements from it + m.allowedLabels = nil + } else { + m.allowedLabels = make(map[string]bool) + for _, v := range allowedLabels { + m.allowedLabels[v] = true + } + } + m.blockedLabels = make(map[string]bool) + for _, v := range blockedLabels { + m.blockedLabels[v] = true + } + m.AllowedLabels = allowedLabels + m.BlockedLabels = blockedLabels + + m.filter = iradix.New() + for _, prefix := range m.AllowedPrefixes { + m.filter, _, _ = m.filter.Insert([]byte(prefix), true) + } + for _, prefix := range m.BlockedPrefixes { + m.filter, _, _ = m.filter.Insert([]byte(prefix), false) + } +} + +func (m *Metrics) Shutdown() { + if ss, ok := m.sink.(ShutdownSink); ok { + ss.Shutdown() + } +} + +// labelIsAllowed return true if a should be included in metric +// the caller should lock m.filterLock while calling this method +func (m *Metrics) labelIsAllowed(label *Label) bool { + labelName := (*label).Name + if m.blockedLabels != nil { + _, ok := m.blockedLabels[labelName] + if ok { + // If present, let's remove this label + return false + } + } + if m.allowedLabels != nil { + _, ok := m.allowedLabels[labelName] + return ok + } + // Allow by default + return true +} + +// filterLabels return only allowed labels +// the caller should lock m.filterLock while calling this method +func (m *Metrics) filterLabels(labels []Label) []Label { + if labels == nil { + return nil + } + toReturn := []Label{} + for _, label := range labels { + if m.labelIsAllowed(&label) { + toReturn = append(toReturn, label) + } + } + return toReturn +} + +// Returns whether the metric should be allowed based on configured prefix filters +// Also return the applicable labels +func (m *Metrics) allowMetric(key []string, labels []Label) (bool, []Label) { + m.filterLock.RLock() + defer m.filterLock.RUnlock() + + if m.filter == nil || m.filter.Len() == 0 { + return m.Config.FilterDefault, m.filterLabels(labels) + } + + _, allowed, ok := m.filter.Root().LongestPrefix([]byte(strings.Join(key, "."))) + if !ok { + return m.Config.FilterDefault, m.filterLabels(labels) + } + + return allowed.(bool), m.filterLabels(labels) +} + +// Periodically collects runtime stats to publish +func (m *Metrics) collectStats() { + for { + time.Sleep(m.ProfileInterval) + m.EmitRuntimeStats() + } +} + +// Emits various runtime statsitics +func (m *Metrics) EmitRuntimeStats() { + // Export number of Goroutines + numRoutines := runtime.NumGoroutine() + m.SetGauge([]string{"runtime", "num_goroutines"}, float32(numRoutines)) + + // Export memory stats + var stats runtime.MemStats + runtime.ReadMemStats(&stats) + m.SetGauge([]string{"runtime", "alloc_bytes"}, float32(stats.Alloc)) + m.SetGauge([]string{"runtime", "sys_bytes"}, float32(stats.Sys)) + m.SetGauge([]string{"runtime", "malloc_count"}, float32(stats.Mallocs)) + m.SetGauge([]string{"runtime", "free_count"}, float32(stats.Frees)) + m.SetGauge([]string{"runtime", "heap_objects"}, float32(stats.HeapObjects)) + m.SetGauge([]string{"runtime", "total_gc_pause_ns"}, float32(stats.PauseTotalNs)) + m.SetGauge([]string{"runtime", "total_gc_runs"}, float32(stats.NumGC)) + + // Export info about the last few GC runs + num := stats.NumGC + + // Handle wrap around + if num < m.lastNumGC { + m.lastNumGC = 0 + } + + // Ensure we don't scan more than 256 + if num-m.lastNumGC >= 256 { + m.lastNumGC = num - 255 + } + + for i := m.lastNumGC; i < num; i++ { + pause := stats.PauseNs[i%256] + m.AddSample([]string{"runtime", "gc_pause_ns"}, float32(pause)) + } + m.lastNumGC = num +} + +// Creates a new slice with the provided string value as the first element +// and the provided slice values as the remaining values. +// Ordering of the values in the provided input slice is kept in tact in the output slice. +func insert(i int, v string, s []string) []string { + // Allocate new slice to avoid modifying the input slice + newS := make([]string, len(s)+1) + + // Copy s[0, i-1] into newS + for j := 0; j < i; j++ { + newS[j] = s[j] + } + + // Insert provided element at index i + newS[i] = v + + // Copy s[i, len(s)-1] into newS starting at newS[i+1] + for j := i; j < len(s); j++ { + newS[j+1] = s[j] + } + + return newS +} diff --git a/vendor/github.com/hashicorp/go-metrics/sink.go b/vendor/github.com/hashicorp/go-metrics/sink.go new file mode 100644 index 00000000..c9e520ff --- /dev/null +++ b/vendor/github.com/hashicorp/go-metrics/sink.go @@ -0,0 +1,156 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MIT + +package metrics + +import ( + "fmt" + "net/url" +) + +// The MetricSink interface is used to transmit metrics information +// to an external system +type MetricSink interface { + // A Gauge should retain the last value it is set to + SetGauge(key []string, val float32) + SetGaugeWithLabels(key []string, val float32, labels []Label) + + // Should emit a Key/Value pair for each call + EmitKey(key []string, val float32) + + // Counters should accumulate values + IncrCounter(key []string, val float32) + IncrCounterWithLabels(key []string, val float32, labels []Label) + + // Samples are for timing information, where quantiles are used + AddSample(key []string, val float32) + AddSampleWithLabels(key []string, val float32, labels []Label) +} + +// PrecisionGaugeMetricSink interfae is used to support 64 bit precisions for Sinks, if needed. +type PrecisionGaugeMetricSink interface { + SetPrecisionGauge(key []string, val float64) + SetPrecisionGaugeWithLabels(key []string, val float64, labels []Label) +} + +type ShutdownSink interface { + MetricSink + + // Shutdown the metric sink, flush metrics to storage, and cleanup resources. + // Called immediately prior to application exit. Implementations must block + // until metrics are flushed to storage. + Shutdown() +} + +// BlackholeSink is used to just blackhole messages +type BlackholeSink struct{} + +func (*BlackholeSink) SetGauge(key []string, val float32) {} +func (*BlackholeSink) SetGaugeWithLabels(key []string, val float32, labels []Label) {} +func (*BlackholeSink) SetPrecisionGauge(key []string, val float64) {} +func (*BlackholeSink) SetPrecisionGaugeWithLabels(key []string, val float64, labels []Label) {} +func (*BlackholeSink) EmitKey(key []string, val float32) {} +func (*BlackholeSink) IncrCounter(key []string, val float32) {} +func (*BlackholeSink) IncrCounterWithLabels(key []string, val float32, labels []Label) {} +func (*BlackholeSink) AddSample(key []string, val float32) {} +func (*BlackholeSink) AddSampleWithLabels(key []string, val float32, labels []Label) {} + +// FanoutSink is used to sink to fanout values to multiple sinks +type FanoutSink []MetricSink + +func (fh FanoutSink) SetGauge(key []string, val float32) { + fh.SetGaugeWithLabels(key, val, nil) +} + +func (fh FanoutSink) SetGaugeWithLabels(key []string, val float32, labels []Label) { + for _, s := range fh { + s.SetGaugeWithLabels(key, val, labels) + } +} + +func (fh FanoutSink) SetPrecisionGauge(key []string, val float64) { + fh.SetPrecisionGaugeWithLabels(key, val, nil) +} + +func (fh FanoutSink) SetPrecisionGaugeWithLabels(key []string, val float64, labels []Label) { + for _, s := range fh { + // The Sink needs to implement PrecisionGaugeMetricSink, in case it doesn't, the metric value won't be set and ingored instead + if s64, ok := s.(PrecisionGaugeMetricSink); ok { + s64.SetPrecisionGaugeWithLabels(key, val, labels) + } + } +} + +func (fh FanoutSink) EmitKey(key []string, val float32) { + for _, s := range fh { + s.EmitKey(key, val) + } +} + +func (fh FanoutSink) IncrCounter(key []string, val float32) { + fh.IncrCounterWithLabels(key, val, nil) +} + +func (fh FanoutSink) IncrCounterWithLabels(key []string, val float32, labels []Label) { + for _, s := range fh { + s.IncrCounterWithLabels(key, val, labels) + } +} + +func (fh FanoutSink) AddSample(key []string, val float32) { + fh.AddSampleWithLabels(key, val, nil) +} + +func (fh FanoutSink) AddSampleWithLabels(key []string, val float32, labels []Label) { + for _, s := range fh { + s.AddSampleWithLabels(key, val, labels) + } +} + +func (fh FanoutSink) Shutdown() { + for _, s := range fh { + if ss, ok := s.(ShutdownSink); ok { + ss.Shutdown() + } + } +} + +// sinkURLFactoryFunc is an generic interface around the *SinkFromURL() function provided +// by each sink type +type sinkURLFactoryFunc func(*url.URL) (MetricSink, error) + +// sinkRegistry supports the generic NewMetricSink function by mapping URL +// schemes to metric sink factory functions +var sinkRegistry = map[string]sinkURLFactoryFunc{ + "statsd": NewStatsdSinkFromURL, + "statsite": NewStatsiteSinkFromURL, + "inmem": NewInmemSinkFromURL, +} + +// NewMetricSinkFromURL allows a generic URL input to configure any of the +// supported sinks. The scheme of the URL identifies the type of the sink, the +// and query parameters are used to set options. +// +// "statsd://" - Initializes a StatsdSink. The host and port are passed through +// as the "addr" of the sink +// +// "statsite://" - Initializes a StatsiteSink. The host and port become the +// "addr" of the sink +// +// "inmem://" - Initializes an InmemSink. The host and port are ignored. The +// "interval" and "duration" query parameters must be specified with valid +// durations, see NewInmemSink for details. +func NewMetricSinkFromURL(urlStr string) (MetricSink, error) { + u, err := url.Parse(urlStr) + if err != nil { + return nil, err + } + + sinkURLFactoryFunc := sinkRegistry[u.Scheme] + if sinkURLFactoryFunc == nil { + return nil, fmt.Errorf( + "cannot create metric sink, unrecognized sink name: %q", u.Scheme) + } + + return sinkURLFactoryFunc(u) +} diff --git a/vendor/github.com/hashicorp/go-metrics/start.go b/vendor/github.com/hashicorp/go-metrics/start.go new file mode 100644 index 00000000..0862fe7f --- /dev/null +++ b/vendor/github.com/hashicorp/go-metrics/start.go @@ -0,0 +1,176 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MIT + +package metrics + +import ( + "os" + "sync" + "sync/atomic" + "time" + + iradix "github.com/hashicorp/go-immutable-radix" +) + +// Config is used to configure metrics settings +type Config struct { + ServiceName string // Prefixed with keys to separate services + HostName string // Hostname to use. If not provided and EnableHostname, it will be os.Hostname + EnableHostname bool // Enable prefixing gauge values with hostname + EnableHostnameLabel bool // Enable adding hostname to labels + EnableServiceLabel bool // Enable adding service to labels + EnableRuntimeMetrics bool // Enables profiling of runtime metrics (GC, Goroutines, Memory) + EnableTypePrefix bool // Prefixes key with a type ("counter", "gauge", "timer") + TimerGranularity time.Duration // Granularity of timers. + ProfileInterval time.Duration // Interval to profile runtime metrics + + AllowedPrefixes []string // A list of metric prefixes to allow, with '.' as the separator + BlockedPrefixes []string // A list of metric prefixes to block, with '.' as the separator + AllowedLabels []string // A list of metric labels to allow, with '.' as the separator + BlockedLabels []string // A list of metric labels to block, with '.' as the separator + FilterDefault bool // Whether to allow metrics by default +} + +// Metrics represents an instance of a metrics sink that can +// be used to emit +type Metrics struct { + Config + lastNumGC uint32 + sink MetricSink + filter *iradix.Tree + allowedLabels map[string]bool + blockedLabels map[string]bool + filterLock sync.RWMutex // Lock filters and allowedLabels/blockedLabels access +} + +// Shared global metrics instance +var globalMetrics atomic.Value // *Metrics + +func init() { + // Initialize to a blackhole sink to avoid errors + globalMetrics.Store(&Metrics{sink: &BlackholeSink{}}) +} + +// Default returns the shared global metrics instance. +func Default() *Metrics { + return globalMetrics.Load().(*Metrics) +} + +// DefaultConfig provides a sane default configuration +func DefaultConfig(serviceName string) *Config { + c := &Config{ + ServiceName: serviceName, // Use client provided service + HostName: "", + EnableHostname: true, // Enable hostname prefix + EnableRuntimeMetrics: true, // Enable runtime profiling + EnableTypePrefix: false, // Disable type prefix + TimerGranularity: time.Millisecond, // Timers are in milliseconds + ProfileInterval: time.Second, // Poll runtime every second + FilterDefault: true, // Don't filter metrics by default + } + + // Try to get the hostname + name, _ := os.Hostname() + c.HostName = name + return c +} + +// New is used to create a new instance of Metrics +func New(conf *Config, sink MetricSink) (*Metrics, error) { + met := &Metrics{} + met.Config = *conf + met.sink = sink + met.UpdateFilterAndLabels(conf.AllowedPrefixes, conf.BlockedPrefixes, conf.AllowedLabels, conf.BlockedLabels) + + // Start the runtime collector + if conf.EnableRuntimeMetrics { + go met.collectStats() + } + return met, nil +} + +// NewGlobal is the same as New, but it assigns the metrics object to be +// used globally as well as returning it. +func NewGlobal(conf *Config, sink MetricSink) (*Metrics, error) { + metrics, err := New(conf, sink) + if err == nil { + globalMetrics.Store(metrics) + } + return metrics, err +} + +// Proxy all the methods to the globalMetrics instance + +// Set gauge key and value with 32 bit precision +func SetGauge(key []string, val float32) { + globalMetrics.Load().(*Metrics).SetGauge(key, val) +} + +// Set gauge key and value with 32 bit precision +func SetGaugeWithLabels(key []string, val float32, labels []Label) { + globalMetrics.Load().(*Metrics).SetGaugeWithLabels(key, val, labels) +} + +// Set gauge key and value with 64 bit precision +// The Sink needs to implement PrecisionGaugeMetricSink, in case it doesn't, the metric value won't be set and ingored instead +func SetPrecisionGauge(key []string, val float64) { + globalMetrics.Load().(*Metrics).SetPrecisionGauge(key, val) +} + +// Set gauge key, value with 64 bit precision, and labels +// The Sink needs to implement PrecisionGaugeMetricSink, in case it doesn't, the metric value won't be set and ingored instead +func SetPrecisionGaugeWithLabels(key []string, val float64, labels []Label) { + globalMetrics.Load().(*Metrics).SetPrecisionGaugeWithLabels(key, val, labels) +} + +func EmitKey(key []string, val float32) { + globalMetrics.Load().(*Metrics).EmitKey(key, val) +} + +func IncrCounter(key []string, val float32) { + globalMetrics.Load().(*Metrics).IncrCounter(key, val) +} + +func IncrCounterWithLabels(key []string, val float32, labels []Label) { + globalMetrics.Load().(*Metrics).IncrCounterWithLabels(key, val, labels) +} + +func AddSample(key []string, val float32) { + globalMetrics.Load().(*Metrics).AddSample(key, val) +} + +func AddSampleWithLabels(key []string, val float32, labels []Label) { + globalMetrics.Load().(*Metrics).AddSampleWithLabels(key, val, labels) +} + +func MeasureSince(key []string, start time.Time) { + globalMetrics.Load().(*Metrics).MeasureSince(key, start) +} + +func MeasureSinceWithLabels(key []string, start time.Time, labels []Label) { + globalMetrics.Load().(*Metrics).MeasureSinceWithLabels(key, start, labels) +} + +func UpdateFilter(allow, block []string) { + globalMetrics.Load().(*Metrics).UpdateFilter(allow, block) +} + +// UpdateFilterAndLabels set allow/block prefixes of metrics while allowedLabels +// and blockedLabels - when not nil - allow filtering of labels in order to +// block/allow globally labels (especially useful when having large number of +// values for a given label). See README.md for more information about usage. +func UpdateFilterAndLabels(allow, block, allowedLabels, blockedLabels []string) { + globalMetrics.Load().(*Metrics).UpdateFilterAndLabels(allow, block, allowedLabels, blockedLabels) +} + +// Shutdown disables metric collection, then blocks while attempting to flush metrics to storage. +// WARNING: Not all MetricSink backends support this functionality, and calling this will cause them to leak resources. +// This is intended for use immediately prior to application exit. +func Shutdown() { + m := globalMetrics.Load().(*Metrics) + // Swap whatever MetricSink is currently active with a BlackholeSink. Callers must not have a + // reason to expect that calls to the library will successfully collect metrics after Shutdown + // has been called. + globalMetrics.Store(&Metrics{sink: &BlackholeSink{}}) + m.Shutdown() +} diff --git a/vendor/github.com/hashicorp/go-metrics/statsd.go b/vendor/github.com/hashicorp/go-metrics/statsd.go new file mode 100644 index 00000000..91abe1f8 --- /dev/null +++ b/vendor/github.com/hashicorp/go-metrics/statsd.go @@ -0,0 +1,197 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MIT + +package metrics + +import ( + "bytes" + "fmt" + "log" + "net" + "net/url" + "strings" + "time" +) + +const ( + // statsdMaxLen is the maximum size of a packet + // to send to statsd + statsdMaxLen = 1400 +) + +// StatsdSink provides a MetricSink that can be used +// with a statsite or statsd metrics server. It uses +// only UDP packets, while StatsiteSink uses TCP. +type StatsdSink struct { + addr string + metricQueue chan string +} + +// NewStatsdSinkFromURL creates an StatsdSink from a URL. It is used +// (and tested) from NewMetricSinkFromURL. +func NewStatsdSinkFromURL(u *url.URL) (MetricSink, error) { + return NewStatsdSink(u.Host) +} + +// NewStatsdSink is used to create a new StatsdSink +func NewStatsdSink(addr string) (*StatsdSink, error) { + s := &StatsdSink{ + addr: addr, + metricQueue: make(chan string, 4096), + } + go s.flushMetrics() + return s, nil +} + +// Close is used to stop flushing to statsd +func (s *StatsdSink) Shutdown() { + close(s.metricQueue) +} + +func (s *StatsdSink) SetGauge(key []string, val float32) { + flatKey := s.flattenKey(key) + s.pushMetric(fmt.Sprintf("%s:%f|g\n", flatKey, val)) +} + +func (s *StatsdSink) SetGaugeWithLabels(key []string, val float32, labels []Label) { + flatKey := s.flattenKeyLabels(key, labels) + s.pushMetric(fmt.Sprintf("%s:%f|g\n", flatKey, val)) +} + +func (s *StatsdSink) SetPrecisionGauge(key []string, val float64) { + flatKey := s.flattenKey(key) + s.pushMetric(fmt.Sprintf("%s:%f|g\n", flatKey, val)) +} + +func (s *StatsdSink) SetPrecisionGaugeWithLabels(key []string, val float64, labels []Label) { + flatKey := s.flattenKeyLabels(key, labels) + s.pushMetric(fmt.Sprintf("%s:%f|g\n", flatKey, val)) +} + +func (s *StatsdSink) EmitKey(key []string, val float32) { + flatKey := s.flattenKey(key) + s.pushMetric(fmt.Sprintf("%s:%f|kv\n", flatKey, val)) +} + +func (s *StatsdSink) IncrCounter(key []string, val float32) { + flatKey := s.flattenKey(key) + s.pushMetric(fmt.Sprintf("%s:%f|c\n", flatKey, val)) +} + +func (s *StatsdSink) IncrCounterWithLabels(key []string, val float32, labels []Label) { + flatKey := s.flattenKeyLabels(key, labels) + s.pushMetric(fmt.Sprintf("%s:%f|c\n", flatKey, val)) +} + +func (s *StatsdSink) AddSample(key []string, val float32) { + flatKey := s.flattenKey(key) + s.pushMetric(fmt.Sprintf("%s:%f|ms\n", flatKey, val)) +} + +func (s *StatsdSink) AddSampleWithLabels(key []string, val float32, labels []Label) { + flatKey := s.flattenKeyLabels(key, labels) + s.pushMetric(fmt.Sprintf("%s:%f|ms\n", flatKey, val)) +} + +// Flattens the key for formatting, removes spaces +func (s *StatsdSink) flattenKey(parts []string) string { + joined := strings.Join(parts, ".") + return strings.Map(func(r rune) rune { + switch r { + case ':': + fallthrough + case ' ': + return '_' + default: + return r + } + }, joined) +} + +// Flattens the key along with labels for formatting, removes spaces +func (s *StatsdSink) flattenKeyLabels(parts []string, labels []Label) string { + for _, label := range labels { + parts = append(parts, label.Value) + } + return s.flattenKey(parts) +} + +// Does a non-blocking push to the metrics queue +func (s *StatsdSink) pushMetric(m string) { + select { + case s.metricQueue <- m: + default: + } +} + +// Flushes metrics +func (s *StatsdSink) flushMetrics() { + var sock net.Conn + var err error + var wait <-chan time.Time + ticker := time.NewTicker(flushInterval) + defer ticker.Stop() + +CONNECT: + // Create a buffer + buf := bytes.NewBuffer(nil) + + // Attempt to connect + sock, err = net.Dial("udp", s.addr) + if err != nil { + log.Printf("[ERR] Error connecting to statsd! Err: %s", err) + goto WAIT + } + + for { + select { + case metric, ok := <-s.metricQueue: + // Get a metric from the queue + if !ok { + goto QUIT + } + + // Check if this would overflow the packet size + if len(metric)+buf.Len() > statsdMaxLen { + _, err := sock.Write(buf.Bytes()) + buf.Reset() + if err != nil { + log.Printf("[ERR] Error writing to statsd! Err: %s", err) + goto WAIT + } + } + + // Append to the buffer + buf.WriteString(metric) + + case <-ticker.C: + if buf.Len() == 0 { + continue + } + + _, err := sock.Write(buf.Bytes()) + buf.Reset() + if err != nil { + log.Printf("[ERR] Error flushing to statsd! Err: %s", err) + goto WAIT + } + } + } + +WAIT: + // Wait for a while + wait = time.After(time.Duration(5) * time.Second) + for { + select { + // Dequeue the messages to avoid backlog + case _, ok := <-s.metricQueue: + if !ok { + goto QUIT + } + case <-wait: + goto CONNECT + } + } +QUIT: + s.metricQueue = nil +} diff --git a/vendor/github.com/hashicorp/go-metrics/statsite.go b/vendor/github.com/hashicorp/go-metrics/statsite.go new file mode 100644 index 00000000..13f18ed4 --- /dev/null +++ b/vendor/github.com/hashicorp/go-metrics/statsite.go @@ -0,0 +1,185 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MIT + +package metrics + +import ( + "bufio" + "fmt" + "log" + "net" + "net/url" + "strings" + "time" +) + +const ( + // We force flush the statsite metrics after this period of + // inactivity. Prevents stats from getting stuck in a buffer + // forever. + flushInterval = 100 * time.Millisecond +) + +// NewStatsiteSinkFromURL creates an StatsiteSink from a URL. It is used +// (and tested) from NewMetricSinkFromURL. +func NewStatsiteSinkFromURL(u *url.URL) (MetricSink, error) { + return NewStatsiteSink(u.Host) +} + +// StatsiteSink provides a MetricSink that can be used with a +// statsite metrics server +type StatsiteSink struct { + addr string + metricQueue chan string +} + +// NewStatsiteSink is used to create a new StatsiteSink +func NewStatsiteSink(addr string) (*StatsiteSink, error) { + s := &StatsiteSink{ + addr: addr, + metricQueue: make(chan string, 4096), + } + go s.flushMetrics() + return s, nil +} + +// Close is used to stop flushing to statsite +func (s *StatsiteSink) Shutdown() { + close(s.metricQueue) +} + +func (s *StatsiteSink) SetGauge(key []string, val float32) { + flatKey := s.flattenKey(key) + s.pushMetric(fmt.Sprintf("%s:%f|g\n", flatKey, val)) +} + +func (s *StatsiteSink) SetGaugeWithLabels(key []string, val float32, labels []Label) { + flatKey := s.flattenKeyLabels(key, labels) + s.pushMetric(fmt.Sprintf("%s:%f|g\n", flatKey, val)) +} + +func (s *StatsiteSink) SetPrecisionGauge(key []string, val float64) { + flatKey := s.flattenKey(key) + s.pushMetric(fmt.Sprintf("%s:%f|g\n", flatKey, val)) +} + +func (s *StatsiteSink) SetPrecisionGaugeWithLabels(key []string, val float64, labels []Label) { + flatKey := s.flattenKeyLabels(key, labels) + s.pushMetric(fmt.Sprintf("%s:%f|g\n", flatKey, val)) +} + +func (s *StatsiteSink) EmitKey(key []string, val float32) { + flatKey := s.flattenKey(key) + s.pushMetric(fmt.Sprintf("%s:%f|kv\n", flatKey, val)) +} + +func (s *StatsiteSink) IncrCounter(key []string, val float32) { + flatKey := s.flattenKey(key) + s.pushMetric(fmt.Sprintf("%s:%f|c\n", flatKey, val)) +} + +func (s *StatsiteSink) IncrCounterWithLabels(key []string, val float32, labels []Label) { + flatKey := s.flattenKeyLabels(key, labels) + s.pushMetric(fmt.Sprintf("%s:%f|c\n", flatKey, val)) +} + +func (s *StatsiteSink) AddSample(key []string, val float32) { + flatKey := s.flattenKey(key) + s.pushMetric(fmt.Sprintf("%s:%f|ms\n", flatKey, val)) +} + +func (s *StatsiteSink) AddSampleWithLabels(key []string, val float32, labels []Label) { + flatKey := s.flattenKeyLabels(key, labels) + s.pushMetric(fmt.Sprintf("%s:%f|ms\n", flatKey, val)) +} + +// Flattens the key for formatting, removes spaces +func (s *StatsiteSink) flattenKey(parts []string) string { + joined := strings.Join(parts, ".") + return strings.Map(func(r rune) rune { + switch r { + case ':': + fallthrough + case ' ': + return '_' + default: + return r + } + }, joined) +} + +// Flattens the key along with labels for formatting, removes spaces +func (s *StatsiteSink) flattenKeyLabels(parts []string, labels []Label) string { + for _, label := range labels { + parts = append(parts, label.Value) + } + return s.flattenKey(parts) +} + +// Does a non-blocking push to the metrics queue +func (s *StatsiteSink) pushMetric(m string) { + select { + case s.metricQueue <- m: + default: + } +} + +// Flushes metrics +func (s *StatsiteSink) flushMetrics() { + var sock net.Conn + var err error + var wait <-chan time.Time + var buffered *bufio.Writer + ticker := time.NewTicker(flushInterval) + defer ticker.Stop() + +CONNECT: + // Attempt to connect + sock, err = net.Dial("tcp", s.addr) + if err != nil { + log.Printf("[ERR] Error connecting to statsite! Err: %s", err) + goto WAIT + } + + // Create a buffered writer + buffered = bufio.NewWriter(sock) + + for { + select { + case metric, ok := <-s.metricQueue: + // Get a metric from the queue + if !ok { + goto QUIT + } + + // Try to send to statsite + _, err := buffered.Write([]byte(metric)) + if err != nil { + log.Printf("[ERR] Error writing to statsite! Err: %s", err) + goto WAIT + } + case <-ticker.C: + if err := buffered.Flush(); err != nil { + log.Printf("[ERR] Error flushing to statsite! Err: %s", err) + goto WAIT + } + } + } + +WAIT: + // Wait for a while + wait = time.After(time.Duration(5) * time.Second) + for { + select { + // Dequeue the messages to avoid backlog + case _, ok := <-s.metricQueue: + if !ok { + goto QUIT + } + case <-wait: + goto CONNECT + } + } +QUIT: + s.metricQueue = nil +} diff --git a/vendor/github.com/hashicorp/raft-boltdb/v2/README.md b/vendor/github.com/hashicorp/raft-boltdb/v2/README.md index 22bad34a..e6807d2d 100644 --- a/vendor/github.com/hashicorp/raft-boltdb/v2/README.md +++ b/vendor/github.com/hashicorp/raft-boltdb/v2/README.md @@ -5,9 +5,34 @@ This implementation uses the maintained version of BoltDB, [BBolt](https://githu There is no breaking API change to the library. However, there is the potential for disk format incompatibilities so it was decided to be conservative and making it a separate import path. This separate import path will allow both versions (original and v2) to be imported to perform a safe in-place upgrade of old files read with the old version and written back out with the new one. +## Metrics Emission and Compatibility + +This library can emit metrics using either `github.com/armon/go-metrics` or `github.com/hashicorp/go-metrics`. Choosing between the libraries is controlled via build tags. + +**Build Tags** +* `armonmetrics` - Using this tag will cause metrics to be routed to `armon/go-metrics` +* `hashicorpmetrics` - Using this tag will cause all metrics to be routed to `hashicorp/go-metrics` + +If no build tag is specified, the default behavior is to use `armon/go-metrics`. + +**Deprecating `armon/go-metrics`** + +Emitting metrics to `armon/go-metrics` is officially deprecated. Usage of `armon/go-metrics` will remain the default until mid-2025 with opt-in support continuing to the end of 2025. + +**Migration** +To migrate an application currently using the older `armon/go-metrics` to instead use `hashicorp/go-metrics` the following should be done. + +1. Upgrade libraries using `armon/go-metrics` to consume `hashicorp/go-metrics/compat` instead. This should involve only changing import statements. All repositories in the `hashicorp` namespace +2. Update an applications library dependencies to those that have the compatibility layer configured. +3. Update the application to use `hashicorp/go-metrics` for configuring metrics export instead of `armon/go-metrics` + * Replace all application imports of `github.com/armon/go-metrics` with `github.com/hashicorp/go-metrics` + * Instrument your build system to build with the `hashicorpmetrics` tag. + + Eventually once the default behavior changes to use `hashicorp/go-metrics` by default (mid-2025), you can drop the `hashicorpmetrics` build tag. + ## Metrics -The raft-boldb library emits a number of metrics utilizing github.com/armon/go-metrics. Those metrics are detailed in the following table. One note is that the application which pulls in this library may add its own prefix to the metric names. For example within [Consul](https://github.com/hashicorp/consul), the metrics will be prefixed with `consul.`. +The following table details all the metrics emitted by this library. One note is that the application which pulls in this library may add its own prefix to the metric names. For example within [Consul](https://github.com/hashicorp/consul), the metrics will be prefixed with `consul.`. | Metric | Unit | Type | Description | | ----------------------------------- | ------------:| -------:|:--------------------- | @@ -35,3 +60,4 @@ The raft-boldb library emits a number of metrics utilizing github.com/armon/go-m | `raft.boltdb.txstats.write` | writes | counter | Counts the number of writes to the db since Consul was started. | | `raft.boltdb.txstats.writeTime` | ms | timer | Measures the amount of time spent performing writes to the db. | | `raft.boltdb.writeCapacity` | logs/second | sample | Theoretical write capacity in terms of the number of logs that can be written per second. Each sample outputs what the capacity would be if future batched log write operations were similar to this one. This similarity encompasses 4 things: batch size, byte size, disk performance and boltdb performance. While none of these will be static and its highly likely individual samples of this metric will vary, aggregating this metric over a larger time window should provide a decent picture into how this BoltDB store can perform | + diff --git a/vendor/github.com/hashicorp/raft-boltdb/v2/bolt_store.go b/vendor/github.com/hashicorp/raft-boltdb/v2/bolt_store.go index 54e3fa6c..146c502d 100644 --- a/vendor/github.com/hashicorp/raft-boltdb/v2/bolt_store.go +++ b/vendor/github.com/hashicorp/raft-boltdb/v2/bolt_store.go @@ -1,3 +1,6 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MPL-2.0 + package raftboltdb import ( @@ -6,8 +9,8 @@ import ( "os" "time" - "github.com/armon/go-metrics" v1 "github.com/boltdb/bolt" + "github.com/hashicorp/go-metrics/compat" "github.com/hashicorp/raft" "go.etcd.io/bbolt" ) diff --git a/vendor/github.com/hashicorp/raft-boltdb/v2/metrics.go b/vendor/github.com/hashicorp/raft-boltdb/v2/metrics.go index 1480ff7a..cf356587 100644 --- a/vendor/github.com/hashicorp/raft-boltdb/v2/metrics.go +++ b/vendor/github.com/hashicorp/raft-boltdb/v2/metrics.go @@ -1,10 +1,13 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MPL-2.0 + package raftboltdb import ( "context" "time" - metrics "github.com/armon/go-metrics" + metrics "github.com/hashicorp/go-metrics/compat" "go.etcd.io/bbolt" ) diff --git a/vendor/github.com/hashicorp/raft-boltdb/v2/util.go b/vendor/github.com/hashicorp/raft-boltdb/v2/util.go index 28f7dfcd..aa514413 100644 --- a/vendor/github.com/hashicorp/raft-boltdb/v2/util.go +++ b/vendor/github.com/hashicorp/raft-boltdb/v2/util.go @@ -1,3 +1,6 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MPL-2.0 + package raftboltdb import ( diff --git a/vendor/github.com/hashicorp/raft/.golangci-lint.yml b/vendor/github.com/hashicorp/raft/.golangci-lint.yml index 5f2a2d9f..654d05e1 100644 --- a/vendor/github.com/hashicorp/raft/.golangci-lint.yml +++ b/vendor/github.com/hashicorp/raft/.golangci-lint.yml @@ -9,6 +9,17 @@ linters-settings: check-shadowing: true golint: min-confidence: 0 + depguard: + rules: + main: + list-mode: lax + allow: + - "github.com/hashicorp/go-metrics/compat" + deny: + - pkg: "github.com/hashicorp/go-metrics" + desc: not allowed, use github.com/hashicorp/go-metrics/compat instead + - pkg: "github.com/armon/go-metrics" + desc: not allowed, use github.com/hashicorp/go-metrics/compat instead linters: disable-all: true @@ -16,6 +27,7 @@ linters: - gofmt #- golint - govet + - depguard #- varcheck #- typecheck #- gosimple diff --git a/vendor/github.com/hashicorp/raft/CHANGELOG.md b/vendor/github.com/hashicorp/raft/CHANGELOG.md index b0fef7eb..f88d1621 100644 --- a/vendor/github.com/hashicorp/raft/CHANGELOG.md +++ b/vendor/github.com/hashicorp/raft/CHANGELOG.md @@ -1,5 +1,9 @@ # UNRELEASED +IMPROVEMENETS + +* Added a flag to skip legacy duplicate telemetry. [GH-630](https://github.com/hashicorp/raft/pull/630) + # 1.7.0 (June 5th, 2024) CHANGES @@ -37,7 +41,7 @@ CHANGES go-msgpack v2.1.1 is by default binary compatible with v0.5.5 ("non-builtin" encoding of `time.Time`), but can decode messages produced by v1.1.5 as well ("builtin" encoding of `time.Time`). - However, if users of this libary overrode the version of go-msgpack (especially to v1), this **could break** compatibility if raft nodes are running a mix of versions. + However, if users of this library overrode the version of go-msgpack (especially to v1), this **could break** compatibility if raft nodes are running a mix of versions. This compatibility can be configured at runtime in Raft using `NetworkTransportConfig.MsgpackUseNewTimeFormat` -- the default is `false`, which maintains compatibility with `go-msgpack` v0.5.5, but if set to `true`, will be compatible with `go-msgpack` v1.1.5. diff --git a/vendor/github.com/hashicorp/raft/README.md b/vendor/github.com/hashicorp/raft/README.md index ded5bd02..c388d835 100644 --- a/vendor/github.com/hashicorp/raft/README.md +++ b/vendor/github.com/hashicorp/raft/README.md @@ -110,3 +110,29 @@ greatly sacrificing performance. In terms of performance, Raft is comparable to Paxos. Assuming stable leadership, committing a log entry requires a single round trip to half of the cluster. Thus performance is bound by disk I/O and network latency. + + + ## Metrics Emission and Compatibility + + This library can emit metrics using either `github.com/armon/go-metrics` or `github.com/hashicorp/go-metrics`. Choosing between the libraries is controlled via build tags. + + **Build Tags** + * `armonmetrics` - Using this tag will cause metrics to be routed to `armon/go-metrics` + * `hashicorpmetrics` - Using this tag will cause all metrics to be routed to `hashicorp/go-metrics` + + If no build tag is specified, the default behavior is to use `armon/go-metrics`. + + **Deprecating `armon/go-metrics`** + + Emitting metrics to `armon/go-metrics` is officially deprecated. Usage of `armon/go-metrics` will remain the default until mid-2025 with opt-in support continuing to the end of 2025. + + **Migration** + To migrate an application currently using the older `armon/go-metrics` to instead use `hashicorp/go-metrics` the following should be done. + + 1. Upgrade libraries using `armon/go-metrics` to consume `hashicorp/go-metrics/compat` instead. This should involve only changing import statements. All repositories in the `hashicorp` namespace + 2. Update an applications library dependencies to those that have the compatibility layer configured. + 3. Update the application to use `hashicorp/go-metrics` for configuring metrics export instead of `armon/go-metrics` + * Replace all application imports of `github.com/armon/go-metrics` with `github.com/hashicorp/go-metrics` + * Instrument your build system to build with the `hashicorpmetrics` tag. + + Eventually once the default behavior changes to use `hashicorp/go-metrics` by default (mid-2025), you can drop the `hashicorpmetrics` build tag. diff --git a/vendor/github.com/hashicorp/raft/api.go b/vendor/github.com/hashicorp/raft/api.go index cff2eaac..2b38798b 100644 --- a/vendor/github.com/hashicorp/raft/api.go +++ b/vendor/github.com/hashicorp/raft/api.go @@ -12,8 +12,8 @@ import ( "sync/atomic" "time" - metrics "github.com/armon/go-metrics" hclog "github.com/hashicorp/go-hclog" + metrics "github.com/hashicorp/go-metrics/compat" ) const ( @@ -59,7 +59,7 @@ var ( ErrEnqueueTimeout = errors.New("timed out enqueuing operation") // ErrNothingNewToSnapshot is returned when trying to create a snapshot - // but there's nothing new commited to the FSM since we started. + // but there's nothing new committed to the FSM since we started. ErrNothingNewToSnapshot = errors.New("nothing new to snapshot") // ErrUnsupportedProtocol is returned when an operation is attempted @@ -217,6 +217,11 @@ type Raft struct { // preVoteDisabled control if the pre-vote feature is activated, // prevote feature is disabled if set to true. preVoteDisabled bool + + // noLegacyTelemetry allows to skip the legacy metrics to avoid duplicates. + // legacy metrics are those that have `_peer_name` as metric suffix instead as labels. + // e.g: raft_replication_heartbeat_peer0 + noLegacyTelemetry bool } // BootstrapCluster initializes a server's storage with the given cluster @@ -232,7 +237,8 @@ type Raft struct { // listing just itself as a Voter, then invoke AddVoter() on it to add other // servers to the cluster. func BootstrapCluster(conf *Config, logs LogStore, stable StableStore, - snaps SnapshotStore, trans Transport, configuration Configuration) error { + snaps SnapshotStore, trans Transport, configuration Configuration, +) error { // Validate the Raft server config. if err := ValidateConfig(conf); err != nil { return err @@ -305,7 +311,8 @@ func BootstrapCluster(conf *Config, logs LogStore, stable StableStore, // the sole voter, and then join up other new clean-state peer servers using // the usual APIs in order to bring the cluster back into a known state. func RecoverCluster(conf *Config, fsm FSM, logs LogStore, stable StableStore, - snaps SnapshotStore, trans Transport, configuration Configuration) error { + snaps SnapshotStore, trans Transport, configuration Configuration, +) error { // Validate the Raft server config. if err := ValidateConfig(conf); err != nil { return err @@ -436,7 +443,8 @@ func RecoverCluster(conf *Config, fsm FSM, logs LogStore, stable StableStore, // without starting a Raft instance or connecting to the cluster. This function // has identical behavior to Raft.GetConfiguration. func GetConfiguration(conf *Config, fsm FSM, logs LogStore, stable StableStore, - snaps SnapshotStore, trans Transport) (Configuration, error) { + snaps SnapshotStore, trans Transport, +) (Configuration, error) { conf.skipStartup = true r, err := NewRaft(conf, fsm, logs, stable, snaps, trans) if err != nil { @@ -566,6 +574,7 @@ func NewRaft(conf *Config, fsm FSM, logs LogStore, stable StableStore, snaps Sna followerNotifyCh: make(chan struct{}, 1), mainThreadSaturation: newSaturationMetric([]string{"raft", "thread", "main", "saturation"}, 1*time.Second), preVoteDisabled: conf.PreVoteDisabled || !transportSupportPreVote, + noLegacyTelemetry: conf.NoLegacyTelemetry, } if !transportSupportPreVote && !conf.PreVoteDisabled { r.logger.Warn("pre-vote is disabled because it is not supported by the Transport") @@ -1099,12 +1108,12 @@ func (r *Raft) State() RaftState { // lose it. // // Receivers can expect to receive a notification only if leadership -// transition has occured. +// transition has occurred. // // If receivers aren't ready for the signal, signals may drop and only the // latest leadership transition. For example, if a receiver receives subsequent // `true` values, they may deduce that leadership was lost and regained while -// the the receiver was processing first leadership transition. +// the receiver was processing first leadership transition. func (r *Raft) LeaderCh() <-chan bool { return r.leaderCh } @@ -1208,6 +1217,11 @@ func (r *Raft) Stats() map[string]string { return s } +// CurrentTerm returns the current term. +func (r *Raft) CurrentTerm() uint64 { + return r.getCurrentTerm() +} + // LastIndex returns the last index in stable storage, // either from the last log or from the last snapshot. func (r *Raft) LastIndex() uint64 { diff --git a/vendor/github.com/hashicorp/raft/config.go b/vendor/github.com/hashicorp/raft/config.go index d14392fc..0f586973 100644 --- a/vendor/github.com/hashicorp/raft/config.go +++ b/vendor/github.com/hashicorp/raft/config.go @@ -235,6 +235,11 @@ type Config struct { // PreVoteDisabled deactivate the pre-vote feature when set to true PreVoteDisabled bool + // NoLegacyTelemetry allows to skip the legacy metrics to avoid duplicates. + // legacy metrics are those that have `_peer_name` as metric suffix instead as labels. + // e.g: raft_replication_heartbeat_peer0 + NoLegacyTelemetry bool + // skipStartup allows NewRaft() to bypass all background work goroutines skipStartup bool } diff --git a/vendor/github.com/hashicorp/raft/configuration.go b/vendor/github.com/hashicorp/raft/configuration.go index 9bfad14f..f8a0108a 100644 --- a/vendor/github.com/hashicorp/raft/configuration.go +++ b/vendor/github.com/hashicorp/raft/configuration.go @@ -180,7 +180,7 @@ func hasVote(configuration Configuration, id ServerID) bool { return false } -// inConfiguration returns true if the server identified by 'id' is in in the +// inConfiguration returns true if the server identified by 'id' is in the // provided Configuration. func inConfiguration(configuration Configuration, id ServerID) bool { for _, server := range configuration.Servers { diff --git a/vendor/github.com/hashicorp/raft/fsm.go b/vendor/github.com/hashicorp/raft/fsm.go index a84bde34..be6a24e7 100644 --- a/vendor/github.com/hashicorp/raft/fsm.go +++ b/vendor/github.com/hashicorp/raft/fsm.go @@ -8,8 +8,8 @@ import ( "io" "time" - "github.com/armon/go-metrics" hclog "github.com/hashicorp/go-hclog" + "github.com/hashicorp/go-metrics/compat" ) // FSM is implemented by clients to make use of the replicated log. @@ -34,6 +34,12 @@ type FSM interface { // Apply and Snapshot are always called from the same thread, but Apply will // be called concurrently with FSMSnapshot.Persist. This means the FSM should // be implemented to allow for concurrent updates while a snapshot is happening. + // + // Clients of this library should make no assumptions about whether a returned + // Snapshot() will actually be stored by Raft. In fact it's quite possible that + // any Snapshot returned by this call will be discarded, and that + // FSMSnapshot.Persist will never be called. Raft will always call + // FSMSnapshot.Release however. Snapshot() (FSMSnapshot, error) // Restore is used to restore an FSM from a snapshot. It is not called diff --git a/vendor/github.com/hashicorp/raft/log.go b/vendor/github.com/hashicorp/raft/log.go index 4ae21932..4a6dc47b 100644 --- a/vendor/github.com/hashicorp/raft/log.go +++ b/vendor/github.com/hashicorp/raft/log.go @@ -7,7 +7,7 @@ import ( "fmt" "time" - metrics "github.com/armon/go-metrics" + metrics "github.com/hashicorp/go-metrics/compat" ) // LogType describes various types of log entries. diff --git a/vendor/github.com/hashicorp/raft/log_cache.go b/vendor/github.com/hashicorp/raft/log_cache.go index 2cc3885a..b61f8176 100644 --- a/vendor/github.com/hashicorp/raft/log_cache.go +++ b/vendor/github.com/hashicorp/raft/log_cache.go @@ -34,7 +34,7 @@ func NewLogCache(capacity int, store LogStore) (*LogCache, error) { } // IsMonotonic implements the MonotonicLogStore interface. This is a shim to -// expose the underyling store as monotonically indexed or not. +// expose the underlying store as monotonically indexed or not. func (c *LogCache) IsMonotonic() bool { if store, ok := c.store.(MonotonicLogStore); ok { return store.IsMonotonic() diff --git a/vendor/github.com/hashicorp/raft/net_transport.go b/vendor/github.com/hashicorp/raft/net_transport.go index 1bac17d6..bd2d61da 100644 --- a/vendor/github.com/hashicorp/raft/net_transport.go +++ b/vendor/github.com/hashicorp/raft/net_transport.go @@ -14,8 +14,8 @@ import ( "sync" "time" - "github.com/armon/go-metrics" "github.com/hashicorp/go-hclog" + "github.com/hashicorp/go-metrics/compat" "github.com/hashicorp/go-msgpack/v2/codec" ) diff --git a/vendor/github.com/hashicorp/raft/raft.go b/vendor/github.com/hashicorp/raft/raft.go index cbc9a59a..df5cea3f 100644 --- a/vendor/github.com/hashicorp/raft/raft.go +++ b/vendor/github.com/hashicorp/raft/raft.go @@ -14,7 +14,7 @@ import ( "github.com/hashicorp/go-hclog" - "github.com/armon/go-metrics" + "github.com/hashicorp/go-metrics/compat" ) const ( @@ -300,9 +300,9 @@ func (r *Raft) runCandidate() { } // Make sure the leadership transfer flag is reset after each run. Having this - // flag will set the field LeadershipTransfer in a RequestVoteRequst to true, + // flag will set the field LeadershipTransfer in a RequestVoteRequest to true, // which will make other servers vote even though they have a leader already. - // It is important to reset that flag, because this priviledge could be abused + // It is important to reset that flag, because this privilege could be abused // otherwise. defer func() { r.candidateFromLeadershipTransfer.Store(false) }() @@ -474,7 +474,7 @@ func (r *Raft) runLeader() { // Store the notify chan. It's not reloadable so shouldn't change before the // defer below runs, but this makes sure we always notify the same chan if - // ever for both gaining and loosing leadership. + // ever for both gaining and losing leadership. notify := r.config().NotifyCh // Push to the notify channel if given diff --git a/vendor/github.com/hashicorp/raft/replication.go b/vendor/github.com/hashicorp/raft/replication.go index c0343df3..c3d9f0d5 100644 --- a/vendor/github.com/hashicorp/raft/replication.go +++ b/vendor/github.com/hashicorp/raft/replication.go @@ -10,7 +10,7 @@ import ( "sync/atomic" "time" - "github.com/armon/go-metrics" + "github.com/hashicorp/go-metrics/compat" ) const ( @@ -63,7 +63,7 @@ type followerReplication struct { triggerCh chan struct{} // triggerDeferErrorCh is used to provide a backchannel. By sending a - // deferErr, the sender can be notifed when the replication is done. + // deferErr, the sender can be notified when the replication is done. triggerDeferErrorCh chan *deferError // lastContact is updated to the current time whenever any response is @@ -233,7 +233,7 @@ START: s.failures++ return } - appendStats(string(peer.ID), start, float32(len(req.Entries))) + appendStats(string(peer.ID), start, float32(len(req.Entries)), r.noLegacyTelemetry) // Check for a newer term, stop running if resp.Term > req.Term { @@ -347,8 +347,11 @@ func (r *Raft) sendLatestSnapshot(s *followerReplication) (bool, error) { } labels := []metrics.Label{{Name: "peer_id", Value: string(peer.ID)}} metrics.MeasureSinceWithLabels([]string{"raft", "replication", "installSnapshot"}, start, labels) - // Duplicated information. Kept for backward compatibility. - metrics.MeasureSince([]string{"raft", "replication", "installSnapshot", string(peer.ID)}, start) + + if !r.noLegacyTelemetry { + // Duplicated information. Kept for backward compatibility. + metrics.MeasureSince([]string{"raft", "replication", "installSnapshot", string(peer.ID)}, start) + } // Check for a newer term, stop running if resp.Term > req.Term { @@ -423,8 +426,12 @@ func (r *Raft) heartbeat(s *followerReplication, stopCh chan struct{}) { failures = 0 labels := []metrics.Label{{Name: "peer_id", Value: string(peer.ID)}} metrics.MeasureSinceWithLabels([]string{"raft", "replication", "heartbeat"}, start, labels) - // Duplicated information. Kept for backward compatibility. - metrics.MeasureSince([]string{"raft", "replication", "heartbeat", string(peer.ID)}, start) + + if !r.noLegacyTelemetry { + // Duplicated information. Kept for backward compatibility. + metrics.MeasureSince([]string{"raft", "replication", "heartbeat", string(peer.ID)}, start) + } + s.notifyAll(resp.Success) } } @@ -533,7 +540,7 @@ func (r *Raft) pipelineDecode(s *followerReplication, p AppendPipeline, stopCh, s.peerLock.RUnlock() req, resp := ready.Request(), ready.Response() - appendStats(string(peer.ID), ready.Start(), float32(len(req.Entries))) + appendStats(string(peer.ID), ready.Start(), float32(len(req.Entries)), r.noLegacyTelemetry) // Check for a newer term, stop running if resp.Term > req.Term { @@ -621,13 +628,16 @@ func (r *Raft) setNewLogs(req *AppendEntriesRequest, nextIndex, lastIndex uint64 } // appendStats is used to emit stats about an AppendEntries invocation. -func appendStats(peer string, start time.Time, logs float32) { +func appendStats(peer string, start time.Time, logs float32, skipLegacy bool) { labels := []metrics.Label{{Name: "peer_id", Value: peer}} metrics.MeasureSinceWithLabels([]string{"raft", "replication", "appendEntries", "rpc"}, start, labels) metrics.IncrCounterWithLabels([]string{"raft", "replication", "appendEntries", "logs"}, logs, labels) - // Duplicated information. Kept for backward compatibility. - metrics.MeasureSince([]string{"raft", "replication", "appendEntries", "rpc", peer}, start) - metrics.IncrCounter([]string{"raft", "replication", "appendEntries", "logs", peer}, logs) + + if !skipLegacy { + // Duplicated information. Kept for backward compatibility. + metrics.MeasureSince([]string{"raft", "replication", "appendEntries", "rpc", peer}, start) + metrics.IncrCounter([]string{"raft", "replication", "appendEntries", "logs", peer}, logs) + } } // handleStaleTerm is used when a follower indicates that we have a stale term. diff --git a/vendor/github.com/hashicorp/raft/saturation.go b/vendor/github.com/hashicorp/raft/saturation.go index 508f08fd..94c98278 100644 --- a/vendor/github.com/hashicorp/raft/saturation.go +++ b/vendor/github.com/hashicorp/raft/saturation.go @@ -7,7 +7,7 @@ import ( "math" "time" - "github.com/armon/go-metrics" + "github.com/hashicorp/go-metrics/compat" ) // saturationMetric measures the saturation (percentage of time spent working vs diff --git a/vendor/github.com/hashicorp/raft/snapshot.go b/vendor/github.com/hashicorp/raft/snapshot.go index 89d11fda..3f9d3158 100644 --- a/vendor/github.com/hashicorp/raft/snapshot.go +++ b/vendor/github.com/hashicorp/raft/snapshot.go @@ -8,7 +8,7 @@ import ( "io" "time" - "github.com/armon/go-metrics" + "github.com/hashicorp/go-metrics/compat" ) // SnapshotMeta is for metadata of a snapshot. @@ -211,7 +211,7 @@ func (r *Raft) takeSnapshot() (string, error) { } // compactLogsWithTrailing takes the last inclusive index of a snapshot, -// the lastLogIdx, and and the trailingLogs and trims the logs that +// the lastLogIdx, and the trailingLogs and trims the logs that // are no longer needed. func (r *Raft) compactLogsWithTrailing(snapIdx uint64, lastLogIdx uint64, trailingLogs uint64) error { // Determine log ranges to compact diff --git a/vendor/github.com/klauspost/cpuid/v2/README.md b/vendor/github.com/klauspost/cpuid/v2/README.md index 21508edb..f06ba51c 100644 --- a/vendor/github.com/klauspost/cpuid/v2/README.md +++ b/vendor/github.com/klauspost/cpuid/v2/README.md @@ -281,6 +281,7 @@ Exit Code 1 | AMXBF16 | Tile computational operations on BFLOAT16 numbers | | AMXINT8 | Tile computational operations on 8-bit integers | | AMXFP16 | Tile computational operations on FP16 numbers | +| AMXFP8 | Tile computational operations on FP8 numbers | | AMXTILE | Tile architecture | | APX_F | Intel APX | | AVX | AVX functions | diff --git a/vendor/github.com/klauspost/cpuid/v2/cpuid.go b/vendor/github.com/klauspost/cpuid/v2/cpuid.go index 53bc18ca..db99eb62 100644 --- a/vendor/github.com/klauspost/cpuid/v2/cpuid.go +++ b/vendor/github.com/klauspost/cpuid/v2/cpuid.go @@ -55,6 +55,12 @@ const ( Qualcomm Marvell + QEMU + QNX + ACRN + SRE + Apple + lastVendor ) @@ -75,6 +81,7 @@ const ( AMXBF16 // Tile computational operations on BFLOAT16 numbers AMXFP16 // Tile computational operations on FP16 numbers AMXINT8 // Tile computational operations on 8-bit integers + AMXFP8 // Tile computational operations on FP8 numbers AMXTILE // Tile architecture APX_F // Intel APX AVX // AVX functions @@ -296,20 +303,22 @@ const ( // CPUInfo contains information about the detected system CPU. type CPUInfo struct { - BrandName string // Brand name reported by the CPU - VendorID Vendor // Comparable CPU vendor ID - VendorString string // Raw vendor string. - featureSet flagSet // Features of the CPU - PhysicalCores int // Number of physical processor cores in your CPU. Will be 0 if undetectable. - ThreadsPerCore int // Number of threads per physical core. Will be 1 if undetectable. - LogicalCores int // Number of physical cores times threads that can run on each core through the use of hyperthreading. Will be 0 if undetectable. - Family int // CPU family number - Model int // CPU model number - Stepping int // CPU stepping info - CacheLine int // Cache line size in bytes. Will be 0 if undetectable. - Hz int64 // Clock speed, if known, 0 otherwise. Will attempt to contain base clock speed. - BoostFreq int64 // Max clock speed, if known, 0 otherwise - Cache struct { + BrandName string // Brand name reported by the CPU + VendorID Vendor // Comparable CPU vendor ID + VendorString string // Raw vendor string. + HypervisorVendorID Vendor // Hypervisor vendor + HypervisorVendorString string // Raw hypervisor vendor string + featureSet flagSet // Features of the CPU + PhysicalCores int // Number of physical processor cores in your CPU. Will be 0 if undetectable. + ThreadsPerCore int // Number of threads per physical core. Will be 1 if undetectable. + LogicalCores int // Number of physical cores times threads that can run on each core through the use of hyperthreading. Will be 0 if undetectable. + Family int // CPU family number + Model int // CPU model number + Stepping int // CPU stepping info + CacheLine int // Cache line size in bytes. Will be 0 if undetectable. + Hz int64 // Clock speed, if known, 0 otherwise. Will attempt to contain base clock speed. + BoostFreq int64 // Max clock speed, if known, 0 otherwise + Cache struct { L1I int // L1 Instruction Cache (per core or shared). Will be -1 if undetected L1D int // L1 Data Cache (per core or shared). Will be -1 if undetected L2 int // L2 Cache (per core or shared). Will be -1 if undetected @@ -318,8 +327,9 @@ type CPUInfo struct { SGX SGXSupport AMDMemEncryption AMDMemEncryptionSupport AVX10Level uint8 - maxFunc uint32 - maxExFunc uint32 + + maxFunc uint32 + maxExFunc uint32 } var cpuid func(op uint32) (eax, ebx, ecx, edx uint32) @@ -503,7 +513,7 @@ func (c CPUInfo) FeatureSet() []string { // Uses the RDTSCP instruction. The value 0 is returned // if the CPU does not support the instruction. func (c CPUInfo) RTCounter() uint64 { - if !c.Supports(RDTSCP) { + if !c.Has(RDTSCP) { return 0 } a, _, _, d := rdtscpAsm() @@ -515,13 +525,22 @@ func (c CPUInfo) RTCounter() uint64 { // about the current cpu/core the code is running on. // If the RDTSCP instruction isn't supported on the CPU, the value 0 is returned. func (c CPUInfo) Ia32TscAux() uint32 { - if !c.Supports(RDTSCP) { + if !c.Has(RDTSCP) { return 0 } _, _, ecx, _ := rdtscpAsm() return ecx } +// SveLengths returns arm SVE vector and predicate lengths. +// Will return 0, 0 if SVE is not enabled or otherwise unable to detect. +func (c CPUInfo) SveLengths() (vl, pl uint64) { + if !c.Has(SVE) { + return 0, 0 + } + return getVectorLength() +} + // LogicalCPU will return the Logical CPU the code is currently executing on. // This is likely to change when the OS re-schedules the running thread // to another CPU. @@ -781,11 +800,16 @@ func threadsPerCore() int { _, b, _, _ := cpuidex(0xb, 0) if b&0xffff == 0 { if vend == AMD { - // Workaround for AMD returning 0, assume 2 if >= Zen 2 - // It will be more correct than not. + // if >= Zen 2 0x8000001e EBX 15-8 bits means threads per core. + // The number of threads per core is ThreadsPerCore+1 + // See PPR for AMD Family 17h Models 00h-0Fh (page 82) fam, _, _ := familyModel() _, _, _, d := cpuid(1) if (d&(1<<28)) != 0 && fam >= 23 { + if maxExtendedFunction() >= 0x8000001e { + _, b, _, _ := cpuid(0x8000001e) + return int((b>>8)&0xff) + 1 + } return 2 } } @@ -877,7 +901,9 @@ var vendorMapping = map[string]Vendor{ "GenuineTMx86": Transmeta, "Geode by NSC": NSC, "VIA VIA VIA ": VIA, - "KVMKVMKVMKVM": KVM, + "KVMKVMKVM": KVM, + "Linux KVM Hv": KVM, + "TCGTCGTCGTCG": QEMU, "Microsoft Hv": MSVM, "VMwareVMware": VMware, "XenVMMXenVMM": XenHVM, @@ -887,6 +913,10 @@ var vendorMapping = map[string]Vendor{ "SiS SiS SiS ": SiS, "RiseRiseRise": SiS, "Genuine RDC": RDC, + "QNXQVMBSQG": QNX, + "ACRNACRNACRN": ACRN, + "SRESRESRESRE": SRE, + "Apple VZ": Apple, } func vendorID() (Vendor, string) { @@ -899,6 +929,17 @@ func vendorID() (Vendor, string) { return vend, v } +func hypervisorVendorID() (Vendor, string) { + // https://lwn.net/Articles/301888/ + _, b, c, d := cpuid(0x40000000) + v := string(valAsString(b, c, d)) + vend, ok := vendorMapping[v] + if !ok { + return VendorUnknown, v + } + return vend, v +} + func cacheLine() int { if maxFunctionID() < 0x1 { return 0 @@ -1271,6 +1312,7 @@ func support() flagSet { fs.setIf(ebx&(1<<31) != 0, AVX512VL) // ecx fs.setIf(ecx&(1<<1) != 0, AVX512VBMI) + fs.setIf(ecx&(1<<3) != 0, AMXFP8) fs.setIf(ecx&(1<<6) != 0, AVX512VBMI2) fs.setIf(ecx&(1<<11) != 0, AVX512VNNI) fs.setIf(ecx&(1<<12) != 0, AVX512BITALG) diff --git a/vendor/github.com/klauspost/cpuid/v2/cpuid_arm64.s b/vendor/github.com/klauspost/cpuid/v2/cpuid_arm64.s index b31d6aec..b196f78e 100644 --- a/vendor/github.com/klauspost/cpuid/v2/cpuid_arm64.s +++ b/vendor/github.com/klauspost/cpuid/v2/cpuid_arm64.s @@ -24,3 +24,13 @@ TEXT ·getInstAttributes(SB), 7, $0 MOVD R1, instAttrReg1+8(FP) RET +TEXT ·getVectorLength(SB), 7, $0 + WORD $0xd2800002 // mov x2, #0 + WORD $0x04225022 // addvl x2, x2, #1 + WORD $0xd37df042 // lsl x2, x2, #3 + WORD $0xd2800003 // mov x3, #0 + WORD $0x04635023 // addpl x3, x3, #1 + WORD $0xd37df063 // lsl x3, x3, #3 + MOVD R2, vl+0(FP) + MOVD R3, pl+8(FP) + RET diff --git a/vendor/github.com/klauspost/cpuid/v2/detect_arm64.go b/vendor/github.com/klauspost/cpuid/v2/detect_arm64.go index 9a53504a..566743d2 100644 --- a/vendor/github.com/klauspost/cpuid/v2/detect_arm64.go +++ b/vendor/github.com/klauspost/cpuid/v2/detect_arm64.go @@ -10,6 +10,7 @@ import "runtime" func getMidr() (midr uint64) func getProcFeatures() (procFeatures uint64) func getInstAttributes() (instAttrReg0, instAttrReg1 uint64) +func getVectorLength() (vl, pl uint64) func initCPU() { cpuid = func(uint32) (a, b, c, d uint32) { return 0, 0, 0, 0 } @@ -24,7 +25,7 @@ func addInfo(c *CPUInfo, safe bool) { detectOS(c) // ARM64 disabled since it may crash if interrupt is not intercepted by OS. - if safe && !c.Supports(ARMCPUID) && runtime.GOOS != "freebsd" { + if safe && !c.Has(ARMCPUID) && runtime.GOOS != "freebsd" { return } midr := getMidr() diff --git a/vendor/github.com/klauspost/cpuid/v2/detect_ref.go b/vendor/github.com/klauspost/cpuid/v2/detect_ref.go index 9636c2bc..574f9389 100644 --- a/vendor/github.com/klauspost/cpuid/v2/detect_ref.go +++ b/vendor/github.com/klauspost/cpuid/v2/detect_ref.go @@ -10,6 +10,8 @@ func initCPU() { cpuidex = func(x, y uint32) (a, b, c, d uint32) { return 0, 0, 0, 0 } xgetbv = func(uint32) (a, b uint32) { return 0, 0 } rdtscpAsm = func() (a, b, c, d uint32) { return 0, 0, 0, 0 } + } func addInfo(info *CPUInfo, safe bool) {} +func getVectorLength() (vl, pl uint64) { return 0, 0 } diff --git a/vendor/github.com/klauspost/cpuid/v2/detect_x86.go b/vendor/github.com/klauspost/cpuid/v2/detect_x86.go index 799b400c..f924c9d8 100644 --- a/vendor/github.com/klauspost/cpuid/v2/detect_x86.go +++ b/vendor/github.com/klauspost/cpuid/v2/detect_x86.go @@ -32,7 +32,10 @@ func addInfo(c *CPUInfo, safe bool) { c.LogicalCores = logicalCores() c.PhysicalCores = physicalCores() c.VendorID, c.VendorString = vendorID() + c.HypervisorVendorID, c.HypervisorVendorString = hypervisorVendorID() c.AVX10Level = c.supportAVX10() c.cacheSize() c.frequencies() } + +func getVectorLength() (vl, pl uint64) { return 0, 0 } diff --git a/vendor/github.com/klauspost/cpuid/v2/featureid_string.go b/vendor/github.com/klauspost/cpuid/v2/featureid_string.go index 3a256031..e7f874a7 100644 --- a/vendor/github.com/klauspost/cpuid/v2/featureid_string.go +++ b/vendor/github.com/klauspost/cpuid/v2/featureid_string.go @@ -15,224 +15,225 @@ func _() { _ = x[AMXBF16-5] _ = x[AMXFP16-6] _ = x[AMXINT8-7] - _ = x[AMXTILE-8] - _ = x[APX_F-9] - _ = x[AVX-10] - _ = x[AVX10-11] - _ = x[AVX10_128-12] - _ = x[AVX10_256-13] - _ = x[AVX10_512-14] - _ = x[AVX2-15] - _ = x[AVX512BF16-16] - _ = x[AVX512BITALG-17] - _ = x[AVX512BW-18] - _ = x[AVX512CD-19] - _ = x[AVX512DQ-20] - _ = x[AVX512ER-21] - _ = x[AVX512F-22] - _ = x[AVX512FP16-23] - _ = x[AVX512IFMA-24] - _ = x[AVX512PF-25] - _ = x[AVX512VBMI-26] - _ = x[AVX512VBMI2-27] - _ = x[AVX512VL-28] - _ = x[AVX512VNNI-29] - _ = x[AVX512VP2INTERSECT-30] - _ = x[AVX512VPOPCNTDQ-31] - _ = x[AVXIFMA-32] - _ = x[AVXNECONVERT-33] - _ = x[AVXSLOW-34] - _ = x[AVXVNNI-35] - _ = x[AVXVNNIINT8-36] - _ = x[AVXVNNIINT16-37] - _ = x[BHI_CTRL-38] - _ = x[BMI1-39] - _ = x[BMI2-40] - _ = x[CETIBT-41] - _ = x[CETSS-42] - _ = x[CLDEMOTE-43] - _ = x[CLMUL-44] - _ = x[CLZERO-45] - _ = x[CMOV-46] - _ = x[CMPCCXADD-47] - _ = x[CMPSB_SCADBS_SHORT-48] - _ = x[CMPXCHG8-49] - _ = x[CPBOOST-50] - _ = x[CPPC-51] - _ = x[CX16-52] - _ = x[EFER_LMSLE_UNS-53] - _ = x[ENQCMD-54] - _ = x[ERMS-55] - _ = x[F16C-56] - _ = x[FLUSH_L1D-57] - _ = x[FMA3-58] - _ = x[FMA4-59] - _ = x[FP128-60] - _ = x[FP256-61] - _ = x[FSRM-62] - _ = x[FXSR-63] - _ = x[FXSROPT-64] - _ = x[GFNI-65] - _ = x[HLE-66] - _ = x[HRESET-67] - _ = x[HTT-68] - _ = x[HWA-69] - _ = x[HYBRID_CPU-70] - _ = x[HYPERVISOR-71] - _ = x[IA32_ARCH_CAP-72] - _ = x[IA32_CORE_CAP-73] - _ = x[IBPB-74] - _ = x[IBPB_BRTYPE-75] - _ = x[IBRS-76] - _ = x[IBRS_PREFERRED-77] - _ = x[IBRS_PROVIDES_SMP-78] - _ = x[IBS-79] - _ = x[IBSBRNTRGT-80] - _ = x[IBSFETCHSAM-81] - _ = x[IBSFFV-82] - _ = x[IBSOPCNT-83] - _ = x[IBSOPCNTEXT-84] - _ = x[IBSOPSAM-85] - _ = x[IBSRDWROPCNT-86] - _ = x[IBSRIPINVALIDCHK-87] - _ = x[IBS_FETCH_CTLX-88] - _ = x[IBS_OPDATA4-89] - _ = x[IBS_OPFUSE-90] - _ = x[IBS_PREVENTHOST-91] - _ = x[IBS_ZEN4-92] - _ = x[IDPRED_CTRL-93] - _ = x[INT_WBINVD-94] - _ = x[INVLPGB-95] - _ = x[KEYLOCKER-96] - _ = x[KEYLOCKERW-97] - _ = x[LAHF-98] - _ = x[LAM-99] - _ = x[LBRVIRT-100] - _ = x[LZCNT-101] - _ = x[MCAOVERFLOW-102] - _ = x[MCDT_NO-103] - _ = x[MCOMMIT-104] - _ = x[MD_CLEAR-105] - _ = x[MMX-106] - _ = x[MMXEXT-107] - _ = x[MOVBE-108] - _ = x[MOVDIR64B-109] - _ = x[MOVDIRI-110] - _ = x[MOVSB_ZL-111] - _ = x[MOVU-112] - _ = x[MPX-113] - _ = x[MSRIRC-114] - _ = x[MSRLIST-115] - _ = x[MSR_PAGEFLUSH-116] - _ = x[NRIPS-117] - _ = x[NX-118] - _ = x[OSXSAVE-119] - _ = x[PCONFIG-120] - _ = x[POPCNT-121] - _ = x[PPIN-122] - _ = x[PREFETCHI-123] - _ = x[PSFD-124] - _ = x[RDPRU-125] - _ = x[RDRAND-126] - _ = x[RDSEED-127] - _ = x[RDTSCP-128] - _ = x[RRSBA_CTRL-129] - _ = x[RTM-130] - _ = x[RTM_ALWAYS_ABORT-131] - _ = x[SBPB-132] - _ = x[SERIALIZE-133] - _ = x[SEV-134] - _ = x[SEV_64BIT-135] - _ = x[SEV_ALTERNATIVE-136] - _ = x[SEV_DEBUGSWAP-137] - _ = x[SEV_ES-138] - _ = x[SEV_RESTRICTED-139] - _ = x[SEV_SNP-140] - _ = x[SGX-141] - _ = x[SGXLC-142] - _ = x[SHA-143] - _ = x[SME-144] - _ = x[SME_COHERENT-145] - _ = x[SPEC_CTRL_SSBD-146] - _ = x[SRBDS_CTRL-147] - _ = x[SRSO_MSR_FIX-148] - _ = x[SRSO_NO-149] - _ = x[SRSO_USER_KERNEL_NO-150] - _ = x[SSE-151] - _ = x[SSE2-152] - _ = x[SSE3-153] - _ = x[SSE4-154] - _ = x[SSE42-155] - _ = x[SSE4A-156] - _ = x[SSSE3-157] - _ = x[STIBP-158] - _ = x[STIBP_ALWAYSON-159] - _ = x[STOSB_SHORT-160] - _ = x[SUCCOR-161] - _ = x[SVM-162] - _ = x[SVMDA-163] - _ = x[SVMFBASID-164] - _ = x[SVML-165] - _ = x[SVMNP-166] - _ = x[SVMPF-167] - _ = x[SVMPFT-168] - _ = x[SYSCALL-169] - _ = x[SYSEE-170] - _ = x[TBM-171] - _ = x[TDX_GUEST-172] - _ = x[TLB_FLUSH_NESTED-173] - _ = x[TME-174] - _ = x[TOPEXT-175] - _ = x[TSCRATEMSR-176] - _ = x[TSXLDTRK-177] - _ = x[VAES-178] - _ = x[VMCBCLEAN-179] - _ = x[VMPL-180] - _ = x[VMSA_REGPROT-181] - _ = x[VMX-182] - _ = x[VPCLMULQDQ-183] - _ = x[VTE-184] - _ = x[WAITPKG-185] - _ = x[WBNOINVD-186] - _ = x[WRMSRNS-187] - _ = x[X87-188] - _ = x[XGETBV1-189] - _ = x[XOP-190] - _ = x[XSAVE-191] - _ = x[XSAVEC-192] - _ = x[XSAVEOPT-193] - _ = x[XSAVES-194] - _ = x[AESARM-195] - _ = x[ARMCPUID-196] - _ = x[ASIMD-197] - _ = x[ASIMDDP-198] - _ = x[ASIMDHP-199] - _ = x[ASIMDRDM-200] - _ = x[ATOMICS-201] - _ = x[CRC32-202] - _ = x[DCPOP-203] - _ = x[EVTSTRM-204] - _ = x[FCMA-205] - _ = x[FP-206] - _ = x[FPHP-207] - _ = x[GPA-208] - _ = x[JSCVT-209] - _ = x[LRCPC-210] - _ = x[PMULL-211] - _ = x[SHA1-212] - _ = x[SHA2-213] - _ = x[SHA3-214] - _ = x[SHA512-215] - _ = x[SM3-216] - _ = x[SM4-217] - _ = x[SVE-218] - _ = x[lastID-219] + _ = x[AMXFP8-8] + _ = x[AMXTILE-9] + _ = x[APX_F-10] + _ = x[AVX-11] + _ = x[AVX10-12] + _ = x[AVX10_128-13] + _ = x[AVX10_256-14] + _ = x[AVX10_512-15] + _ = x[AVX2-16] + _ = x[AVX512BF16-17] + _ = x[AVX512BITALG-18] + _ = x[AVX512BW-19] + _ = x[AVX512CD-20] + _ = x[AVX512DQ-21] + _ = x[AVX512ER-22] + _ = x[AVX512F-23] + _ = x[AVX512FP16-24] + _ = x[AVX512IFMA-25] + _ = x[AVX512PF-26] + _ = x[AVX512VBMI-27] + _ = x[AVX512VBMI2-28] + _ = x[AVX512VL-29] + _ = x[AVX512VNNI-30] + _ = x[AVX512VP2INTERSECT-31] + _ = x[AVX512VPOPCNTDQ-32] + _ = x[AVXIFMA-33] + _ = x[AVXNECONVERT-34] + _ = x[AVXSLOW-35] + _ = x[AVXVNNI-36] + _ = x[AVXVNNIINT8-37] + _ = x[AVXVNNIINT16-38] + _ = x[BHI_CTRL-39] + _ = x[BMI1-40] + _ = x[BMI2-41] + _ = x[CETIBT-42] + _ = x[CETSS-43] + _ = x[CLDEMOTE-44] + _ = x[CLMUL-45] + _ = x[CLZERO-46] + _ = x[CMOV-47] + _ = x[CMPCCXADD-48] + _ = x[CMPSB_SCADBS_SHORT-49] + _ = x[CMPXCHG8-50] + _ = x[CPBOOST-51] + _ = x[CPPC-52] + _ = x[CX16-53] + _ = x[EFER_LMSLE_UNS-54] + _ = x[ENQCMD-55] + _ = x[ERMS-56] + _ = x[F16C-57] + _ = x[FLUSH_L1D-58] + _ = x[FMA3-59] + _ = x[FMA4-60] + _ = x[FP128-61] + _ = x[FP256-62] + _ = x[FSRM-63] + _ = x[FXSR-64] + _ = x[FXSROPT-65] + _ = x[GFNI-66] + _ = x[HLE-67] + _ = x[HRESET-68] + _ = x[HTT-69] + _ = x[HWA-70] + _ = x[HYBRID_CPU-71] + _ = x[HYPERVISOR-72] + _ = x[IA32_ARCH_CAP-73] + _ = x[IA32_CORE_CAP-74] + _ = x[IBPB-75] + _ = x[IBPB_BRTYPE-76] + _ = x[IBRS-77] + _ = x[IBRS_PREFERRED-78] + _ = x[IBRS_PROVIDES_SMP-79] + _ = x[IBS-80] + _ = x[IBSBRNTRGT-81] + _ = x[IBSFETCHSAM-82] + _ = x[IBSFFV-83] + _ = x[IBSOPCNT-84] + _ = x[IBSOPCNTEXT-85] + _ = x[IBSOPSAM-86] + _ = x[IBSRDWROPCNT-87] + _ = x[IBSRIPINVALIDCHK-88] + _ = x[IBS_FETCH_CTLX-89] + _ = x[IBS_OPDATA4-90] + _ = x[IBS_OPFUSE-91] + _ = x[IBS_PREVENTHOST-92] + _ = x[IBS_ZEN4-93] + _ = x[IDPRED_CTRL-94] + _ = x[INT_WBINVD-95] + _ = x[INVLPGB-96] + _ = x[KEYLOCKER-97] + _ = x[KEYLOCKERW-98] + _ = x[LAHF-99] + _ = x[LAM-100] + _ = x[LBRVIRT-101] + _ = x[LZCNT-102] + _ = x[MCAOVERFLOW-103] + _ = x[MCDT_NO-104] + _ = x[MCOMMIT-105] + _ = x[MD_CLEAR-106] + _ = x[MMX-107] + _ = x[MMXEXT-108] + _ = x[MOVBE-109] + _ = x[MOVDIR64B-110] + _ = x[MOVDIRI-111] + _ = x[MOVSB_ZL-112] + _ = x[MOVU-113] + _ = x[MPX-114] + _ = x[MSRIRC-115] + _ = x[MSRLIST-116] + _ = x[MSR_PAGEFLUSH-117] + _ = x[NRIPS-118] + _ = x[NX-119] + _ = x[OSXSAVE-120] + _ = x[PCONFIG-121] + _ = x[POPCNT-122] + _ = x[PPIN-123] + _ = x[PREFETCHI-124] + _ = x[PSFD-125] + _ = x[RDPRU-126] + _ = x[RDRAND-127] + _ = x[RDSEED-128] + _ = x[RDTSCP-129] + _ = x[RRSBA_CTRL-130] + _ = x[RTM-131] + _ = x[RTM_ALWAYS_ABORT-132] + _ = x[SBPB-133] + _ = x[SERIALIZE-134] + _ = x[SEV-135] + _ = x[SEV_64BIT-136] + _ = x[SEV_ALTERNATIVE-137] + _ = x[SEV_DEBUGSWAP-138] + _ = x[SEV_ES-139] + _ = x[SEV_RESTRICTED-140] + _ = x[SEV_SNP-141] + _ = x[SGX-142] + _ = x[SGXLC-143] + _ = x[SHA-144] + _ = x[SME-145] + _ = x[SME_COHERENT-146] + _ = x[SPEC_CTRL_SSBD-147] + _ = x[SRBDS_CTRL-148] + _ = x[SRSO_MSR_FIX-149] + _ = x[SRSO_NO-150] + _ = x[SRSO_USER_KERNEL_NO-151] + _ = x[SSE-152] + _ = x[SSE2-153] + _ = x[SSE3-154] + _ = x[SSE4-155] + _ = x[SSE42-156] + _ = x[SSE4A-157] + _ = x[SSSE3-158] + _ = x[STIBP-159] + _ = x[STIBP_ALWAYSON-160] + _ = x[STOSB_SHORT-161] + _ = x[SUCCOR-162] + _ = x[SVM-163] + _ = x[SVMDA-164] + _ = x[SVMFBASID-165] + _ = x[SVML-166] + _ = x[SVMNP-167] + _ = x[SVMPF-168] + _ = x[SVMPFT-169] + _ = x[SYSCALL-170] + _ = x[SYSEE-171] + _ = x[TBM-172] + _ = x[TDX_GUEST-173] + _ = x[TLB_FLUSH_NESTED-174] + _ = x[TME-175] + _ = x[TOPEXT-176] + _ = x[TSCRATEMSR-177] + _ = x[TSXLDTRK-178] + _ = x[VAES-179] + _ = x[VMCBCLEAN-180] + _ = x[VMPL-181] + _ = x[VMSA_REGPROT-182] + _ = x[VMX-183] + _ = x[VPCLMULQDQ-184] + _ = x[VTE-185] + _ = x[WAITPKG-186] + _ = x[WBNOINVD-187] + _ = x[WRMSRNS-188] + _ = x[X87-189] + _ = x[XGETBV1-190] + _ = x[XOP-191] + _ = x[XSAVE-192] + _ = x[XSAVEC-193] + _ = x[XSAVEOPT-194] + _ = x[XSAVES-195] + _ = x[AESARM-196] + _ = x[ARMCPUID-197] + _ = x[ASIMD-198] + _ = x[ASIMDDP-199] + _ = x[ASIMDHP-200] + _ = x[ASIMDRDM-201] + _ = x[ATOMICS-202] + _ = x[CRC32-203] + _ = x[DCPOP-204] + _ = x[EVTSTRM-205] + _ = x[FCMA-206] + _ = x[FP-207] + _ = x[FPHP-208] + _ = x[GPA-209] + _ = x[JSCVT-210] + _ = x[LRCPC-211] + _ = x[PMULL-212] + _ = x[SHA1-213] + _ = x[SHA2-214] + _ = x[SHA3-215] + _ = x[SHA512-216] + _ = x[SM3-217] + _ = x[SM4-218] + _ = x[SVE-219] + _ = x[lastID-220] _ = x[firstID-0] } -const _FeatureID_name = "firstIDADXAESNIAMD3DNOWAMD3DNOWEXTAMXBF16AMXFP16AMXINT8AMXTILEAPX_FAVXAVX10AVX10_128AVX10_256AVX10_512AVX2AVX512BF16AVX512BITALGAVX512BWAVX512CDAVX512DQAVX512ERAVX512FAVX512FP16AVX512IFMAAVX512PFAVX512VBMIAVX512VBMI2AVX512VLAVX512VNNIAVX512VP2INTERSECTAVX512VPOPCNTDQAVXIFMAAVXNECONVERTAVXSLOWAVXVNNIAVXVNNIINT8AVXVNNIINT16BHI_CTRLBMI1BMI2CETIBTCETSSCLDEMOTECLMULCLZEROCMOVCMPCCXADDCMPSB_SCADBS_SHORTCMPXCHG8CPBOOSTCPPCCX16EFER_LMSLE_UNSENQCMDERMSF16CFLUSH_L1DFMA3FMA4FP128FP256FSRMFXSRFXSROPTGFNIHLEHRESETHTTHWAHYBRID_CPUHYPERVISORIA32_ARCH_CAPIA32_CORE_CAPIBPBIBPB_BRTYPEIBRSIBRS_PREFERREDIBRS_PROVIDES_SMPIBSIBSBRNTRGTIBSFETCHSAMIBSFFVIBSOPCNTIBSOPCNTEXTIBSOPSAMIBSRDWROPCNTIBSRIPINVALIDCHKIBS_FETCH_CTLXIBS_OPDATA4IBS_OPFUSEIBS_PREVENTHOSTIBS_ZEN4IDPRED_CTRLINT_WBINVDINVLPGBKEYLOCKERKEYLOCKERWLAHFLAMLBRVIRTLZCNTMCAOVERFLOWMCDT_NOMCOMMITMD_CLEARMMXMMXEXTMOVBEMOVDIR64BMOVDIRIMOVSB_ZLMOVUMPXMSRIRCMSRLISTMSR_PAGEFLUSHNRIPSNXOSXSAVEPCONFIGPOPCNTPPINPREFETCHIPSFDRDPRURDRANDRDSEEDRDTSCPRRSBA_CTRLRTMRTM_ALWAYS_ABORTSBPBSERIALIZESEVSEV_64BITSEV_ALTERNATIVESEV_DEBUGSWAPSEV_ESSEV_RESTRICTEDSEV_SNPSGXSGXLCSHASMESME_COHERENTSPEC_CTRL_SSBDSRBDS_CTRLSRSO_MSR_FIXSRSO_NOSRSO_USER_KERNEL_NOSSESSE2SSE3SSE4SSE42SSE4ASSSE3STIBPSTIBP_ALWAYSONSTOSB_SHORTSUCCORSVMSVMDASVMFBASIDSVMLSVMNPSVMPFSVMPFTSYSCALLSYSEETBMTDX_GUESTTLB_FLUSH_NESTEDTMETOPEXTTSCRATEMSRTSXLDTRKVAESVMCBCLEANVMPLVMSA_REGPROTVMXVPCLMULQDQVTEWAITPKGWBNOINVDWRMSRNSX87XGETBV1XOPXSAVEXSAVECXSAVEOPTXSAVESAESARMARMCPUIDASIMDASIMDDPASIMDHPASIMDRDMATOMICSCRC32DCPOPEVTSTRMFCMAFPFPHPGPAJSCVTLRCPCPMULLSHA1SHA2SHA3SHA512SM3SM4SVElastID" +const _FeatureID_name = "firstIDADXAESNIAMD3DNOWAMD3DNOWEXTAMXBF16AMXFP16AMXINT8AMXFP8AMXTILEAPX_FAVXAVX10AVX10_128AVX10_256AVX10_512AVX2AVX512BF16AVX512BITALGAVX512BWAVX512CDAVX512DQAVX512ERAVX512FAVX512FP16AVX512IFMAAVX512PFAVX512VBMIAVX512VBMI2AVX512VLAVX512VNNIAVX512VP2INTERSECTAVX512VPOPCNTDQAVXIFMAAVXNECONVERTAVXSLOWAVXVNNIAVXVNNIINT8AVXVNNIINT16BHI_CTRLBMI1BMI2CETIBTCETSSCLDEMOTECLMULCLZEROCMOVCMPCCXADDCMPSB_SCADBS_SHORTCMPXCHG8CPBOOSTCPPCCX16EFER_LMSLE_UNSENQCMDERMSF16CFLUSH_L1DFMA3FMA4FP128FP256FSRMFXSRFXSROPTGFNIHLEHRESETHTTHWAHYBRID_CPUHYPERVISORIA32_ARCH_CAPIA32_CORE_CAPIBPBIBPB_BRTYPEIBRSIBRS_PREFERREDIBRS_PROVIDES_SMPIBSIBSBRNTRGTIBSFETCHSAMIBSFFVIBSOPCNTIBSOPCNTEXTIBSOPSAMIBSRDWROPCNTIBSRIPINVALIDCHKIBS_FETCH_CTLXIBS_OPDATA4IBS_OPFUSEIBS_PREVENTHOSTIBS_ZEN4IDPRED_CTRLINT_WBINVDINVLPGBKEYLOCKERKEYLOCKERWLAHFLAMLBRVIRTLZCNTMCAOVERFLOWMCDT_NOMCOMMITMD_CLEARMMXMMXEXTMOVBEMOVDIR64BMOVDIRIMOVSB_ZLMOVUMPXMSRIRCMSRLISTMSR_PAGEFLUSHNRIPSNXOSXSAVEPCONFIGPOPCNTPPINPREFETCHIPSFDRDPRURDRANDRDSEEDRDTSCPRRSBA_CTRLRTMRTM_ALWAYS_ABORTSBPBSERIALIZESEVSEV_64BITSEV_ALTERNATIVESEV_DEBUGSWAPSEV_ESSEV_RESTRICTEDSEV_SNPSGXSGXLCSHASMESME_COHERENTSPEC_CTRL_SSBDSRBDS_CTRLSRSO_MSR_FIXSRSO_NOSRSO_USER_KERNEL_NOSSESSE2SSE3SSE4SSE42SSE4ASSSE3STIBPSTIBP_ALWAYSONSTOSB_SHORTSUCCORSVMSVMDASVMFBASIDSVMLSVMNPSVMPFSVMPFTSYSCALLSYSEETBMTDX_GUESTTLB_FLUSH_NESTEDTMETOPEXTTSCRATEMSRTSXLDTRKVAESVMCBCLEANVMPLVMSA_REGPROTVMXVPCLMULQDQVTEWAITPKGWBNOINVDWRMSRNSX87XGETBV1XOPXSAVEXSAVECXSAVEOPTXSAVESAESARMARMCPUIDASIMDASIMDDPASIMDHPASIMDRDMATOMICSCRC32DCPOPEVTSTRMFCMAFPFPHPGPAJSCVTLRCPCPMULLSHA1SHA2SHA3SHA512SM3SM4SVElastID" -var _FeatureID_index = [...]uint16{0, 7, 10, 15, 23, 34, 41, 48, 55, 62, 67, 70, 75, 84, 93, 102, 106, 116, 128, 136, 144, 152, 160, 167, 177, 187, 195, 205, 216, 224, 234, 252, 267, 274, 286, 293, 300, 311, 323, 331, 335, 339, 345, 350, 358, 363, 369, 373, 382, 400, 408, 415, 419, 423, 437, 443, 447, 451, 460, 464, 468, 473, 478, 482, 486, 493, 497, 500, 506, 509, 512, 522, 532, 545, 558, 562, 573, 577, 591, 608, 611, 621, 632, 638, 646, 657, 665, 677, 693, 707, 718, 728, 743, 751, 762, 772, 779, 788, 798, 802, 805, 812, 817, 828, 835, 842, 850, 853, 859, 864, 873, 880, 888, 892, 895, 901, 908, 921, 926, 928, 935, 942, 948, 952, 961, 965, 970, 976, 982, 988, 998, 1001, 1017, 1021, 1030, 1033, 1042, 1057, 1070, 1076, 1090, 1097, 1100, 1105, 1108, 1111, 1123, 1137, 1147, 1159, 1166, 1185, 1188, 1192, 1196, 1200, 1205, 1210, 1215, 1220, 1234, 1245, 1251, 1254, 1259, 1268, 1272, 1277, 1282, 1288, 1295, 1300, 1303, 1312, 1328, 1331, 1337, 1347, 1355, 1359, 1368, 1372, 1384, 1387, 1397, 1400, 1407, 1415, 1422, 1425, 1432, 1435, 1440, 1446, 1454, 1460, 1466, 1474, 1479, 1486, 1493, 1501, 1508, 1513, 1518, 1525, 1529, 1531, 1535, 1538, 1543, 1548, 1553, 1557, 1561, 1565, 1571, 1574, 1577, 1580, 1586} +var _FeatureID_index = [...]uint16{0, 7, 10, 15, 23, 34, 41, 48, 55, 61, 68, 73, 76, 81, 90, 99, 108, 112, 122, 134, 142, 150, 158, 166, 173, 183, 193, 201, 211, 222, 230, 240, 258, 273, 280, 292, 299, 306, 317, 329, 337, 341, 345, 351, 356, 364, 369, 375, 379, 388, 406, 414, 421, 425, 429, 443, 449, 453, 457, 466, 470, 474, 479, 484, 488, 492, 499, 503, 506, 512, 515, 518, 528, 538, 551, 564, 568, 579, 583, 597, 614, 617, 627, 638, 644, 652, 663, 671, 683, 699, 713, 724, 734, 749, 757, 768, 778, 785, 794, 804, 808, 811, 818, 823, 834, 841, 848, 856, 859, 865, 870, 879, 886, 894, 898, 901, 907, 914, 927, 932, 934, 941, 948, 954, 958, 967, 971, 976, 982, 988, 994, 1004, 1007, 1023, 1027, 1036, 1039, 1048, 1063, 1076, 1082, 1096, 1103, 1106, 1111, 1114, 1117, 1129, 1143, 1153, 1165, 1172, 1191, 1194, 1198, 1202, 1206, 1211, 1216, 1221, 1226, 1240, 1251, 1257, 1260, 1265, 1274, 1278, 1283, 1288, 1294, 1301, 1306, 1309, 1318, 1334, 1337, 1343, 1353, 1361, 1365, 1374, 1378, 1390, 1393, 1403, 1406, 1413, 1421, 1428, 1431, 1438, 1441, 1446, 1452, 1460, 1466, 1472, 1480, 1485, 1492, 1499, 1507, 1514, 1519, 1524, 1531, 1535, 1537, 1541, 1544, 1549, 1554, 1559, 1563, 1567, 1571, 1577, 1580, 1583, 1586, 1592} func (i FeatureID) String() string { if i < 0 || i >= FeatureID(len(_FeatureID_index)-1) { @@ -270,12 +271,17 @@ func _() { _ = x[AMCC-23] _ = x[Qualcomm-24] _ = x[Marvell-25] - _ = x[lastVendor-26] + _ = x[QEMU-26] + _ = x[QNX-27] + _ = x[ACRN-28] + _ = x[SRE-29] + _ = x[Apple-30] + _ = x[lastVendor-31] } -const _Vendor_name = "VendorUnknownIntelAMDVIATransmetaNSCKVMMSVMVMwareXenHVMBhyveHygonSiSRDCAmpereARMBroadcomCaviumDECFujitsuInfineonMotorolaNVIDIAAMCCQualcommMarvelllastVendor" +const _Vendor_name = "VendorUnknownIntelAMDVIATransmetaNSCKVMMSVMVMwareXenHVMBhyveHygonSiSRDCAmpereARMBroadcomCaviumDECFujitsuInfineonMotorolaNVIDIAAMCCQualcommMarvellQEMUQNXACRNSREApplelastVendor" -var _Vendor_index = [...]uint8{0, 13, 18, 21, 24, 33, 36, 39, 43, 49, 55, 60, 65, 68, 71, 77, 80, 88, 94, 97, 104, 112, 120, 126, 130, 138, 145, 155} +var _Vendor_index = [...]uint8{0, 13, 18, 21, 24, 33, 36, 39, 43, 49, 55, 60, 65, 68, 71, 77, 80, 88, 94, 97, 104, 112, 120, 126, 130, 138, 145, 149, 152, 156, 159, 164, 174} func (i Vendor) String() string { if i < 0 || i >= Vendor(len(_Vendor_index)-1) { diff --git a/vendor/github.com/labstack/echo/v4/CHANGELOG.md b/vendor/github.com/labstack/echo/v4/CHANGELOG.md index de3857ff..4e88f8ab 100644 --- a/vendor/github.com/labstack/echo/v4/CHANGELOG.md +++ b/vendor/github.com/labstack/echo/v4/CHANGELOG.md @@ -1,5 +1,59 @@ # Changelog +## v4.13.3 - 2024-12-19 + +**Security** + +* Update golang.org/x/net dependency [GO-2024-3333](https://pkg.go.dev/vuln/GO-2024-3333) in https://github.com/labstack/echo/pull/2722 + + +## v4.13.2 - 2024-12-12 + +**Security** + +* Update dependencies (dependabot reports [GO-2024-3321](https://pkg.go.dev/vuln/GO-2024-3321)) in https://github.com/labstack/echo/pull/2721 + + +## v4.13.1 - 2024-12-11 + +**Fixes** + +* Fix BindBody ignoring `Transfer-Encoding: chunked` requests by @178inaba in https://github.com/labstack/echo/pull/2717 + + + +## v4.13.0 - 2024-12-04 + +**BREAKING CHANGE** JWT Middleware Removed from Core use [labstack/echo-jwt](https://github.com/labstack/echo-jwt) instead + +The JWT middleware has been **removed from Echo core** due to another security vulnerability, [CVE-2024-51744](https://nvd.nist.gov/vuln/detail/CVE-2024-51744). For more details, refer to issue [#2699](https://github.com/labstack/echo/issues/2699). A drop-in replacement is available in the [labstack/echo-jwt](https://github.com/labstack/echo-jwt) repository. + +**Important**: Direct assignments like `token := c.Get("user").(*jwt.Token)` will now cause a panic due to an invalid cast. Update your code accordingly. Replace the current imports from `"github.com/golang-jwt/jwt"` in your handlers to the new middleware version using `"github.com/golang-jwt/jwt/v5"`. + + +Background: + +The version of `golang-jwt/jwt` (v3.2.2) previously used in Echo core has been in an unmaintained state for some time. This is not the first vulnerability affecting this library; earlier issues were addressed in [PR #1946](https://github.com/labstack/echo/pull/1946). +JWT middleware was marked as deprecated in Echo core as of [v4.10.0](https://github.com/labstack/echo/releases/tag/v4.10.0) on 2022-12-27. If you did not notice that, consider leveraging tools like [Staticcheck](https://staticcheck.dev/) to catch such deprecations earlier in you dev/CI flow. For bonus points - check out [gosec](https://github.com/securego/gosec). + +We sincerely apologize for any inconvenience caused by this change. While we strive to maintain backward compatibility within Echo core, recurring security issues with third-party dependencies have forced this decision. + +**Enhancements** + +* remove jwt middleware by @stevenwhitehead in https://github.com/labstack/echo/pull/2701 +* optimization: struct alignment by @behnambm in https://github.com/labstack/echo/pull/2636 +* bind: Maintain backwards compatibility for map[string]interface{} binding by @thesaltree in https://github.com/labstack/echo/pull/2656 +* Add Go 1.23 to CI by @aldas in https://github.com/labstack/echo/pull/2675 +* improve `MultipartForm` test by @martinyonatann in https://github.com/labstack/echo/pull/2682 +* `bind` : add support of multipart multi files by @martinyonatann in https://github.com/labstack/echo/pull/2684 +* Add TemplateRenderer struct to ease creating renderers for `html/template` and `text/template` packages. by @aldas in https://github.com/labstack/echo/pull/2690 +* Refactor TestBasicAuth to utilize table-driven test format by @ErikOlson in https://github.com/labstack/echo/pull/2688 +* Remove broken header by @aldas in https://github.com/labstack/echo/pull/2705 +* fix(bind body): content-length can be -1 by @phamvinhdat in https://github.com/labstack/echo/pull/2710 +* CORS middleware should compile allowOrigin regexp at creation by @aldas in https://github.com/labstack/echo/pull/2709 +* Shorten Github issue template and add test example by @aldas in https://github.com/labstack/echo/pull/2711 + + ## v4.12.0 - 2024-04-15 **Security** diff --git a/vendor/github.com/labstack/echo/v4/Makefile b/vendor/github.com/labstack/echo/v4/Makefile index f9e5afb0..c07d8bb4 100644 --- a/vendor/github.com/labstack/echo/v4/Makefile +++ b/vendor/github.com/labstack/echo/v4/Makefile @@ -31,6 +31,6 @@ benchmark: ## Run benchmarks help: ## Display this help screen @grep -h -E '^[a-zA-Z_-]+:.*?## .*$$' $(MAKEFILE_LIST) | awk 'BEGIN {FS = ":.*?## "}; {printf "\033[36m%-30s\033[0m %s\n", $$1, $$2}' -goversion ?= "1.19" -test_version: ## Run tests inside Docker with given version (defaults to 1.19 oldest supported). Example: make test_version goversion=1.19 +goversion ?= "1.20" +test_version: ## Run tests inside Docker with given version (defaults to 1.20 oldest supported). Example: make test_version goversion=1.20 @docker run --rm -it -v $(shell pwd):/project golang:$(goversion) /bin/sh -c "cd /project && make init check" diff --git a/vendor/github.com/labstack/echo/v4/README.md b/vendor/github.com/labstack/echo/v4/README.md index 351ba3c5..5381898d 100644 --- a/vendor/github.com/labstack/echo/v4/README.md +++ b/vendor/github.com/labstack/echo/v4/README.md @@ -1,5 +1,3 @@ - - [![Sourcegraph](https://sourcegraph.com/github.com/labstack/echo/-/badge.svg?style=flat-square)](https://sourcegraph.com/github.com/labstack/echo?badge) [![GoDoc](http://img.shields.io/badge/go-documentation-blue.svg?style=flat-square)](https://pkg.go.dev/github.com/labstack/echo/v4) [![Go Report Card](https://goreportcard.com/badge/github.com/labstack/echo?style=flat-square)](https://goreportcard.com/report/github.com/labstack/echo) @@ -77,6 +75,7 @@ package main import ( "github.com/labstack/echo/v4" "github.com/labstack/echo/v4/middleware" + "log/slog" "net/http" ) @@ -92,7 +91,9 @@ func main() { e.GET("/", hello) // Start server - e.Logger.Fatal(e.Start(":1323")) + if err := e.Start(":8080"); err != nil && !errors.Is(err, http.ErrServerClosed) { + slog.Error("failed to start server", "error", err) + } } // Handler diff --git a/vendor/github.com/labstack/echo/v4/bind.go b/vendor/github.com/labstack/echo/v4/bind.go index 507def3e..ed7ca324 100644 --- a/vendor/github.com/labstack/echo/v4/bind.go +++ b/vendor/github.com/labstack/echo/v4/bind.go @@ -8,6 +8,7 @@ import ( "encoding/xml" "errors" "fmt" + "mime/multipart" "net/http" "reflect" "strconv" @@ -45,7 +46,7 @@ func (b *DefaultBinder) BindPathParams(c Context, i interface{}) error { for i, name := range names { params[name] = []string{values[i]} } - if err := b.bindData(i, params, "param"); err != nil { + if err := b.bindData(i, params, "param", nil); err != nil { return NewHTTPError(http.StatusBadRequest, err.Error()).SetInternal(err) } return nil @@ -53,7 +54,7 @@ func (b *DefaultBinder) BindPathParams(c Context, i interface{}) error { // BindQueryParams binds query params to bindable object func (b *DefaultBinder) BindQueryParams(c Context, i interface{}) error { - if err := b.bindData(i, c.QueryParams(), "query"); err != nil { + if err := b.bindData(i, c.QueryParams(), "query", nil); err != nil { return NewHTTPError(http.StatusBadRequest, err.Error()).SetInternal(err) } return nil @@ -70,9 +71,12 @@ func (b *DefaultBinder) BindBody(c Context, i interface{}) (err error) { return } - ctype := req.Header.Get(HeaderContentType) - switch { - case strings.HasPrefix(ctype, MIMEApplicationJSON): + // mediatype is found like `mime.ParseMediaType()` does it + base, _, _ := strings.Cut(req.Header.Get(HeaderContentType), ";") + mediatype := strings.TrimSpace(base) + + switch mediatype { + case MIMEApplicationJSON: if err = c.Echo().JSONSerializer.Deserialize(c, i); err != nil { switch err.(type) { case *HTTPError: @@ -81,7 +85,7 @@ func (b *DefaultBinder) BindBody(c Context, i interface{}) (err error) { return NewHTTPError(http.StatusBadRequest, err.Error()).SetInternal(err) } } - case strings.HasPrefix(ctype, MIMEApplicationXML), strings.HasPrefix(ctype, MIMETextXML): + case MIMEApplicationXML, MIMETextXML: if err = xml.NewDecoder(req.Body).Decode(i); err != nil { if ute, ok := err.(*xml.UnsupportedTypeError); ok { return NewHTTPError(http.StatusBadRequest, fmt.Sprintf("Unsupported type error: type=%v, error=%v", ute.Type, ute.Error())).SetInternal(err) @@ -90,12 +94,20 @@ func (b *DefaultBinder) BindBody(c Context, i interface{}) (err error) { } return NewHTTPError(http.StatusBadRequest, err.Error()).SetInternal(err) } - case strings.HasPrefix(ctype, MIMEApplicationForm), strings.HasPrefix(ctype, MIMEMultipartForm): + case MIMEApplicationForm: params, err := c.FormParams() if err != nil { return NewHTTPError(http.StatusBadRequest, err.Error()).SetInternal(err) } - if err = b.bindData(i, params, "form"); err != nil { + if err = b.bindData(i, params, "form", nil); err != nil { + return NewHTTPError(http.StatusBadRequest, err.Error()).SetInternal(err) + } + case MIMEMultipartForm: + params, err := c.MultipartForm() + if err != nil { + return NewHTTPError(http.StatusBadRequest, err.Error()).SetInternal(err) + } + if err = b.bindData(i, params.Value, "form", params.File); err != nil { return NewHTTPError(http.StatusBadRequest, err.Error()).SetInternal(err) } default: @@ -106,7 +118,7 @@ func (b *DefaultBinder) BindBody(c Context, i interface{}) (err error) { // BindHeaders binds HTTP headers to a bindable object func (b *DefaultBinder) BindHeaders(c Context, i interface{}) error { - if err := b.bindData(i, c.Request().Header, "header"); err != nil { + if err := b.bindData(i, c.Request().Header, "header", nil); err != nil { return NewHTTPError(http.StatusBadRequest, err.Error()).SetInternal(err) } return nil @@ -132,10 +144,11 @@ func (b *DefaultBinder) Bind(i interface{}, c Context) (err error) { } // bindData will bind data ONLY fields in destination struct that have EXPLICIT tag -func (b *DefaultBinder) bindData(destination interface{}, data map[string][]string, tag string) error { - if destination == nil || len(data) == 0 { +func (b *DefaultBinder) bindData(destination interface{}, data map[string][]string, tag string, dataFiles map[string][]*multipart.FileHeader) error { + if destination == nil || (len(data) == 0 && len(dataFiles) == 0) { return nil } + hasFiles := len(dataFiles) > 0 typ := reflect.TypeOf(destination).Elem() val := reflect.ValueOf(destination).Elem() @@ -159,6 +172,10 @@ func (b *DefaultBinder) bindData(destination interface{}, data map[string][]stri for k, v := range data { if isElemString { val.SetMapIndex(reflect.ValueOf(k), reflect.ValueOf(v[0])) + } else if isElemInterface { + // To maintain backward compatibility, we always bind to the first string value + // and not the slice of strings when dealing with map[string]interface{}{} + val.SetMapIndex(reflect.ValueOf(k), reflect.ValueOf(v[0])) } else { val.SetMapIndex(reflect.ValueOf(k), reflect.ValueOf(v)) } @@ -175,7 +192,7 @@ func (b *DefaultBinder) bindData(destination interface{}, data map[string][]stri return errors.New("binding element must be a struct") } - for i := 0; i < typ.NumField(); i++ { + for i := 0; i < typ.NumField(); i++ { // iterate over all destination fields typeField := typ.Field(i) structField := val.Field(i) if typeField.Anonymous { @@ -194,10 +211,10 @@ func (b *DefaultBinder) bindData(destination interface{}, data map[string][]stri } if inputFieldName == "" { - // If tag is nil, we inspect if the field is a not BindUnmarshaler struct and try to bind data into it (might contains fields with tags). + // If tag is nil, we inspect if the field is a not BindUnmarshaler struct and try to bind data into it (might contain fields with tags). // structs that implement BindUnmarshaler are bound only when they have explicit tag if _, ok := structField.Addr().Interface().(BindUnmarshaler); !ok && structFieldKind == reflect.Struct { - if err := b.bindData(structField.Addr().Interface(), data, tag); err != nil { + if err := b.bindData(structField.Addr().Interface(), data, tag, dataFiles); err != nil { return err } } @@ -205,10 +222,20 @@ func (b *DefaultBinder) bindData(destination interface{}, data map[string][]stri continue } + if hasFiles { + if ok, err := isFieldMultipartFile(structField.Type()); err != nil { + return err + } else if ok { + if ok := setMultipartFileHeaderTypes(structField, inputFieldName, dataFiles); ok { + continue + } + } + } + inputValue, exists := data[inputFieldName] if !exists { - // Go json.Unmarshal supports case insensitive binding. However the - // url params are bound case sensitive which is inconsistent. To + // Go json.Unmarshal supports case-insensitive binding. However the + // url params are bound case-sensitive which is inconsistent. To // fix this we must check all of the map values in a // case-insensitive search. for k, v := range data { @@ -390,3 +417,50 @@ func setFloatField(value string, bitSize int, field reflect.Value) error { } return err } + +var ( + // NOT supported by bind as you can NOT check easily empty struct being actual file or not + multipartFileHeaderType = reflect.TypeOf(multipart.FileHeader{}) + // supported by bind as you can check by nil value if file existed or not + multipartFileHeaderPointerType = reflect.TypeOf(&multipart.FileHeader{}) + multipartFileHeaderSliceType = reflect.TypeOf([]multipart.FileHeader(nil)) + multipartFileHeaderPointerSliceType = reflect.TypeOf([]*multipart.FileHeader(nil)) +) + +func isFieldMultipartFile(field reflect.Type) (bool, error) { + switch field { + case multipartFileHeaderPointerType, + multipartFileHeaderSliceType, + multipartFileHeaderPointerSliceType: + return true, nil + case multipartFileHeaderType: + return true, errors.New("binding to multipart.FileHeader struct is not supported, use pointer to struct") + default: + return false, nil + } +} + +func setMultipartFileHeaderTypes(structField reflect.Value, inputFieldName string, files map[string][]*multipart.FileHeader) bool { + fileHeaders := files[inputFieldName] + if len(fileHeaders) == 0 { + return false + } + + result := true + switch structField.Type() { + case multipartFileHeaderPointerSliceType: + structField.Set(reflect.ValueOf(fileHeaders)) + case multipartFileHeaderSliceType: + headers := make([]multipart.FileHeader, len(fileHeaders)) + for i, fileHeader := range fileHeaders { + headers[i] = *fileHeader + } + structField.Set(reflect.ValueOf(headers)) + case multipartFileHeaderPointerType: + structField.Set(reflect.ValueOf(fileHeaders[0])) + default: + result = false + } + + return result +} diff --git a/vendor/github.com/labstack/echo/v4/binder.go b/vendor/github.com/labstack/echo/v4/binder.go index ebabeaf9..da15ae82 100644 --- a/vendor/github.com/labstack/echo/v4/binder.go +++ b/vendor/github.com/labstack/echo/v4/binder.go @@ -69,9 +69,9 @@ import ( type BindingError struct { // Field is the field name where value binding failed Field string `json:"field"` + *HTTPError // Values of parameter that failed to bind. Values []string `json:"-"` - *HTTPError } // NewBindingError creates new instance of binding error @@ -94,16 +94,15 @@ func (be *BindingError) Error() string { // ValueBinder provides utility methods for binding query or path parameter to various Go built-in types type ValueBinder struct { - // failFast is flag for binding methods to return without attempting to bind when previous binding already failed - failFast bool - errors []error - // ValueFunc is used to get single parameter (first) value from request ValueFunc func(sourceParam string) string // ValuesFunc is used to get all values for parameter from request. i.e. `/api/search?ids=1&ids=2` ValuesFunc func(sourceParam string) []string // ErrorFunc is used to create errors. Allows you to use your own error type, that for example marshals to your specific json response ErrorFunc func(sourceParam string, values []string, message interface{}, internalError error) error + errors []error + // failFast is flag for binding methods to return without attempting to bind when previous binding already failed + failFast bool } // QueryParamsBinder creates query parameter value binder diff --git a/vendor/github.com/labstack/echo/v4/context.go b/vendor/github.com/labstack/echo/v4/context.go index 4edaa2ee..f5dd5a69 100644 --- a/vendor/github.com/labstack/echo/v4/context.go +++ b/vendor/github.com/labstack/echo/v4/context.go @@ -200,31 +200,31 @@ type Context interface { } type context struct { + logger Logger request *http.Request response *Response query url.Values echo *Echo - logger Logger store Map lock sync.RWMutex // following fields are set by Router + handler HandlerFunc // path is route path that Router matched. It is empty string where there is no route match. // Route registered with RouteNotFound is considered as a match and path therefore is not empty. path string - // pnames length is tied to param count for the matched route - pnames []string - // Usually echo.Echo is sizing pvalues but there could be user created middlewares that decide to // overwrite parameter by calling SetParamNames + SetParamValues. // When echo.Echo allocated that slice it length/capacity is tied to echo.Echo.maxParam value. // // It is important that pvalues size is always equal or bigger to pnames length. pvalues []string - handler HandlerFunc + + // pnames length is tied to param count for the matched route + pnames []string } const ( diff --git a/vendor/github.com/labstack/echo/v4/echo.go b/vendor/github.com/labstack/echo/v4/echo.go index ab66b0da..60f7061d 100644 --- a/vendor/github.com/labstack/echo/v4/echo.go +++ b/vendor/github.com/labstack/echo/v4/echo.go @@ -45,7 +45,6 @@ import ( "encoding/json" "errors" "fmt" - "io" stdLog "log" "net" "net/http" @@ -91,10 +90,6 @@ type Echo struct { Listener net.Listener TLSListener net.Listener AutoTLSManager autocert.Manager - DisableHTTP2 bool - Debug bool - HideBanner bool - HidePort bool HTTPErrorHandler HTTPErrorHandler Binder Binder JSONSerializer JSONSerializer @@ -106,6 +101,10 @@ type Echo struct { // OnAddRouteHandler is called when Echo adds new route to specific host router. OnAddRouteHandler func(host string, route Route, handler HandlerFunc, middleware []MiddlewareFunc) + DisableHTTP2 bool + Debug bool + HideBanner bool + HidePort bool } // Route contains a handler and information for matching against requests. @@ -117,9 +116,9 @@ type Route struct { // HTTPError represents an error that occurred while handling a request. type HTTPError struct { - Code int `json:"-"` - Message interface{} `json:"message"` Internal error `json:"-"` // Stores the error returned by an external dependency + Message interface{} `json:"message"` + Code int `json:"-"` } // MiddlewareFunc defines a function to process middleware. @@ -142,11 +141,6 @@ type JSONSerializer interface { Deserialize(c Context, i interface{}) error } -// Renderer is the interface that wraps the Render function. -type Renderer interface { - Render(io.Writer, string, interface{}, Context) error -} - // Map defines a generic map of type `map[string]interface{}`. type Map map[string]interface{} @@ -265,7 +259,7 @@ const ( const ( // Version of Echo - Version = "4.12.0" + Version = "4.13.3" website = "https://echo.labstack.com" // http://patorjk.com/software/taag/#p=display&f=Small%20Slant&t=Echo banner = ` diff --git a/vendor/github.com/labstack/echo/v4/echo_fs.go b/vendor/github.com/labstack/echo/v4/echo_fs.go index a7b231f3..0ffc4b0b 100644 --- a/vendor/github.com/labstack/echo/v4/echo_fs.go +++ b/vendor/github.com/labstack/echo/v4/echo_fs.go @@ -102,8 +102,8 @@ func StaticFileHandler(file string, filesystem fs.FS) HandlerFunc { // traverse up from current executable run path. // NB: private because you really should use fs.FS implementation instances type defaultFS struct { - prefix string fs fs.FS + prefix string } func newDefaultFS() *defaultFS { diff --git a/vendor/github.com/labstack/echo/v4/group.go b/vendor/github.com/labstack/echo/v4/group.go index eca25c94..cb37b123 100644 --- a/vendor/github.com/labstack/echo/v4/group.go +++ b/vendor/github.com/labstack/echo/v4/group.go @@ -14,8 +14,8 @@ type Group struct { common host string prefix string - middleware []MiddlewareFunc echo *Echo + middleware []MiddlewareFunc } // Use implements `Echo#Use()` for sub-routes within the Group. diff --git a/vendor/github.com/labstack/echo/v4/ip.go b/vendor/github.com/labstack/echo/v4/ip.go index 6aed8d60..393a6c2d 100644 --- a/vendor/github.com/labstack/echo/v4/ip.go +++ b/vendor/github.com/labstack/echo/v4/ip.go @@ -134,10 +134,10 @@ Private IPv6 address ranges: */ type ipChecker struct { + trustExtraRanges []*net.IPNet trustLoopback bool trustLinkLocal bool trustPrivateNet bool - trustExtraRanges []*net.IPNet } // TrustOption is config for which IP address to trust diff --git a/vendor/github.com/labstack/echo/v4/middleware/body_dump.go b/vendor/github.com/labstack/echo/v4/middleware/body_dump.go index b06f7620..e4119ec1 100644 --- a/vendor/github.com/labstack/echo/v4/middleware/body_dump.go +++ b/vendor/github.com/labstack/echo/v4/middleware/body_dump.go @@ -98,14 +98,14 @@ func (w *bodyDumpResponseWriter) Write(b []byte) (int, error) { } func (w *bodyDumpResponseWriter) Flush() { - err := responseControllerFlush(w.ResponseWriter) + err := http.NewResponseController(w.ResponseWriter).Flush() if err != nil && errors.Is(err, http.ErrNotSupported) { panic(errors.New("response writer flushing is not supported")) } } func (w *bodyDumpResponseWriter) Hijack() (net.Conn, *bufio.ReadWriter, error) { - return responseControllerHijack(w.ResponseWriter) + return http.NewResponseController(w.ResponseWriter).Hijack() } func (w *bodyDumpResponseWriter) Unwrap() http.ResponseWriter { diff --git a/vendor/github.com/labstack/echo/v4/middleware/compress.go b/vendor/github.com/labstack/echo/v4/middleware/compress.go index 557bdc8e..012b76b0 100644 --- a/vendor/github.com/labstack/echo/v4/middleware/compress.go +++ b/vendor/github.com/labstack/echo/v4/middleware/compress.go @@ -190,7 +190,7 @@ func (w *gzipResponseWriter) Flush() { } w.Writer.(*gzip.Writer).Flush() - _ = responseControllerFlush(w.ResponseWriter) + _ = http.NewResponseController(w.ResponseWriter).Flush() } func (w *gzipResponseWriter) Unwrap() http.ResponseWriter { @@ -198,7 +198,7 @@ func (w *gzipResponseWriter) Unwrap() http.ResponseWriter { } func (w *gzipResponseWriter) Hijack() (net.Conn, *bufio.ReadWriter, error) { - return responseControllerHijack(w.ResponseWriter) + return http.NewResponseController(w.ResponseWriter).Hijack() } func (w *gzipResponseWriter) Push(target string, opts *http.PushOptions) error { diff --git a/vendor/github.com/labstack/echo/v4/middleware/cors.go b/vendor/github.com/labstack/echo/v4/middleware/cors.go index 7af6a76f..a1f44532 100644 --- a/vendor/github.com/labstack/echo/v4/middleware/cors.go +++ b/vendor/github.com/labstack/echo/v4/middleware/cors.go @@ -147,13 +147,25 @@ func CORSWithConfig(config CORSConfig) echo.MiddlewareFunc { config.AllowMethods = DefaultCORSConfig.AllowMethods } - allowOriginPatterns := []string{} + allowOriginPatterns := make([]*regexp.Regexp, 0, len(config.AllowOrigins)) for _, origin := range config.AllowOrigins { + if origin == "*" { + continue // "*" is handled differently and does not need regexp + } pattern := regexp.QuoteMeta(origin) pattern = strings.ReplaceAll(pattern, "\\*", ".*") pattern = strings.ReplaceAll(pattern, "\\?", ".") pattern = "^" + pattern + "$" - allowOriginPatterns = append(allowOriginPatterns, pattern) + + re, err := regexp.Compile(pattern) + if err != nil { + // this is to preserve previous behaviour - invalid patterns were just ignored. + // If we would turn this to panic, users with invalid patterns + // would have applications crashing in production due unrecovered panic. + // TODO: this should be turned to error/panic in `v5` + continue + } + allowOriginPatterns = append(allowOriginPatterns, re) } allowMethods := strings.Join(config.AllowMethods, ",") @@ -239,7 +251,7 @@ func CORSWithConfig(config CORSConfig) echo.MiddlewareFunc { } if checkPatterns { for _, re := range allowOriginPatterns { - if match, _ := regexp.MatchString(re, origin); match { + if match := re.MatchString(origin); match { allowOrigin = origin break } diff --git a/vendor/github.com/labstack/echo/v4/middleware/jwt.go b/vendor/github.com/labstack/echo/v4/middleware/jwt.go deleted file mode 100644 index a6bf16f9..00000000 --- a/vendor/github.com/labstack/echo/v4/middleware/jwt.go +++ /dev/null @@ -1,303 +0,0 @@ -// SPDX-License-Identifier: MIT -// SPDX-FileCopyrightText: © 2015 LabStack LLC and Echo contributors - -//go:build go1.15 -// +build go1.15 - -package middleware - -import ( - "errors" - "fmt" - "github.com/golang-jwt/jwt" - "github.com/labstack/echo/v4" - "net/http" - "reflect" -) - -// JWTConfig defines the config for JWT middleware. -type JWTConfig struct { - // Skipper defines a function to skip middleware. - Skipper Skipper - - // BeforeFunc defines a function which is executed just before the middleware. - BeforeFunc BeforeFunc - - // SuccessHandler defines a function which is executed for a valid token before middleware chain continues with next - // middleware or handler. - SuccessHandler JWTSuccessHandler - - // ErrorHandler defines a function which is executed for an invalid token. - // It may be used to define a custom JWT error. - ErrorHandler JWTErrorHandler - - // ErrorHandlerWithContext is almost identical to ErrorHandler, but it's passed the current context. - ErrorHandlerWithContext JWTErrorHandlerWithContext - - // ContinueOnIgnoredError allows the next middleware/handler to be called when ErrorHandlerWithContext decides to - // ignore the error (by returning `nil`). - // This is useful when parts of your site/api allow public access and some authorized routes provide extra functionality. - // In that case you can use ErrorHandlerWithContext to set a default public JWT token value in the request context - // and continue. Some logic down the remaining execution chain needs to check that (public) token value then. - ContinueOnIgnoredError bool - - // Signing key to validate token. - // This is one of the three options to provide a token validation key. - // The order of precedence is a user-defined KeyFunc, SigningKeys and SigningKey. - // Required if neither user-defined KeyFunc nor SigningKeys is provided. - SigningKey interface{} - - // Map of signing keys to validate token with kid field usage. - // This is one of the three options to provide a token validation key. - // The order of precedence is a user-defined KeyFunc, SigningKeys and SigningKey. - // Required if neither user-defined KeyFunc nor SigningKey is provided. - SigningKeys map[string]interface{} - - // Signing method used to check the token's signing algorithm. - // Optional. Default value HS256. - SigningMethod string - - // Context key to store user information from the token into context. - // Optional. Default value "user". - ContextKey string - - // Claims are extendable claims data defining token content. Used by default ParseTokenFunc implementation. - // Not used if custom ParseTokenFunc is set. - // Optional. Default value jwt.MapClaims - Claims jwt.Claims - - // TokenLookup is a string in the form of ":" or ":,:" that is used - // to extract token from the request. - // Optional. Default value "header:Authorization". - // Possible values: - // - "header:" or "header::" - // `` is argument value to cut/trim prefix of the extracted value. This is useful if header - // value has static prefix like `Authorization: ` where part that we - // want to cut is ` ` note the space at the end. - // In case of JWT tokens `Authorization: Bearer ` prefix we cut is `Bearer `. - // If prefix is left empty the whole value is returned. - // - "query:" - // - "param:" - // - "cookie:" - // - "form:" - // Multiple sources example: - // - "header:Authorization,cookie:myowncookie" - TokenLookup string - - // TokenLookupFuncs defines a list of user-defined functions that extract JWT token from the given context. - // This is one of the two options to provide a token extractor. - // The order of precedence is user-defined TokenLookupFuncs, and TokenLookup. - // You can also provide both if you want. - TokenLookupFuncs []ValuesExtractor - - // AuthScheme to be used in the Authorization header. - // Optional. Default value "Bearer". - AuthScheme string - - // KeyFunc defines a user-defined function that supplies the public key for a token validation. - // The function shall take care of verifying the signing algorithm and selecting the proper key. - // A user-defined KeyFunc can be useful if tokens are issued by an external party. - // Used by default ParseTokenFunc implementation. - // - // When a user-defined KeyFunc is provided, SigningKey, SigningKeys, and SigningMethod are ignored. - // This is one of the three options to provide a token validation key. - // The order of precedence is a user-defined KeyFunc, SigningKeys and SigningKey. - // Required if neither SigningKeys nor SigningKey is provided. - // Not used if custom ParseTokenFunc is set. - // Default to an internal implementation verifying the signing algorithm and selecting the proper key. - KeyFunc jwt.Keyfunc - - // ParseTokenFunc defines a user-defined function that parses token from given auth. Returns an error when token - // parsing fails or parsed token is invalid. - // Defaults to implementation using `github.com/golang-jwt/jwt` as JWT implementation library - ParseTokenFunc func(auth string, c echo.Context) (interface{}, error) -} - -// JWTSuccessHandler defines a function which is executed for a valid token. -type JWTSuccessHandler func(c echo.Context) - -// JWTErrorHandler defines a function which is executed for an invalid token. -type JWTErrorHandler func(err error) error - -// JWTErrorHandlerWithContext is almost identical to JWTErrorHandler, but it's passed the current context. -type JWTErrorHandlerWithContext func(err error, c echo.Context) error - -// Algorithms -const ( - AlgorithmHS256 = "HS256" -) - -// ErrJWTMissing is error that is returned when no JWToken was extracted from the request. -var ErrJWTMissing = echo.NewHTTPError(http.StatusBadRequest, "missing or malformed jwt") - -// ErrJWTInvalid is error that is returned when middleware could not parse JWT correctly. -var ErrJWTInvalid = echo.NewHTTPError(http.StatusUnauthorized, "invalid or expired jwt") - -// DefaultJWTConfig is the default JWT auth middleware config. -var DefaultJWTConfig = JWTConfig{ - Skipper: DefaultSkipper, - SigningMethod: AlgorithmHS256, - ContextKey: "user", - TokenLookup: "header:" + echo.HeaderAuthorization, - TokenLookupFuncs: nil, - AuthScheme: "Bearer", - Claims: jwt.MapClaims{}, - KeyFunc: nil, -} - -// JWT returns a JSON Web Token (JWT) auth middleware. -// -// For valid token, it sets the user in context and calls next handler. -// For invalid token, it returns "401 - Unauthorized" error. -// For missing token, it returns "400 - Bad Request" error. -// -// See: https://jwt.io/introduction -// See `JWTConfig.TokenLookup` -// -// Deprecated: Please use https://github.com/labstack/echo-jwt instead -func JWT(key interface{}) echo.MiddlewareFunc { - c := DefaultJWTConfig - c.SigningKey = key - return JWTWithConfig(c) -} - -// JWTWithConfig returns a JWT auth middleware with config. -// See: `JWT()`. -// -// Deprecated: Please use https://github.com/labstack/echo-jwt instead -func JWTWithConfig(config JWTConfig) echo.MiddlewareFunc { - // Defaults - if config.Skipper == nil { - config.Skipper = DefaultJWTConfig.Skipper - } - if config.SigningKey == nil && len(config.SigningKeys) == 0 && config.KeyFunc == nil && config.ParseTokenFunc == nil { - panic("echo: jwt middleware requires signing key") - } - if config.SigningMethod == "" { - config.SigningMethod = DefaultJWTConfig.SigningMethod - } - if config.ContextKey == "" { - config.ContextKey = DefaultJWTConfig.ContextKey - } - if config.Claims == nil { - config.Claims = DefaultJWTConfig.Claims - } - if config.TokenLookup == "" && len(config.TokenLookupFuncs) == 0 { - config.TokenLookup = DefaultJWTConfig.TokenLookup - } - if config.AuthScheme == "" { - config.AuthScheme = DefaultJWTConfig.AuthScheme - } - if config.KeyFunc == nil { - config.KeyFunc = config.defaultKeyFunc - } - if config.ParseTokenFunc == nil { - config.ParseTokenFunc = config.defaultParseToken - } - - extractors, cErr := createExtractors(config.TokenLookup, config.AuthScheme) - if cErr != nil { - panic(cErr) - } - if len(config.TokenLookupFuncs) > 0 { - extractors = append(config.TokenLookupFuncs, extractors...) - } - - return func(next echo.HandlerFunc) echo.HandlerFunc { - return func(c echo.Context) error { - if config.Skipper(c) { - return next(c) - } - - if config.BeforeFunc != nil { - config.BeforeFunc(c) - } - - var lastExtractorErr error - var lastTokenErr error - for _, extractor := range extractors { - auths, err := extractor(c) - if err != nil { - lastExtractorErr = ErrJWTMissing // backwards compatibility: all extraction errors are same (unlike KeyAuth) - continue - } - for _, auth := range auths { - token, err := config.ParseTokenFunc(auth, c) - if err != nil { - lastTokenErr = err - continue - } - // Store user information from token into context. - c.Set(config.ContextKey, token) - if config.SuccessHandler != nil { - config.SuccessHandler(c) - } - return next(c) - } - } - // we are here only when we did not successfully extract or parse any of the tokens - err := lastTokenErr - if err == nil { // prioritize token errors over extracting errors - err = lastExtractorErr - } - if config.ErrorHandler != nil { - return config.ErrorHandler(err) - } - if config.ErrorHandlerWithContext != nil { - tmpErr := config.ErrorHandlerWithContext(err, c) - if config.ContinueOnIgnoredError && tmpErr == nil { - return next(c) - } - return tmpErr - } - - // backwards compatible errors codes - if lastTokenErr != nil { - return &echo.HTTPError{ - Code: ErrJWTInvalid.Code, - Message: ErrJWTInvalid.Message, - Internal: err, - } - } - return err // this is lastExtractorErr value - } - } -} - -func (config *JWTConfig) defaultParseToken(auth string, c echo.Context) (interface{}, error) { - var token *jwt.Token - var err error - // Issue #647, #656 - if _, ok := config.Claims.(jwt.MapClaims); ok { - token, err = jwt.Parse(auth, config.KeyFunc) - } else { - t := reflect.ValueOf(config.Claims).Type().Elem() - claims := reflect.New(t).Interface().(jwt.Claims) - token, err = jwt.ParseWithClaims(auth, claims, config.KeyFunc) - } - if err != nil { - return nil, err - } - if !token.Valid { - return nil, errors.New("invalid token") - } - return token, nil -} - -// defaultKeyFunc returns a signing key of the given token. -func (config *JWTConfig) defaultKeyFunc(t *jwt.Token) (interface{}, error) { - // Check the signing method - if t.Method.Alg() != config.SigningMethod { - return nil, fmt.Errorf("unexpected jwt signing method=%v", t.Header["alg"]) - } - if len(config.SigningKeys) > 0 { - if kid, ok := t.Header["kid"].(string); ok { - if key, ok := config.SigningKeys[kid]; ok { - return key, nil - } - } - return nil, fmt.Errorf("unexpected jwt key id=%v", t.Header["kid"]) - } - - return config.SigningKey, nil -} diff --git a/vendor/github.com/labstack/echo/v4/middleware/responsecontroller_1.19.go b/vendor/github.com/labstack/echo/v4/middleware/responsecontroller_1.19.go deleted file mode 100644 index ddf6b64c..00000000 --- a/vendor/github.com/labstack/echo/v4/middleware/responsecontroller_1.19.go +++ /dev/null @@ -1,44 +0,0 @@ -// SPDX-License-Identifier: MIT -// SPDX-FileCopyrightText: © 2015 LabStack LLC and Echo contributors - -//go:build !go1.20 - -package middleware - -import ( - "bufio" - "fmt" - "net" - "net/http" -) - -// TODO: remove when Go 1.23 is released and we do not support 1.19 anymore -func responseControllerFlush(rw http.ResponseWriter) error { - for { - switch t := rw.(type) { - case interface{ FlushError() error }: - return t.FlushError() - case http.Flusher: - t.Flush() - return nil - case interface{ Unwrap() http.ResponseWriter }: - rw = t.Unwrap() - default: - return fmt.Errorf("%w", http.ErrNotSupported) - } - } -} - -// TODO: remove when Go 1.23 is released and we do not support 1.19 anymore -func responseControllerHijack(rw http.ResponseWriter) (net.Conn, *bufio.ReadWriter, error) { - for { - switch t := rw.(type) { - case http.Hijacker: - return t.Hijack() - case interface{ Unwrap() http.ResponseWriter }: - rw = t.Unwrap() - default: - return nil, nil, fmt.Errorf("%w", http.ErrNotSupported) - } - } -} diff --git a/vendor/github.com/labstack/echo/v4/middleware/responsecontroller_1.20.go b/vendor/github.com/labstack/echo/v4/middleware/responsecontroller_1.20.go deleted file mode 100644 index bc03059b..00000000 --- a/vendor/github.com/labstack/echo/v4/middleware/responsecontroller_1.20.go +++ /dev/null @@ -1,20 +0,0 @@ -// SPDX-License-Identifier: MIT -// SPDX-FileCopyrightText: © 2015 LabStack LLC and Echo contributors - -//go:build go1.20 - -package middleware - -import ( - "bufio" - "net" - "net/http" -) - -func responseControllerFlush(rw http.ResponseWriter) error { - return http.NewResponseController(rw).Flush() -} - -func responseControllerHijack(rw http.ResponseWriter) (net.Conn, *bufio.ReadWriter, error) { - return http.NewResponseController(rw).Hijack() -} diff --git a/vendor/github.com/labstack/echo/v4/renderer.go b/vendor/github.com/labstack/echo/v4/renderer.go new file mode 100644 index 00000000..44e038f3 --- /dev/null +++ b/vendor/github.com/labstack/echo/v4/renderer.go @@ -0,0 +1,29 @@ +package echo + +import "io" + +// Renderer is the interface that wraps the Render function. +type Renderer interface { + Render(io.Writer, string, interface{}, Context) error +} + +// TemplateRenderer is helper to ease creating renderers for `html/template` and `text/template` packages. +// Example usage: +// +// e.Renderer = &echo.TemplateRenderer{ +// Template: template.Must(template.ParseGlob("templates/*.html")), +// } +// +// e.Renderer = &echo.TemplateRenderer{ +// Template: template.Must(template.New("hello").Parse("Hello, {{.}}!")), +// } +type TemplateRenderer struct { + Template interface { + ExecuteTemplate(wr io.Writer, name string, data any) error + } +} + +// Render renders the template with given data. +func (t *TemplateRenderer) Render(w io.Writer, name string, data interface{}, c Context) error { + return t.Template.ExecuteTemplate(w, name, data) +} diff --git a/vendor/github.com/labstack/echo/v4/response.go b/vendor/github.com/labstack/echo/v4/response.go index a795ce36..0f174536 100644 --- a/vendor/github.com/labstack/echo/v4/response.go +++ b/vendor/github.com/labstack/echo/v4/response.go @@ -14,10 +14,10 @@ import ( // by an HTTP handler to construct an HTTP response. // See: https://golang.org/pkg/net/http/#ResponseWriter type Response struct { + Writer http.ResponseWriter echo *Echo beforeFuncs []func() afterFuncs []func() - Writer http.ResponseWriter Status int Size int64 Committed bool @@ -86,7 +86,7 @@ func (r *Response) Write(b []byte) (n int, err error) { // buffered data to the client. // See [http.Flusher](https://golang.org/pkg/net/http/#Flusher) func (r *Response) Flush() { - err := responseControllerFlush(r.Writer) + err := http.NewResponseController(r.Writer).Flush() if err != nil && errors.Is(err, http.ErrNotSupported) { panic(errors.New("response writer flushing is not supported")) } @@ -96,7 +96,7 @@ func (r *Response) Flush() { // take over the connection. // See [http.Hijacker](https://golang.org/pkg/net/http/#Hijacker) func (r *Response) Hijack() (net.Conn, *bufio.ReadWriter, error) { - return responseControllerHijack(r.Writer) + return http.NewResponseController(r.Writer).Hijack() } // Unwrap returns the original http.ResponseWriter. diff --git a/vendor/github.com/labstack/echo/v4/responsecontroller_1.19.go b/vendor/github.com/labstack/echo/v4/responsecontroller_1.19.go deleted file mode 100644 index 782dab3a..00000000 --- a/vendor/github.com/labstack/echo/v4/responsecontroller_1.19.go +++ /dev/null @@ -1,44 +0,0 @@ -// SPDX-License-Identifier: MIT -// SPDX-FileCopyrightText: © 2015 LabStack LLC and Echo contributors - -//go:build !go1.20 - -package echo - -import ( - "bufio" - "fmt" - "net" - "net/http" -) - -// TODO: remove when Go 1.23 is released and we do not support 1.19 anymore -func responseControllerFlush(rw http.ResponseWriter) error { - for { - switch t := rw.(type) { - case interface{ FlushError() error }: - return t.FlushError() - case http.Flusher: - t.Flush() - return nil - case interface{ Unwrap() http.ResponseWriter }: - rw = t.Unwrap() - default: - return fmt.Errorf("%w", http.ErrNotSupported) - } - } -} - -// TODO: remove when Go 1.23 is released and we do not support 1.19 anymore -func responseControllerHijack(rw http.ResponseWriter) (net.Conn, *bufio.ReadWriter, error) { - for { - switch t := rw.(type) { - case http.Hijacker: - return t.Hijack() - case interface{ Unwrap() http.ResponseWriter }: - rw = t.Unwrap() - default: - return nil, nil, fmt.Errorf("%w", http.ErrNotSupported) - } - } -} diff --git a/vendor/github.com/labstack/echo/v4/responsecontroller_1.20.go b/vendor/github.com/labstack/echo/v4/responsecontroller_1.20.go deleted file mode 100644 index 6d77c07f..00000000 --- a/vendor/github.com/labstack/echo/v4/responsecontroller_1.20.go +++ /dev/null @@ -1,20 +0,0 @@ -// SPDX-License-Identifier: MIT -// SPDX-FileCopyrightText: © 2015 LabStack LLC and Echo contributors - -//go:build go1.20 - -package echo - -import ( - "bufio" - "net" - "net/http" -) - -func responseControllerFlush(rw http.ResponseWriter) error { - return http.NewResponseController(rw).Flush() -} - -func responseControllerHijack(rw http.ResponseWriter) (net.Conn, *bufio.ReadWriter, error) { - return http.NewResponseController(rw).Hijack() -} diff --git a/vendor/github.com/labstack/echo/v4/router.go b/vendor/github.com/labstack/echo/v4/router.go index 03267315..49b56966 100644 --- a/vendor/github.com/labstack/echo/v4/router.go +++ b/vendor/github.com/labstack/echo/v4/router.go @@ -18,32 +18,31 @@ type Router struct { } type node struct { - kind kind - label byte - prefix string - parent *node - staticChildren children - originalPath string - methods *routeMethods - paramChild *node - anyChild *node - paramsCount int + methods *routeMethods + parent *node + paramChild *node + anyChild *node + // notFoundHandler is handler registered with RouteNotFound method and is executed for 404 cases + notFoundHandler *routeMethod + prefix string + originalPath string + staticChildren children + paramsCount int + label byte + kind kind // isLeaf indicates that node does not have child routes isLeaf bool // isHandler indicates that node has at least one handler registered to it isHandler bool - - // notFoundHandler is handler registered with RouteNotFound method and is executed for 404 cases - notFoundHandler *routeMethod } type kind uint8 type children []*node type routeMethod struct { + handler HandlerFunc ppath string pnames []string - handler HandlerFunc } type routeMethods struct { @@ -242,18 +241,18 @@ func (r *Router) insert(method, path string, h HandlerFunc) { if i == lcpIndex { // path node is last fragment of route path. ie. `/users/:id` - r.insertNode(method, path[:i], paramKind, routeMethod{ppath, pnames, h}) + r.insertNode(method, path[:i], paramKind, routeMethod{ppath: ppath, pnames: pnames, handler: h}) } else { r.insertNode(method, path[:i], paramKind, routeMethod{}) } } else if path[i] == '*' { r.insertNode(method, path[:i], staticKind, routeMethod{}) pnames = append(pnames, "*") - r.insertNode(method, path[:i+1], anyKind, routeMethod{ppath, pnames, h}) + r.insertNode(method, path[:i+1], anyKind, routeMethod{ppath: ppath, pnames: pnames, handler: h}) } } - r.insertNode(method, path, staticKind, routeMethod{ppath, pnames, h}) + r.insertNode(method, path, staticKind, routeMethod{ppath: ppath, pnames: pnames, handler: h}) } func (r *Router) insertNode(method, path string, t kind, rm routeMethod) { diff --git a/vendor/github.com/lithammer/shortuuid/v4/README.md b/vendor/github.com/lithammer/shortuuid/v4/README.md index c13f947a..581e8bd5 100644 --- a/vendor/github.com/lithammer/shortuuid/v4/README.md +++ b/vendor/github.com/lithammer/shortuuid/v4/README.md @@ -1,11 +1,11 @@ # shortuuid [![Build Status](https://github.com/lithammer/shortuuid/workflows/CI/badge.svg)](https://github.com/lithammer/shortuuid/actions) -[![Godoc](https://img.shields.io/badge/godoc-reference-blue.svg?style=flat)](https://godoc.org/github.com/lithammer/shortuuid) +[![Godoc](https://img.shields.io/badge/godoc-reference-blue.svg?style=flat)](https://pkg.go.dev/github.com/lithammer/shortuuid/v4) A Go library that generates concise, unambiguous, URL-safe UUIDs. Based on and compatible with the Python library -[`shortuuid`](https://github.com/stochastic-technologies/shortuuid). +[`shortuuid`](https://github.com/skorokithakis/shortuuid). Often, one needs to use non-sequential IDs in places where users will see them, but the IDs must be as concise and easy to use as possible. shortuuid solves @@ -26,7 +26,8 @@ import ( ) func main() { - u := shortuuid.New() // KwSysDpxcBU9FNhGkn2dCf + u := shortuuid.New() + fmt.Println(u) // KwSysDpxcBU9FNhGkn2dCf } ``` @@ -37,8 +38,9 @@ instead of `New()`. shortuuid.NewWithNamespace("http://example.com") ``` -It's possible to use a custom alphabet as well, though it has to be 57 -characters long. +It's possible to use a custom alphabet as well (at least 2 +characters long). +It will automatically sort and remove duplicates from your alphabet to ensure consistency ```go alphabet := "23456789ABCDEFGHJKLMNPQRSTUVWXYZabcdefghijkmnopqrstuvwxy=" diff --git a/vendor/github.com/lithammer/shortuuid/v4/alphabet.go b/vendor/github.com/lithammer/shortuuid/v4/alphabet.go index 1e5356d2..4ee3ef4c 100644 --- a/vendor/github.com/lithammer/shortuuid/v4/alphabet.go +++ b/vendor/github.com/lithammer/shortuuid/v4/alphabet.go @@ -2,33 +2,44 @@ package shortuuid import ( "fmt" - "sort" - "strings" + "math" + "slices" ) // DefaultAlphabet is the default alphabet used. -const DefaultAlphabet = "23456789ABCDEFGHJKLMNPQRSTUVWXYZabcdefghijkmnopqrstuvwxyz" +const ( + DefaultAlphabet = "23456789ABCDEFGHJKLMNPQRSTUVWXYZabcdefghijkmnopqrstuvwxyz" + rune1Max = 1<<7 - 1 +) type alphabet struct { - chars [57]rune - len int64 + chars []rune + len int64 + encLen int64 + singleBytes bool } -// Remove duplicates and sort it to ensure reproducability. +// Remove duplicates and sort it to ensure reproducibility. func newAlphabet(s string) alphabet { - abc := dedupe(strings.Split(s, "")) + abc := []rune(s) + slices.Sort(abc) + abc = slices.Compact(abc) - if len(abc) != 57 { - panic("encoding alphabet is not 57-bytes long") + if len(abc) < 2 { + panic("encoding alphabet must be at least two characters") } - sort.Strings(abc) a := alphabet{ - len: int64(len(abc)), + chars: abc, + len: int64(len(abc)), + encLen: int64(math.Ceil(128 / math.Log2(float64(len(abc))))), + singleBytes: true, } - - for i, char := range strings.Join(abc, "") { - a.chars[i] = char + for _, c := range a.chars { + if c > rune1Max { + a.singleBytes = false + break + } } return a @@ -41,25 +52,17 @@ func (a *alphabet) Length() int64 { // Index returns the index of the first instance of t in the alphabet, or an // error if t is not present. func (a *alphabet) Index(t rune) (int64, error) { - for i, char := range a.chars { - if char == t { - return int64(i), nil + i, j := 0, int(a.len) + for i < j { + h := int(uint(i+j) >> 1) + if a.chars[h] < t { + i = h + 1 + } else { + j = h } } - return 0, fmt.Errorf("element '%v' is not part of the alphabet", t) -} - -// dudupe removes duplicate characters from s. -func dedupe(s []string) []string { - var out []string - m := make(map[string]bool) - - for _, char := range s { - if _, ok := m[char]; !ok { - m[char] = true - out = append(out, char) - } + if i >= int(a.len) || a.chars[i] != t { + return 0, fmt.Errorf("element '%v' is not part of the alphabet", t) } - - return out + return int64(i), nil } diff --git a/vendor/github.com/lithammer/shortuuid/v4/base57.go b/vendor/github.com/lithammer/shortuuid/v4/base57.go deleted file mode 100644 index 24996006..00000000 --- a/vendor/github.com/lithammer/shortuuid/v4/base57.go +++ /dev/null @@ -1,91 +0,0 @@ -package shortuuid - -import ( - "fmt" - "math" - "math/big" - "strings" - - "github.com/google/uuid" -) - -type base57 struct { - // alphabet is the character set to construct the UUID from. - alphabet alphabet -} - -// Encode encodes uuid.UUID into a string using the most significant bits (MSB) -// first according to the alphabet. -func (b base57) Encode(u uuid.UUID) string { - var num big.Int - num.SetString(strings.Replace(u.String(), "-", "", 4), 16) - - // Calculate encoded length. - length := math.Ceil(math.Log(math.Pow(2, 128)) / math.Log(float64(b.alphabet.Length()))) - - return b.numToString(&num, int(length)) -} - -// Decode decodes a string according to the alphabet into a uuid.UUID. If s is -// too short, its most significant bits (MSB) will be padded with 0 (zero). -func (b base57) Decode(u string) (uuid.UUID, error) { - str, err := b.stringToNum(u) - if err != nil { - return uuid.Nil, err - } - return uuid.Parse(str) -} - -// numToString converts a number a string using the given alphabet. -func (b *base57) numToString(number *big.Int, padToLen int) string { - var ( - out []rune - digit *big.Int - ) - - alphaLen := big.NewInt(b.alphabet.Length()) - - zero := new(big.Int) - for number.Cmp(zero) > 0 { - number, digit = new(big.Int).DivMod(number, alphaLen, new(big.Int)) - out = append(out, b.alphabet.chars[digit.Int64()]) - } - - if padToLen > 0 { - remainder := math.Max(float64(padToLen-len(out)), 0) - out = append(out, []rune(strings.Repeat(string(b.alphabet.chars[0]), int(remainder)))...) - } - - reverse(out) - - return string(out) -} - -// stringToNum converts a string a number using the given alphabet. -func (b *base57) stringToNum(s string) (string, error) { - n := big.NewInt(0) - - for _, char := range s { - n.Mul(n, big.NewInt(b.alphabet.Length())) - - index, err := b.alphabet.Index(char) - if err != nil { - return "", err - } - - n.Add(n, big.NewInt(index)) - } - - if n.BitLen() > 128 { - return "", fmt.Errorf("number is out of range (need a 128-bit value)") - } - - return fmt.Sprintf("%032x", n), nil -} - -// reverse reverses a inline. -func reverse(a []rune) { - for i, j := 0, len(a)-1; i < j; i, j = i+1, j-1 { - a[i], a[j] = a[j], a[i] - } -} diff --git a/vendor/github.com/lithammer/shortuuid/v4/encoder.go b/vendor/github.com/lithammer/shortuuid/v4/encoder.go new file mode 100644 index 00000000..6990c294 --- /dev/null +++ b/vendor/github.com/lithammer/shortuuid/v4/encoder.go @@ -0,0 +1,158 @@ +package shortuuid + +import ( + "encoding/binary" + "fmt" + "github.com/google/uuid" + "math" + "math/bits" + "strings" +) + +type encoder struct { + // alphabet is the character set to construct the UUID from. + alphabet alphabet +} + +const ( + defaultBase = 57 + defaultEncLen = 22 + defaultNDigits = 10 + defaultDivisor = 362033331456891249 // 57^10 +) + +func maxPow(b uint64) (d uint64, n int) { + d, n = b, 1 + for m := math.MaxUint64 / b; d <= m; { + d *= b + n++ + } + return +} + +// Encode encodes uuid.UUID into a string using the most significant bits (MSB) +// first according to the alphabet. +func (e encoder) Encode(u uuid.UUID) string { + if e.alphabet.singleBytes { + return e.encodeSingleBytes(u) + } + return e.encode(u) +} + +func (e encoder) encodeSingleBytes(u uuid.UUID) string { + num := uint128{ + binary.BigEndian.Uint64(u[8:]), + binary.BigEndian.Uint64(u[:8]), + } + var r uint64 + var i int + var buf []byte + if e.alphabet.len == defaultBase { // compiler optimizations using constants for default base + buf = make([]byte, defaultEncLen) + for i = defaultEncLen - 1; num.Hi > 0 || num.Lo > 0; { + num, r = num.quoRem64(defaultDivisor) + for j := 0; j < defaultNDigits && i >= 0; j++ { + buf[i] = byte(e.alphabet.chars[r%defaultBase]) + r /= defaultBase + i-- + } + } + } else { + buf = make([]byte, e.alphabet.encLen) + l := uint64(e.alphabet.len) + d, n := maxPow(l) + for i = int(e.alphabet.encLen - 1); num.Hi > 0 || num.Lo > 0; { + num, r = num.quoRem64(d) + for j := 0; j < n && i >= 0; j++ { + buf[i] = byte(e.alphabet.chars[r%l]) + r /= l + i-- + } + } + } + for ; i >= 0; i-- { + buf[i] = byte(e.alphabet.chars[0]) + } + return string(buf[:]) +} + +func (e encoder) encode(u uuid.UUID) string { + num := uint128{ + binary.BigEndian.Uint64(u[8:]), + binary.BigEndian.Uint64(u[:8]), + } + var r uint64 + var outIndexes []uint64 + if e.alphabet.len == defaultBase { // compiler optimizations using constants for default base + outIndexes = make([]uint64, defaultEncLen) // avoids escaping to heap for base57 when used with constant + for i := defaultEncLen - 1; num.Hi > 0 || num.Lo > 0; { + num, r = num.quoRem64(defaultDivisor) + for j := 0; j < defaultNDigits && i >= 0; j++ { + outIndexes[i] = r % defaultBase + r /= defaultBase + i-- + } + } + } else { + outIndexes = make([]uint64, e.alphabet.encLen) + l := uint64(e.alphabet.len) + d, n := maxPow(l) + for i := int(e.alphabet.encLen - 1); num.Hi > 0 || num.Lo > 0; { + num, r = num.quoRem64(d) + for j := 0; j < n && i >= 0; j++ { + outIndexes[i] = r % l + r /= l + i-- + } + } + } + + var sb strings.Builder + sb.Grow(int(e.alphabet.encLen)) + for i := 0; i < int(e.alphabet.encLen); i++ { + sb.WriteRune(e.alphabet.chars[outIndexes[i]]) + } + return sb.String() +} + +// Decode decodes a string according to the alphabet into a uuid.UUID. If s is +// too short, its most significant bits (MSB) will be padded with 0 (zero). +func (e encoder) Decode(s string) (u uuid.UUID, err error) { + var n uint128 + var index int64 + + for _, char := range s { + index, err = e.alphabet.Index(char) + if err != nil { + return + } + n, err = n.mulAdd64(uint64(e.alphabet.len), uint64(index)) + if err != nil { + return + } + } + binary.BigEndian.PutUint64(u[:8], n.Hi) + binary.BigEndian.PutUint64(u[8:], n.Lo) + return +} + +type uint128 struct { + Lo, Hi uint64 +} + +func (u uint128) quoRem64(v uint64) (q uint128, r uint64) { + q.Hi, r = bits.Div64(0, u.Hi, v) + q.Lo, r = bits.Div64(r, u.Lo, v) + return +} + +func (u uint128) mulAdd64(m uint64, a uint64) (uint128, error) { + hi, lo := bits.Mul64(u.Lo, m) + p0, p1 := bits.Mul64(u.Hi, m) + lo, c0 := bits.Add64(lo, a, 0) + hi, c1 := bits.Add64(hi, p1, c0) + if p0 != 0 || c1 != 0 { + return uint128{}, fmt.Errorf("number is out of range (need a 128-bit value)") + } + return uint128{lo, hi}, nil +} diff --git a/vendor/github.com/lithammer/shortuuid/v4/shortuuid.go b/vendor/github.com/lithammer/shortuuid/v4/shortuuid.go index 7ae1ef5f..0c51b9a2 100644 --- a/vendor/github.com/lithammer/shortuuid/v4/shortuuid.go +++ b/vendor/github.com/lithammer/shortuuid/v4/shortuuid.go @@ -8,7 +8,7 @@ import ( // DefaultEncoder is the default encoder uses when generating new UUIDs, and is // based on Base57. -var DefaultEncoder = &base57{newAlphabet(DefaultAlphabet)} +var DefaultEncoder = &encoder{newAlphabet(DefaultAlphabet)} // Encoder is an interface for encoding/decoding UUIDs to strings. type Encoder interface { @@ -33,9 +33,9 @@ func NewWithNamespace(name string) string { switch { case name == "": u = uuid.New() - case strings.HasPrefix(strings.ToLower(name), "http://"): + case hasPrefixCaseInsensitive(name, "https://"): u = uuid.NewSHA1(uuid.NameSpaceURL, []byte(name)) - case strings.HasPrefix(strings.ToLower(name), "https://"): + case hasPrefixCaseInsensitive(name, "http://"): u = uuid.NewSHA1(uuid.NameSpaceURL, []byte(name)) default: u = uuid.NewSHA1(uuid.NameSpaceDNS, []byte(name)) @@ -47,6 +47,10 @@ func NewWithNamespace(name string) string { // NewWithAlphabet returns a new UUIDv4, encoded with base57 using the // alternative alphabet abc. func NewWithAlphabet(abc string) string { - enc := base57{newAlphabet(abc)} + enc := encoder{newAlphabet(abc)} return enc.Encode(uuid.New()) } + +func hasPrefixCaseInsensitive(s, prefix string) bool { + return len(s) >= len(prefix) && strings.EqualFold(s[:len(prefix)], prefix) +} diff --git a/vendor/github.com/mailru/easyjson/jlexer/bytestostr.go b/vendor/github.com/mailru/easyjson/jlexer/bytestostr.go index ff7b27c5..e68108f8 100644 --- a/vendor/github.com/mailru/easyjson/jlexer/bytestostr.go +++ b/vendor/github.com/mailru/easyjson/jlexer/bytestostr.go @@ -8,7 +8,6 @@ package jlexer import ( - "reflect" "unsafe" ) @@ -18,7 +17,5 @@ import ( // chunk may be either blocked from being freed by GC because of a single string or the buffer.Data // may be garbage-collected even when the string exists. func bytesToStr(data []byte) string { - h := (*reflect.SliceHeader)(unsafe.Pointer(&data)) - shdr := reflect.StringHeader{Data: h.Data, Len: h.Len} - return *(*string)(unsafe.Pointer(&shdr)) + return *(*string)(unsafe.Pointer(&data)) } diff --git a/vendor/github.com/mailru/easyjson/jlexer/lexer.go b/vendor/github.com/mailru/easyjson/jlexer/lexer.go index b5f5e261..a27705b1 100644 --- a/vendor/github.com/mailru/easyjson/jlexer/lexer.go +++ b/vendor/github.com/mailru/easyjson/jlexer/lexer.go @@ -19,21 +19,21 @@ import ( "github.com/josharian/intern" ) -// tokenKind determines type of a token. -type tokenKind byte +// TokenKind determines type of a token. +type TokenKind byte const ( - tokenUndef tokenKind = iota // No token. - tokenDelim // Delimiter: one of '{', '}', '[' or ']'. - tokenString // A string literal, e.g. "abc\u1234" - tokenNumber // Number literal, e.g. 1.5e5 - tokenBool // Boolean literal: true or false. - tokenNull // null keyword. + TokenUndef TokenKind = iota // No token. + TokenDelim // Delimiter: one of '{', '}', '[' or ']'. + TokenString // A string literal, e.g. "abc\u1234" + TokenNumber // Number literal, e.g. 1.5e5 + TokenBool // Boolean literal: true or false. + TokenNull // null keyword. ) // token describes a single token: type, position in the input and value. type token struct { - kind tokenKind // Type of a token. + kind TokenKind // Type of a token. boolValue bool // Value if a boolean literal token. byteValueCloned bool // true if byteValue was allocated and does not refer to original json body @@ -47,7 +47,7 @@ type Lexer struct { start int // Start of the current token. pos int // Current unscanned position in the input stream. - token token // Last scanned token, if token.kind != tokenUndef. + token token // Last scanned token, if token.kind != TokenUndef. firstElement bool // Whether current element is the first in array or an object. wantSep byte // A comma or a colon character, which need to occur before a token. @@ -59,7 +59,7 @@ type Lexer struct { // FetchToken scans the input for the next token. func (r *Lexer) FetchToken() { - r.token.kind = tokenUndef + r.token.kind = TokenUndef r.start = r.pos // Check if r.Data has r.pos element @@ -90,7 +90,7 @@ func (r *Lexer) FetchToken() { r.errSyntax() } - r.token.kind = tokenString + r.token.kind = TokenString r.fetchString() return @@ -99,7 +99,7 @@ func (r *Lexer) FetchToken() { r.errSyntax() } r.firstElement = true - r.token.kind = tokenDelim + r.token.kind = TokenDelim r.token.delimValue = r.Data[r.pos] r.pos++ return @@ -109,7 +109,7 @@ func (r *Lexer) FetchToken() { r.errSyntax() } r.wantSep = 0 - r.token.kind = tokenDelim + r.token.kind = TokenDelim r.token.delimValue = r.Data[r.pos] r.pos++ return @@ -118,7 +118,7 @@ func (r *Lexer) FetchToken() { if r.wantSep != 0 { r.errSyntax() } - r.token.kind = tokenNumber + r.token.kind = TokenNumber r.fetchNumber() return @@ -127,7 +127,7 @@ func (r *Lexer) FetchToken() { r.errSyntax() } - r.token.kind = tokenNull + r.token.kind = TokenNull r.fetchNull() return @@ -136,7 +136,7 @@ func (r *Lexer) FetchToken() { r.errSyntax() } - r.token.kind = tokenBool + r.token.kind = TokenBool r.token.boolValue = true r.fetchTrue() return @@ -146,7 +146,7 @@ func (r *Lexer) FetchToken() { r.errSyntax() } - r.token.kind = tokenBool + r.token.kind = TokenBool r.token.boolValue = false r.fetchFalse() return @@ -391,7 +391,7 @@ func (r *Lexer) fetchString() { // scanToken scans the next token if no token is currently available in the lexer. func (r *Lexer) scanToken() { - if r.token.kind != tokenUndef || r.fatalError != nil { + if r.token.kind != TokenUndef || r.fatalError != nil { return } @@ -400,7 +400,7 @@ func (r *Lexer) scanToken() { // consume resets the current token to allow scanning the next one. func (r *Lexer) consume() { - r.token.kind = tokenUndef + r.token.kind = TokenUndef r.token.byteValueCloned = false r.token.delimValue = 0 } @@ -443,10 +443,10 @@ func (r *Lexer) errInvalidToken(expected string) { switch expected { case "[": r.token.delimValue = ']' - r.token.kind = tokenDelim + r.token.kind = TokenDelim case "{": r.token.delimValue = '}' - r.token.kind = tokenDelim + r.token.kind = TokenDelim } r.addNonfatalError(&LexerError{ Reason: fmt.Sprintf("expected %s", expected), @@ -475,7 +475,7 @@ func (r *Lexer) GetPos() int { // Delim consumes a token and verifies that it is the given delimiter. func (r *Lexer) Delim(c byte) { - if r.token.kind == tokenUndef && r.Ok() { + if r.token.kind == TokenUndef && r.Ok() { r.FetchToken() } @@ -489,7 +489,7 @@ func (r *Lexer) Delim(c byte) { // IsDelim returns true if there was no scanning error and next token is the given delimiter. func (r *Lexer) IsDelim(c byte) bool { - if r.token.kind == tokenUndef && r.Ok() { + if r.token.kind == TokenUndef && r.Ok() { r.FetchToken() } return !r.Ok() || r.token.delimValue == c @@ -497,10 +497,10 @@ func (r *Lexer) IsDelim(c byte) bool { // Null verifies that the next token is null and consumes it. func (r *Lexer) Null() { - if r.token.kind == tokenUndef && r.Ok() { + if r.token.kind == TokenUndef && r.Ok() { r.FetchToken() } - if !r.Ok() || r.token.kind != tokenNull { + if !r.Ok() || r.token.kind != TokenNull { r.errInvalidToken("null") } r.consume() @@ -508,15 +508,15 @@ func (r *Lexer) Null() { // IsNull returns true if the next token is a null keyword. func (r *Lexer) IsNull() bool { - if r.token.kind == tokenUndef && r.Ok() { + if r.token.kind == TokenUndef && r.Ok() { r.FetchToken() } - return r.Ok() && r.token.kind == tokenNull + return r.Ok() && r.token.kind == TokenNull } // Skip skips a single token. func (r *Lexer) Skip() { - if r.token.kind == tokenUndef && r.Ok() { + if r.token.kind == TokenUndef && r.Ok() { r.FetchToken() } r.consume() @@ -621,10 +621,10 @@ func (r *Lexer) Consumed() { } func (r *Lexer) unsafeString(skipUnescape bool) (string, []byte) { - if r.token.kind == tokenUndef && r.Ok() { + if r.token.kind == TokenUndef && r.Ok() { r.FetchToken() } - if !r.Ok() || r.token.kind != tokenString { + if !r.Ok() || r.token.kind != TokenString { r.errInvalidToken("string") return "", nil } @@ -664,10 +664,10 @@ func (r *Lexer) UnsafeFieldName(skipUnescape bool) string { // String reads a string literal. func (r *Lexer) String() string { - if r.token.kind == tokenUndef && r.Ok() { + if r.token.kind == TokenUndef && r.Ok() { r.FetchToken() } - if !r.Ok() || r.token.kind != tokenString { + if !r.Ok() || r.token.kind != TokenString { r.errInvalidToken("string") return "" } @@ -687,10 +687,10 @@ func (r *Lexer) String() string { // StringIntern reads a string literal, and performs string interning on it. func (r *Lexer) StringIntern() string { - if r.token.kind == tokenUndef && r.Ok() { + if r.token.kind == TokenUndef && r.Ok() { r.FetchToken() } - if !r.Ok() || r.token.kind != tokenString { + if !r.Ok() || r.token.kind != TokenString { r.errInvalidToken("string") return "" } @@ -705,10 +705,10 @@ func (r *Lexer) StringIntern() string { // Bytes reads a string literal and base64 decodes it into a byte slice. func (r *Lexer) Bytes() []byte { - if r.token.kind == tokenUndef && r.Ok() { + if r.token.kind == TokenUndef && r.Ok() { r.FetchToken() } - if !r.Ok() || r.token.kind != tokenString { + if !r.Ok() || r.token.kind != TokenString { r.errInvalidToken("string") return nil } @@ -731,10 +731,10 @@ func (r *Lexer) Bytes() []byte { // Bool reads a true or false boolean keyword. func (r *Lexer) Bool() bool { - if r.token.kind == tokenUndef && r.Ok() { + if r.token.kind == TokenUndef && r.Ok() { r.FetchToken() } - if !r.Ok() || r.token.kind != tokenBool { + if !r.Ok() || r.token.kind != TokenBool { r.errInvalidToken("bool") return false } @@ -744,10 +744,10 @@ func (r *Lexer) Bool() bool { } func (r *Lexer) number() string { - if r.token.kind == tokenUndef && r.Ok() { + if r.token.kind == TokenUndef && r.Ok() { r.FetchToken() } - if !r.Ok() || r.token.kind != tokenNumber { + if !r.Ok() || r.token.kind != TokenNumber { r.errInvalidToken("number") return "" } @@ -1151,7 +1151,7 @@ func (r *Lexer) GetNonFatalErrors() []*LexerError { // JsonNumber fetches and json.Number from 'encoding/json' package. // Both int, float or string, contains them are valid values func (r *Lexer) JsonNumber() json.Number { - if r.token.kind == tokenUndef && r.Ok() { + if r.token.kind == TokenUndef && r.Ok() { r.FetchToken() } if !r.Ok() { @@ -1160,11 +1160,11 @@ func (r *Lexer) JsonNumber() json.Number { } switch r.token.kind { - case tokenString: + case TokenString: return json.Number(r.String()) - case tokenNumber: + case TokenNumber: return json.Number(r.Raw()) - case tokenNull: + case TokenNull: r.Null() return json.Number("") default: @@ -1175,7 +1175,7 @@ func (r *Lexer) JsonNumber() json.Number { // Interface fetches an interface{} analogous to the 'encoding/json' package. func (r *Lexer) Interface() interface{} { - if r.token.kind == tokenUndef && r.Ok() { + if r.token.kind == TokenUndef && r.Ok() { r.FetchToken() } @@ -1183,13 +1183,13 @@ func (r *Lexer) Interface() interface{} { return nil } switch r.token.kind { - case tokenString: + case TokenString: return r.String() - case tokenNumber: + case TokenNumber: return r.Float64() - case tokenBool: + case TokenBool: return r.Bool() - case tokenNull: + case TokenNull: r.Null() return nil } @@ -1242,3 +1242,16 @@ func (r *Lexer) WantColon() { r.wantSep = ':' r.firstElement = false } + +// CurrentToken returns current token kind if there were no errors and TokenUndef otherwise +func (r *Lexer) CurrentToken() TokenKind { + if r.token.kind == TokenUndef && r.Ok() { + r.FetchToken() + } + + if !r.Ok() { + return TokenUndef + } + + return r.token.kind +} diff --git a/vendor/github.com/mailru/easyjson/jwriter/writer.go b/vendor/github.com/mailru/easyjson/jwriter/writer.go index 2c5b2010..34b0ade4 100644 --- a/vendor/github.com/mailru/easyjson/jwriter/writer.go +++ b/vendor/github.com/mailru/easyjson/jwriter/writer.go @@ -67,6 +67,18 @@ func (w *Writer) RawString(s string) { w.Buffer.AppendString(s) } +// RawBytesString appends string from bytes to the buffer. +func (w *Writer) RawBytesString(data []byte, err error) { + switch { + case w.Error != nil: + return + case err != nil: + w.Error = err + default: + w.String(string(data)) + } +} + // Raw appends raw binary data to the buffer or sets the error if it is given. Useful for // calling with results of MarshalJSON-like functions. func (w *Writer) Raw(data []byte, err error) { diff --git a/vendor/github.com/mattn/go-colorable/colorable_appengine.go b/vendor/github.com/mattn/go-colorable/colorable_appengine.go deleted file mode 100644 index 416d1bbb..00000000 --- a/vendor/github.com/mattn/go-colorable/colorable_appengine.go +++ /dev/null @@ -1,38 +0,0 @@ -//go:build appengine -// +build appengine - -package colorable - -import ( - "io" - "os" - - _ "github.com/mattn/go-isatty" -) - -// NewColorable returns new instance of Writer which handles escape sequence. -func NewColorable(file *os.File) io.Writer { - if file == nil { - panic("nil passed instead of *os.File to NewColorable()") - } - - return file -} - -// NewColorableStdout returns new instance of Writer which handles escape sequence for stdout. -func NewColorableStdout() io.Writer { - return os.Stdout -} - -// NewColorableStderr returns new instance of Writer which handles escape sequence for stderr. -func NewColorableStderr() io.Writer { - return os.Stderr -} - -// EnableColorsStdout enable colors if possible. -func EnableColorsStdout(enabled *bool) func() { - if enabled != nil { - *enabled = true - } - return func() {} -} diff --git a/vendor/github.com/mattn/go-colorable/colorable_others.go b/vendor/github.com/mattn/go-colorable/colorable_others.go index 766d9460..c1a78aa9 100644 --- a/vendor/github.com/mattn/go-colorable/colorable_others.go +++ b/vendor/github.com/mattn/go-colorable/colorable_others.go @@ -1,5 +1,5 @@ -//go:build !windows && !appengine -// +build !windows,!appengine +//go:build !windows || appengine +// +build !windows appengine package colorable diff --git a/vendor/github.com/mattn/go-colorable/colorable_windows.go b/vendor/github.com/mattn/go-colorable/colorable_windows.go index 1846ad5a..2df7b859 100644 --- a/vendor/github.com/mattn/go-colorable/colorable_windows.go +++ b/vendor/github.com/mattn/go-colorable/colorable_windows.go @@ -11,7 +11,7 @@ import ( "strconv" "strings" "sync" - "syscall" + syscall "golang.org/x/sys/windows" "unsafe" "github.com/mattn/go-isatty" @@ -73,7 +73,7 @@ type consoleCursorInfo struct { } var ( - kernel32 = syscall.NewLazyDLL("kernel32.dll") + kernel32 = syscall.NewLazySystemDLL("kernel32.dll") procGetConsoleScreenBufferInfo = kernel32.NewProc("GetConsoleScreenBufferInfo") procSetConsoleTextAttribute = kernel32.NewProc("SetConsoleTextAttribute") procSetConsoleCursorPosition = kernel32.NewProc("SetConsoleCursorPosition") @@ -87,8 +87,8 @@ var ( procCreateConsoleScreenBuffer = kernel32.NewProc("CreateConsoleScreenBuffer") ) -// Writer provides colorable Writer to the console -type Writer struct { +// writer provides colorable Writer to the console +type writer struct { out io.Writer handle syscall.Handle althandle syscall.Handle @@ -98,7 +98,7 @@ type Writer struct { mutex sync.Mutex } -// NewColorable returns new instance of Writer which handles escape sequence from File. +// NewColorable returns new instance of writer which handles escape sequence from File. func NewColorable(file *os.File) io.Writer { if file == nil { panic("nil passed instead of *os.File to NewColorable()") @@ -112,17 +112,17 @@ func NewColorable(file *os.File) io.Writer { var csbi consoleScreenBufferInfo handle := syscall.Handle(file.Fd()) procGetConsoleScreenBufferInfo.Call(uintptr(handle), uintptr(unsafe.Pointer(&csbi))) - return &Writer{out: file, handle: handle, oldattr: csbi.attributes, oldpos: coord{0, 0}} + return &writer{out: file, handle: handle, oldattr: csbi.attributes, oldpos: coord{0, 0}} } return file } -// NewColorableStdout returns new instance of Writer which handles escape sequence for stdout. +// NewColorableStdout returns new instance of writer which handles escape sequence for stdout. func NewColorableStdout() io.Writer { return NewColorable(os.Stdout) } -// NewColorableStderr returns new instance of Writer which handles escape sequence for stderr. +// NewColorableStderr returns new instance of writer which handles escape sequence for stderr. func NewColorableStderr() io.Writer { return NewColorable(os.Stderr) } @@ -434,7 +434,7 @@ func atoiWithDefault(s string, def int) (int, error) { } // Write writes data on console -func (w *Writer) Write(data []byte) (n int, err error) { +func (w *writer) Write(data []byte) (n int, err error) { w.mutex.Lock() defer w.mutex.Unlock() var csbi consoleScreenBufferInfo @@ -560,7 +560,7 @@ loop: } procSetConsoleCursorPosition.Call(uintptr(handle), *(*uintptr)(unsafe.Pointer(&csbi.cursorPosition))) case 'E': - n, err = strconv.Atoi(buf.String()) + n, err = atoiWithDefault(buf.String(), 1) if err != nil { continue } @@ -569,7 +569,7 @@ loop: csbi.cursorPosition.y += short(n) procSetConsoleCursorPosition.Call(uintptr(handle), *(*uintptr)(unsafe.Pointer(&csbi.cursorPosition))) case 'F': - n, err = strconv.Atoi(buf.String()) + n, err = atoiWithDefault(buf.String(), 1) if err != nil { continue } diff --git a/vendor/github.com/mholt/acmez/v2/.gitignore b/vendor/github.com/mholt/acmez/v3/.gitignore similarity index 100% rename from vendor/github.com/mholt/acmez/v2/.gitignore rename to vendor/github.com/mholt/acmez/v3/.gitignore diff --git a/vendor/github.com/mholt/acmez/v2/LICENSE b/vendor/github.com/mholt/acmez/v3/LICENSE similarity index 100% rename from vendor/github.com/mholt/acmez/v2/LICENSE rename to vendor/github.com/mholt/acmez/v3/LICENSE diff --git a/vendor/github.com/mholt/acmez/v2/README.md b/vendor/github.com/mholt/acmez/v3/README.md similarity index 93% rename from vendor/github.com/mholt/acmez/v2/README.md rename to vendor/github.com/mholt/acmez/v3/README.md index 38006c82..e5e062d4 100644 --- a/vendor/github.com/mholt/acmez/v2/README.md +++ b/vendor/github.com/mholt/acmez/v3/README.md @@ -1,7 +1,7 @@ acmez - ACME client library for Go ================================== -[![godoc](https://pkg.go.dev/badge/github.com/mholt/acmez/v2)](https://pkg.go.dev/github.com/mholt/acmez/v2) +[![godoc](https://pkg.go.dev/badge/github.com/mholt/acmez/v3)](https://pkg.go.dev/github.com/mholt/acmez/v3) ACMEz ("ack-measy" or "acme-zee", whichever you prefer) is a fully-compliant [RFC 8555](https://tools.ietf.org/html/rfc8555) (ACME) implementation in pure Go. It is lightweight, has an elegant Go API, and its retry logic is highly robust against external errors. ACMEz is suitable for large-scale enterprise deployments. It also supports common IETF-standardized ACME extensions. @@ -34,12 +34,13 @@ In other words, the `acmez` package is **porcelain** while the `acme` package is - [RFC 8737](https://www.rfc-editor.org/rfc/rfc8737.html) (tls-alpn-01 challenge) - [RFC 8823](https://www.rfc-editor.org/rfc/rfc8823.html) (email-reply-00 challenge; S/MIME) - ACME Renewal Information (ARI) support ([draft-ietf-acme-ari-03](https://datatracker.ietf.org/doc/draft-ietf-acme-ari/)) +- ACME profiles ([draft-aaron-acme-profiles](https://datatracker.ietf.org/doc/draft-aaron-acme-profiles/)) ## Install ``` -go get github.com/mholt/acmez/v2 +go get github.com/mholt/acmez/v3 ``` @@ -50,7 +51,7 @@ See the [`examples` folder](https://github.com/mholt/acmez/tree/master/examples) ## Challenge solvers -The `acmez` package is "bring-your-own-solver." It provides helper utilities for http-01, dns-01, and tls-alpn-01 challenges, but does not actually solve them for you. You must write or use an implementation of [`acmez.Solver`](https://pkg.go.dev/github.com/mholt/acmez/v2#Solver) in order to get certificates. How this is done depends on your environment/situation. +The `acmez` package is "bring-your-own-solver." It provides helper utilities for http-01, dns-01, and tls-alpn-01 challenges, but does not actually solve them for you. You must write or use an implementation of [`acmez.Solver`](https://pkg.go.dev/github.com/mholt/acmez/v3#Solver) in order to get certificates. How this is done depends on your environment/situation. However, you can find [a general-purpose dns-01 solver in CertMagic](https://pkg.go.dev/github.com/caddyserver/certmagic#DNS01Solver), which uses [libdns](https://github.com/libdns) packages to integrate with numerous DNS providers. You can use it like this: @@ -69,7 +70,7 @@ client := acmez.Client{ } ``` -If you're implementing a tls-alpn-01 solver, the `acmez` package can help. It has the constant [`ACMETLS1Protocol`](https://pkg.go.dev/github.com/mholt/acmez/v2#pkg-constants) which you can use to identify challenge handshakes by inspecting the ClientHello's ALPN extension. Simply complete the handshake using a certificate from the [`acmez.TLSALPN01ChallengeCert()`](https://pkg.go.dev/github.com/mholt/acmez/v2#TLSALPN01ChallengeCert) function to solve the challenge. +If you're implementing a tls-alpn-01 solver, the `acmez` package can help. It has the constant [`ACMETLS1Protocol`](https://pkg.go.dev/github.com/mholt/acmez/v3#pkg-constants) which you can use to identify challenge handshakes by inspecting the ClientHello's ALPN extension. Simply complete the handshake using a certificate from the [`acmez.TLSALPN01ChallengeCert()`](https://pkg.go.dev/github.com/mholt/acmez/v3#TLSALPN01ChallengeCert) function to solve the challenge. diff --git a/vendor/github.com/mholt/acmez/v2/THIRD-PARTY b/vendor/github.com/mholt/acmez/v3/THIRD-PARTY similarity index 100% rename from vendor/github.com/mholt/acmez/v2/THIRD-PARTY rename to vendor/github.com/mholt/acmez/v3/THIRD-PARTY diff --git a/vendor/github.com/mholt/acmez/v2/acme/account.go b/vendor/github.com/mholt/acmez/v3/acme/account.go similarity index 93% rename from vendor/github.com/mholt/acmez/v2/acme/account.go rename to vendor/github.com/mholt/acmez/v3/acme/account.go index b7a72e03..cdb31a74 100644 --- a/vendor/github.com/mholt/acmez/v2/acme/account.go +++ b/vendor/github.com/mholt/acmez/v3/acme/account.go @@ -64,7 +64,17 @@ type Account struct { // orders (required, string): A URL from which a list of orders // submitted by this account can be fetched via a POST-as-GET // request, as described in Section 7.1.2.1. - Orders string `json:"orders"` + // + // When empty, this field is omitted from JSON encodings since it + // is not in the subset of fields described by the spec for inclusion + // when creating an account (§7.3), but the spec also says in that + // same section: "The server MUST ignore any values provided in the + // "orders" fields in account objects sent by the client." Yet, we + // have reports of non-compliant ACME servers (see + // https://caddy.community/t/failing-to-register-an-acme-account/27220/5) + // so we tighten up our serialization a bit to omit empty Orders, + // even though the spec also says this field is "required". + Orders string `json:"orders,omitempty"` // In response to new-account, "the server returns this account // object in a 201 (Created) response, with the account URL diff --git a/vendor/github.com/mholt/acmez/v2/acme/ari.go b/vendor/github.com/mholt/acmez/v3/acme/ari.go similarity index 89% rename from vendor/github.com/mholt/acmez/v2/acme/ari.go rename to vendor/github.com/mholt/acmez/v3/acme/ari.go index 93401f37..ed48d4f0 100644 --- a/vendor/github.com/mholt/acmez/v2/acme/ari.go +++ b/vendor/github.com/mholt/acmez/v3/acme/ari.go @@ -20,11 +20,10 @@ import ( "encoding/asn1" "encoding/base64" "fmt" + "log/slog" "math/rand" "net/http" "time" - - "go.uber.org/zap" ) // ErrUnsupported is used to indicate lack of support by an ACME server. @@ -58,9 +57,9 @@ type RenewalInfo struct { // The following fields are not part of the RenewalInfo object in // the ARI spec, but are important for proper conformance to the - // spec, and are practically useful for implementators: + // spec, and are practically useful for implementers: - // "The unique identifer is constructed by concatenating the + // "The unique identifier is constructed by concatenating the // base64url-encoding Section 5 of [RFC4648] of the bytes of the // keyIdentifier field of certificate's Authority Key Identifier // (AKI) Section 4.2.1.1 of [RFC5280] extension, a literal period, @@ -131,7 +130,8 @@ func (c *Client) GetRenewalInfo(ctx context.Context, leafCert *x509.Certificate) } if c.Logger != nil { - c.Logger.Debug("getting renewal info", zap.Strings("names", leafCert.DNSNames)) + c.Logger.LogAttrs(ctx, slog.LevelDebug, "getting renewal info", + slog.Any("names", leafCert.DNSNames)) } certID, err := ARIUniqueIdentifier(leafCert) @@ -154,10 +154,10 @@ func (c *Client) GetRenewalInfo(ctx context.Context, leafCert *x509.Certificate) resp, err = c.httpReq(ctx, http.MethodGet, c.ariEndpoint(certID), nil, &ari) if err != nil { if c.Logger != nil { - c.Logger.Warn("error getting ARI response", - zap.Error(err), - zap.Int("attempt", i), - zap.Strings("names", leafCert.DNSNames)) + c.Logger.LogAttrs(ctx, slog.LevelWarn, "error getting ARI response", + slog.Any("error", err), + slog.Int("attempt", i), + slog.Any("names", leafCert.DNSNames)) } continue } @@ -173,10 +173,10 @@ func (c *Client) GetRenewalInfo(ctx context.Context, leafCert *x509.Certificate) ari.SuggestedWindow.Start.Equal(ari.SuggestedWindow.End) || (ari.SuggestedWindow.End.Unix()-ari.SuggestedWindow.Start.Unix()-1 <= 0) { if c.Logger != nil { - c.Logger.Debug("invalid ARI window", - zap.Time("start", ari.SuggestedWindow.Start), - zap.Time("end", ari.SuggestedWindow.End), - zap.Strings("names", leafCert.DNSNames)) + c.Logger.LogAttrs(ctx, slog.LevelDebug, "invalid ARI window", + slog.Time("start", ari.SuggestedWindow.Start), + slog.Time("end", ari.SuggestedWindow.End), + slog.Any("names", leafCert.DNSNames)) } continue } @@ -193,7 +193,8 @@ func (c *Client) GetRenewalInfo(ctx context.Context, leafCert *x509.Certificate) // interval that the ACME server recommends." draft-ietf-acme-ari-03 §4.2 raTime, err := retryAfterTime(resp) if err != nil && c.Logger != nil { - c.Logger.Error("invalid Retry-After value", zap.Error(err)) + c.Logger.LogAttrs(ctx, slog.LevelError, "invalid Retry-After value", + slog.Any("error", err)) } if !raTime.IsZero() { ari.RetryAfter = &raTime @@ -212,14 +213,13 @@ func (c *Client) GetRenewalInfo(ctx context.Context, leafCert *x509.Certificate) ari.SelectedTime = time.Unix(rand.Int63n(end-start)+start, 0).UTC() if c.Logger != nil { - c.Logger.Info("got renewal info", - zap.Strings("names", leafCert.DNSNames), - zap.Time("window_start", ari.SuggestedWindow.Start), - zap.Time("window_end", ari.SuggestedWindow.End), - zap.Time("selected_time", ari.SelectedTime), - zap.Timep("recheck_after", ari.RetryAfter), - zap.String("explanation_url", ari.ExplanationURL), - ) + c.Logger.LogAttrs(ctx, slog.LevelInfo, "got renewal info", + slog.Any("names", leafCert.DNSNames), + slog.Time("window_start", ari.SuggestedWindow.Start), + slog.Time("window_end", ari.SuggestedWindow.End), + slog.Time("selected_time", ari.SelectedTime), + slog.Time("recheck_after", *ari.RetryAfter), + slog.String("explanation_url", ari.ExplanationURL)) } return ari, nil diff --git a/vendor/github.com/mholt/acmez/v2/acme/authorization.go b/vendor/github.com/mholt/acmez/v3/acme/authorization.go similarity index 100% rename from vendor/github.com/mholt/acmez/v2/acme/authorization.go rename to vendor/github.com/mholt/acmez/v3/acme/authorization.go diff --git a/vendor/github.com/mholt/acmez/v2/acme/certificate.go b/vendor/github.com/mholt/acmez/v3/acme/certificate.go similarity index 98% rename from vendor/github.com/mholt/acmez/v2/acme/certificate.go rename to vendor/github.com/mholt/acmez/v3/acme/certificate.go index 97662c61..5fd4f80d 100644 --- a/vendor/github.com/mholt/acmez/v2/acme/certificate.go +++ b/vendor/github.com/mholt/acmez/v3/acme/certificate.go @@ -22,9 +22,8 @@ import ( "encoding/base64" "encoding/pem" "fmt" + "log/slog" "net/http" - - "go.uber.org/zap" ) // Certificate represents a certificate chain, which we usually refer @@ -121,7 +120,8 @@ func (c *Client) GetCertificateChain(ctx context.Context, account Account, certU } ari, err := c.GetRenewalInfo(ctx, leafCert) if err != nil && c.Logger != nil { - c.Logger.Error("failed getting renewal information", zap.Error(err)) + c.Logger.LogAttrs(ctx, slog.LevelError, "failed getting renewal information", + slog.Any("error", err)) } certChain.RenewalInfo = &ari } diff --git a/vendor/github.com/mholt/acmez/v2/acme/challenge.go b/vendor/github.com/mholt/acmez/v3/acme/challenge.go similarity index 100% rename from vendor/github.com/mholt/acmez/v2/acme/challenge.go rename to vendor/github.com/mholt/acmez/v3/acme/challenge.go diff --git a/vendor/github.com/mholt/acmez/v2/acme/client.go b/vendor/github.com/mholt/acmez/v3/acme/client.go similarity index 94% rename from vendor/github.com/mholt/acmez/v2/acme/client.go rename to vendor/github.com/mholt/acmez/v3/acme/client.go index e5b1fbd2..cc92e976 100644 --- a/vendor/github.com/mholt/acmez/v2/acme/client.go +++ b/vendor/github.com/mholt/acmez/v3/acme/client.go @@ -29,11 +29,10 @@ package acme import ( "context" "fmt" + "log/slog" "net/http" "sync" "time" - - "go.uber.org/zap" ) // Client facilitates ACME client operations as defined by the spec. @@ -64,14 +63,14 @@ type Client struct { UserAgent string // Delay between poll attempts. Only used if server - // does not supply a Retry-Afer header. Default: 250ms + // does not supply a Retry-After header. Default: 250ms PollInterval time.Duration // Maximum duration for polling. Default: 5m PollTimeout time.Duration // An optional logger. Default: no logs - Logger *zap.Logger + Logger *slog.Logger mu sync.Mutex // protects all unexported fields dir Directory @@ -189,6 +188,12 @@ type DirectoryMeta struct { Website string `json:"website,omitempty"` CAAIdentities []string `json:"caaIdentities,omitempty"` ExternalAccountRequired bool `json:"externalAccountRequired,omitempty"` + + // ACME profiles are an EXPERIMENTAL DRAFT feature and are subject to change. See: + // - https://letsencrypt.org/2025/01/09/acme-profiles/ + // - https://datatracker.ietf.org/doc/draft-aaron-acme-profiles/ + // The key is the profile name, and the value is a description. + Profiles map[string]string `json:"profiles,omitempty"` } // stack is a simple thread-safe stack. diff --git a/vendor/github.com/mholt/acmez/v2/acme/http.go b/vendor/github.com/mholt/acmez/v3/acme/http.go similarity index 96% rename from vendor/github.com/mholt/acmez/v2/acme/http.go rename to vendor/github.com/mholt/acmez/v3/acme/http.go index 3d121753..a994fcbf 100644 --- a/vendor/github.com/mholt/acmez/v2/acme/http.go +++ b/vendor/github.com/mholt/acmez/v3/acme/http.go @@ -22,6 +22,7 @@ import ( "errors" "fmt" "io" + "log/slog" "net/http" "regexp" "runtime" @@ -29,8 +30,6 @@ import ( "strings" "sync" "time" - - "go.uber.org/zap" ) // httpPostJWS performs robust HTTP requests by JWS-encoding the JSON of input. @@ -96,9 +95,9 @@ func (c *Client) httpPostJWS(ctx context.Context, privateKey crypto.Signer, if errors.As(err, &problem) { if problem.Type == ProblemTypeBadNonce { if c.Logger != nil { - c.Logger.Debug("server rejected our nonce; retrying", - zap.String("detail", problem.Detail), - zap.Error(err)) + c.Logger.LogAttrs(ctx, slog.LevelDebug, "server rejected our nonce; retrying", + slog.String("detail", problem.Detail), + slog.Any("error", err)) } continue } @@ -176,9 +175,9 @@ func (c *Client) httpReq(ctx context.Context, method, endpoint string, joseJSONP if err != nil { if retry { if c.Logger != nil { - c.Logger.Warn("HTTP request failed; retrying", - zap.String("url", req.URL.String()), - zap.Error(err)) + c.Logger.LogAttrs(ctx, slog.LevelWarn, "HTTP request failed; retrying", + slog.String("url", req.URL.String()), + slog.Any("error", err)) } continue } @@ -273,11 +272,11 @@ func (c *Client) doHTTPRequest(req *http.Request, buf *bytes.Buffer) (resp *http if c.Logger != nil { c.Logger.Debug("http request", - zap.String("method", req.Method), - zap.String("url", req.URL.String()), - zap.Reflect("headers", req.Header), - zap.Reflect("response_headers", resp.Header), - zap.Int("status_code", resp.StatusCode)) + slog.String("method", req.Method), + slog.String("url", req.URL.String()), + slog.Any("headers", req.Header), + slog.Any("response_headers", resp.Header), + slog.Int("status_code", resp.StatusCode)) } // "The server MUST include a Replay-Nonce header field diff --git a/vendor/github.com/mholt/acmez/v2/acme/jws.go b/vendor/github.com/mholt/acmez/v3/acme/jws.go similarity index 100% rename from vendor/github.com/mholt/acmez/v2/acme/jws.go rename to vendor/github.com/mholt/acmez/v3/acme/jws.go diff --git a/vendor/github.com/mholt/acmez/v2/acme/order.go b/vendor/github.com/mholt/acmez/v3/acme/order.go similarity index 90% rename from vendor/github.com/mholt/acmez/v2/acme/order.go rename to vendor/github.com/mholt/acmez/v3/acme/order.go index e51ee339..04620915 100644 --- a/vendor/github.com/mholt/acmez/v2/acme/order.go +++ b/vendor/github.com/mholt/acmez/v3/acme/order.go @@ -19,9 +19,8 @@ import ( "encoding/base64" "errors" "fmt" + "log/slog" "time" - - "go.uber.org/zap" ) // Order is an object that "represents a client's request for a certificate @@ -42,6 +41,13 @@ type Order struct { // or "valid" in the status field. Expires time.Time `json:"expires,omitempty"` + // profile (string, optional): A string uniquely identifying the profile + // which will be used to affect issuance of the certificate requested by + // this Order. + // + // EXPERIMENTAL: Draft ACME extension: draft-aaron-acme-profiles-00 + Profile string `json:"profile,omitempty"` + // identifiers (required, array of object): An array of identifier // objects that the order pertains to. Identifiers []Identifier `json:"identifiers"` @@ -127,9 +133,26 @@ func (c *Client) NewOrder(ctx context.Context, account Account, order Order) (Or return order, err } if c.Logger != nil { - c.Logger.Debug("creating order", - zap.String("account", account.Location), - zap.Strings("identifiers", order.identifierValues())) + c.Logger.LogAttrs(ctx, slog.LevelDebug, "creating order", + slog.String("account", account.Location), + slog.Any("identifiers", order.identifierValues())) + } + if order.Profile != "" { + // "The client MUST NOT request a profile name that is not advertised in the server's Directory metadata object." + // https://www.ietf.org/archive/id/draft-aaron-acme-profiles-00.html#section-4 + if c.dir.Meta == nil { + return order, fmt.Errorf("ACME server does not advertise support for profiles: %+v", c.dir.Meta) + } + var found bool + for profileName := range c.dir.Meta.Profiles { + if profileName == order.Profile { + found = true + break + } + } + if !found { + return order, fmt.Errorf("unknown profile name '%s'; supported profiles: %v", order.Profile, c.dir.Meta.Profiles) + } } resp, err := c.httpPostJWS(ctx, account.PrivateKey, account.Location, c.dir.NewOrder, order, &order) if err != nil { diff --git a/vendor/github.com/mholt/acmez/v2/acme/problem.go b/vendor/github.com/mholt/acmez/v3/acme/problem.go similarity index 85% rename from vendor/github.com/mholt/acmez/v2/acme/problem.go rename to vendor/github.com/mholt/acmez/v3/acme/problem.go index cca92890..94143048 100644 --- a/vendor/github.com/mholt/acmez/v2/acme/problem.go +++ b/vendor/github.com/mholt/acmez/v3/acme/problem.go @@ -16,8 +16,7 @@ package acme import ( "fmt" - - "go.uber.org/zap/zapcore" + "log/slog" ) // Problem carries the details of an error from HTTP APIs as @@ -92,15 +91,14 @@ func (p Problem) Error() string { return s } -// MarshalLogObject satisfies the zapcore.ObjectMarshaler interface. -// This allows problems to be serialized by the zap logger. -func (p Problem) MarshalLogObject(enc zapcore.ObjectEncoder) error { - enc.AddString("type", p.Type) - enc.AddString("title", p.Title) - enc.AddString("detail", p.Detail) - enc.AddString("instance", p.Instance) - enc.AddArray("subproblems", loggableSubproblems(p.Subproblems)) - return nil +func (p Problem) LogValue() slog.Value { + return slog.GroupValue( + slog.String("type", p.Type), + slog.String("title", p.Title), + slog.String("detail", p.Detail), + slog.String("instance", p.Instance), + slog.Any("subproblems", p.Subproblems), + ) } // Subproblem describes a more specific error in a problem according to @@ -115,24 +113,11 @@ type Subproblem struct { Identifier Identifier `json:"identifier,omitempty"` } -// MarshalLogObject satisfies the zapcore.ObjectMarshaler interface. -// This allows subproblems to be serialized by the zap logger. -func (sp Subproblem) MarshalLogObject(enc zapcore.ObjectEncoder) error { - enc.AddString("identifier_type", sp.Identifier.Type) - enc.AddString("identifier", sp.Identifier.Value) - enc.AddObject("subproblem", sp.Problem) - return nil -} - -type loggableSubproblems []Subproblem - -// MarshalLogArray satisfies the zapcore.ArrayMarshaler interface. -// This allows a list of subproblems to be serialized by the zap logger. -func (ls loggableSubproblems) MarshalLogArray(enc zapcore.ArrayEncoder) error { - for _, sp := range ls { - enc.AppendObject(sp) - } - return nil +func (sp Subproblem) LogValue() slog.Value { + return slog.GroupValue( + slog.String("identifier_type", sp.Identifier.Type), + slog.String("identifier", sp.Identifier.Value), + slog.Any("subproblem", sp.Problem)) } // Standard token values for the "type" field of problems, as defined diff --git a/vendor/github.com/mholt/acmez/v2/client.go b/vendor/github.com/mholt/acmez/v3/client.go similarity index 90% rename from vendor/github.com/mholt/acmez/v2/client.go rename to vendor/github.com/mholt/acmez/v3/client.go index 8a4a8178..1429fc82 100644 --- a/vendor/github.com/mholt/acmez/v2/client.go +++ b/vendor/github.com/mholt/acmez/v3/client.go @@ -36,13 +36,13 @@ import ( "crypto/x509" "errors" "fmt" + "log/slog" weakrand "math/rand" "sort" "sync" "time" - "github.com/mholt/acmez/v2/acme" - "go.uber.org/zap" + "github.com/mholt/acmez/v3/acme" ) // Client is a high-level API for ACME operations. It wraps @@ -93,7 +93,7 @@ func (c *Client) ObtainCertificate(ctx context.Context, params OrderParameters) } // create the ACME order - order := acme.Order{Identifiers: params.Identifiers} + order := acme.Order{Profile: params.Profile, Identifiers: params.Identifiers} if !params.NotBefore.IsZero() { order.NotBefore = ¶ms.NotBefore } @@ -147,13 +147,13 @@ func (c *Client) ObtainCertificate(ctx context.Context, params OrderParameters) if c.Logger != nil { l := c.Logger if haveAuthz { - l = l.With(zap.String("identifier", authz.IdentifierValue())) + l = l.With(slog.String("identifier", authz.IdentifierValue())) } l.Error("validating authorization", - zap.Object("problem", problem), - zap.String("order", order.Location), - zap.Int("attempt", attempt), - zap.Int("max_attempts", maxAttempts)) + slog.Any("problem", problem), + slog.String("order", order.Location), + slog.Int("attempt", attempt), + slog.Int("max_attempts", maxAttempts)) } errStr := "solving challenge" if haveAuthz { @@ -170,7 +170,7 @@ func (c *Client) ObtainCertificate(ctx context.Context, params OrderParameters) } if c.Logger != nil { - c.Logger.Info("validations succeeded; finalizing order", zap.String("order", order.Location)) + c.Logger.Info("validations succeeded; finalizing order", slog.String("order", order.Location)) } // get the CSR @@ -205,8 +205,8 @@ func (c *Client) ObtainCertificate(ctx context.Context, params OrderParameters) c.Logger.Info("no certificate chains offered by server") } else { c.Logger.Info("successfully downloaded available certificate chains", - zap.Int("count", len(certChains)), - zap.String("first_url", certChains[0].URL)) + slog.Int("count", len(certChains)), + slog.String("first_url", certChains[0].URL)) } } @@ -316,9 +316,9 @@ func (c *Client) solveChallenges(ctx context.Context, account acme.Account, orde if err := authz.currentSolver.CleanUp(ctx, authz.currentChallenge); err != nil { if c.Logger != nil { c.Logger.Error("cleaning up solver", - zap.String("identifier", authz.IdentifierValue()), - zap.String("challenge_type", authz.currentChallenge.Type), - zap.Error(err)) + slog.String("identifier", authz.IdentifierValue()), + slog.String("challenge_type", authz.currentChallenge.Type), + slog.Any("error", err)) } } } @@ -338,9 +338,9 @@ func (c *Client) solveChallenges(ctx context.Context, account acme.Account, orde if err != nil { if c.Logger != nil { c.Logger.Error("deactivating authorization", - zap.String("identifier", authz.IdentifierValue()), - zap.String("authz", authz.Location), - zap.Error(err)) + slog.String("identifier", authz.IdentifierValue()), + slog.String("authz", authz.Location), + slog.Any("error", err)) } } authz.Authorization = updatedAuthz @@ -388,9 +388,9 @@ func (c *Client) presentForNextChallenge(ctx context.Context, authz *authzState) if authz.Status != acme.StatusPending { if authz.Status == acme.StatusValid && c.Logger != nil { c.Logger.Info("authorization already valid", - zap.String("identifier", authz.IdentifierValue()), - zap.String("authz_url", authz.Location), - zap.Time("expires", authz.Expires)) + slog.String("identifier", authz.IdentifierValue()), + slog.String("authz_url", authz.Location), + slog.Time("expires", authz.Expires)) } return nil } @@ -402,9 +402,9 @@ func (c *Client) presentForNextChallenge(ctx context.Context, authz *authzState) if c.Logger != nil { c.Logger.Info("trying to solve challenge", - zap.String("identifier", authz.IdentifierValue()), - zap.String("challenge_type", authz.currentChallenge.Type), - zap.String("ca", c.Directory)) + slog.String("identifier", authz.IdentifierValue()), + slog.String("challenge_type", authz.currentChallenge.Type), + slog.String("ca", c.Directory)) } err = authz.currentSolver.Present(ctx, authz.currentChallenge) @@ -419,8 +419,8 @@ func (c *Client) initiateCurrentChallenge(ctx context.Context, authz *authzState if authz.Status != acme.StatusPending { if c.Logger != nil { c.Logger.Debug("skipping challenge initiation because authorization is not pending", - zap.String("identifier", authz.IdentifierValue()), - zap.String("authz_status", authz.Status)) + slog.String("identifier", authz.IdentifierValue()), + slog.String("authz_status", authz.Status)) } return nil } @@ -433,14 +433,14 @@ func (c *Client) initiateCurrentChallenge(ctx context.Context, authz *authzState if waiter, ok := authz.currentSolver.(Waiter); ok { if c.Logger != nil { c.Logger.Debug("waiting for solver before continuing", - zap.String("identifier", authz.IdentifierValue()), - zap.String("challenge_type", authz.currentChallenge.Type)) + slog.String("identifier", authz.IdentifierValue()), + slog.String("challenge_type", authz.currentChallenge.Type)) } err := waiter.Wait(ctx, authz.currentChallenge) if c.Logger != nil { c.Logger.Debug("done waiting for solver", - zap.String("identifier", authz.IdentifierValue()), - zap.String("challenge_type", authz.currentChallenge.Type)) + slog.String("identifier", authz.IdentifierValue()), + slog.String("challenge_type", authz.currentChallenge.Type)) } if err != nil { return fmt.Errorf("waiting for solver %T to be ready: %w", authz.currentSolver, err) @@ -452,14 +452,14 @@ func (c *Client) initiateCurrentChallenge(ctx context.Context, authz *authzState if payloader, ok := authz.currentSolver.(Payloader); ok { if c.Logger != nil { c.Logger.Debug("getting payload from solver before continuing", - zap.String("identifier", authz.IdentifierValue()), - zap.String("challenge_type", authz.currentChallenge.Type)) + slog.String("identifier", authz.IdentifierValue()), + slog.String("challenge_type", authz.currentChallenge.Type)) } p, err := payloader.Payload(ctx, authz.currentChallenge) if c.Logger != nil { c.Logger.Debug("done getting payload from solver", - zap.String("identifier", authz.IdentifierValue()), - zap.String("challenge_type", authz.currentChallenge.Type)) + slog.String("identifier", authz.IdentifierValue()), + slog.String("challenge_type", authz.currentChallenge.Type)) } if err != nil { return fmt.Errorf("getting payload from solver %T failed: %w", authz.currentSolver, err) @@ -476,8 +476,8 @@ func (c *Client) initiateCurrentChallenge(ctx context.Context, authz *authzState if c.Logger != nil { c.Logger.Debug("challenge accepted", - zap.String("identifier", authz.IdentifierValue()), - zap.String("challenge_type", authz.currentChallenge.Type)) + slog.String("identifier", authz.IdentifierValue()), + slog.String("challenge_type", authz.currentChallenge.Type)) } return nil @@ -503,7 +503,7 @@ func (c *Client) nextChallenge(authz *authzState) error { return nil } if c.Logger != nil { - c.Logger.Debug("no solver configured", zap.String("challenge_type", remainingChal.Type)) + c.Logger.Debug("no solver configured", slog.String("challenge_type", remainingChal.Type)) } break } @@ -542,9 +542,9 @@ func (c *Client) pollAuthorization(ctx context.Context, account acme.Account, au cleanupErr := authz.currentSolver.CleanUp(ctx, authz.currentChallenge) if cleanupErr != nil && c.Logger != nil { c.Logger.Error("cleaning up solver", - zap.String("identifier", authz.IdentifierValue()), - zap.String("challenge_type", authz.currentChallenge.Type), - zap.Error(cleanupErr)) + slog.String("identifier", authz.IdentifierValue()), + slog.String("challenge_type", authz.currentChallenge.Type), + slog.Any("error", cleanupErr)) } authz.currentSolver = nil // avoid cleaning it up again later } @@ -555,9 +555,9 @@ func (c *Client) pollAuthorization(ctx context.Context, account acme.Account, au if errors.As(err, &problem) { if c.Logger != nil { c.Logger.Error("challenge failed", - zap.String("identifier", authz.IdentifierValue()), - zap.String("challenge_type", authz.currentChallenge.Type), - zap.Object("problem", problem)) + slog.String("identifier", authz.IdentifierValue()), + slog.String("challenge_type", authz.currentChallenge.Type), + slog.Any("problem", problem)) } failedChallengeTypes.rememberFailedChallenge(authz) @@ -579,8 +579,8 @@ func (c *Client) pollAuthorization(ctx context.Context, account acme.Account, au if c.Logger != nil { c.Logger.Info("authorization finalized", - zap.String("identifier", authz.IdentifierValue()), - zap.String("authz_status", authz.Status)) + slog.String("identifier", authz.IdentifierValue()), + slog.String("authz_status", authz.Status)) } return nil diff --git a/vendor/github.com/mholt/acmez/v2/csr.go b/vendor/github.com/mholt/acmez/v3/csr.go similarity index 97% rename from vendor/github.com/mholt/acmez/v2/csr.go rename to vendor/github.com/mholt/acmez/v3/csr.go index fe545c53..f09dc76c 100644 --- a/vendor/github.com/mholt/acmez/v2/csr.go +++ b/vendor/github.com/mholt/acmez/v3/csr.go @@ -27,7 +27,7 @@ import ( "strings" "time" - "github.com/mholt/acmez/v2/acme" + "github.com/mholt/acmez/v3/acme" "golang.org/x/crypto/cryptobyte" cryptobyte_asn1 "golang.org/x/crypto/cryptobyte/asn1" "golang.org/x/net/idna" @@ -98,6 +98,13 @@ type OrderParameters struct { // "valid" status. Account acme.Account + // The name of the ACME profile to use for the order. + // The list of profiles offered by the ACME server is + // available at its directory endpoint. + // EXPERIMENTAL: Subject to change. + // (https://datatracker.ietf.org/doc/draft-aaron-acme-profiles/) + Profile string + // The list of identifiers for which to issue the certificate. // Identifiers may become Subject Alternate Names (SANs) in the // certificate. This slice must be consistent with the SANs diff --git a/vendor/github.com/mholt/acmez/v2/mailreply00.go b/vendor/github.com/mholt/acmez/v3/mailreply00.go similarity index 98% rename from vendor/github.com/mholt/acmez/v2/mailreply00.go rename to vendor/github.com/mholt/acmez/v3/mailreply00.go index 0fae0fd8..913fa079 100644 --- a/vendor/github.com/mholt/acmez/v2/mailreply00.go +++ b/vendor/github.com/mholt/acmez/v3/mailreply00.go @@ -18,7 +18,7 @@ import ( "fmt" "strings" - "github.com/mholt/acmez/v2/acme" + "github.com/mholt/acmez/v3/acme" ) // MailReplyChallengeResponse builds an email response body including headers to reply to the diff --git a/vendor/github.com/mholt/acmez/v2/solver.go b/vendor/github.com/mholt/acmez/v3/solver.go similarity index 99% rename from vendor/github.com/mholt/acmez/v2/solver.go rename to vendor/github.com/mholt/acmez/v3/solver.go index 90f82e0e..c85b61eb 100644 --- a/vendor/github.com/mholt/acmez/v2/solver.go +++ b/vendor/github.com/mholt/acmez/v3/solver.go @@ -17,7 +17,7 @@ package acmez import ( "context" - "github.com/mholt/acmez/v2/acme" + "github.com/mholt/acmez/v3/acme" ) // Solver is a type that can solve ACME challenges. All diff --git a/vendor/github.com/mholt/acmez/v2/tlsalpn01.go b/vendor/github.com/mholt/acmez/v3/tlsalpn01.go similarity index 98% rename from vendor/github.com/mholt/acmez/v2/tlsalpn01.go rename to vendor/github.com/mholt/acmez/v3/tlsalpn01.go index a228e54f..b762aa04 100644 --- a/vendor/github.com/mholt/acmez/v2/tlsalpn01.go +++ b/vendor/github.com/mholt/acmez/v3/tlsalpn01.go @@ -27,7 +27,7 @@ import ( "math/big" "time" - "github.com/mholt/acmez/v2/acme" + "github.com/mholt/acmez/v3/acme" ) // TLSALPN01ChallengeCert creates a certificate that can be used for diff --git a/vendor/github.com/minio/minio-go/v7/api-copy-object.go b/vendor/github.com/minio/minio-go/v7/api-copy-object.go index 0c95d91e..b6cadc86 100644 --- a/vendor/github.com/minio/minio-go/v7/api-copy-object.go +++ b/vendor/github.com/minio/minio-go/v7/api-copy-object.go @@ -68,7 +68,7 @@ func (c *Client) CopyObject(ctx context.Context, dst CopyDestOptions, src CopySr Bucket: dst.Bucket, Key: dst.Object, LastModified: cpObjRes.LastModified, - ETag: trimEtag(resp.Header.Get("ETag")), + ETag: trimEtag(cpObjRes.ETag), VersionID: resp.Header.Get(amzVersionID), Expiration: expTime, ExpirationRuleID: ruleID, diff --git a/vendor/github.com/minio/minio-go/v7/api-datatypes.go b/vendor/github.com/minio/minio-go/v7/api-datatypes.go index 97a6f80b..8a8fd889 100644 --- a/vendor/github.com/minio/minio-go/v7/api-datatypes.go +++ b/vendor/github.com/minio/minio-go/v7/api-datatypes.go @@ -143,10 +143,11 @@ type UploadInfo struct { // Verified checksum values, if any. // Values are base64 (standard) encoded. // For multipart objects this is a checksum of the checksum of each part. - ChecksumCRC32 string - ChecksumCRC32C string - ChecksumSHA1 string - ChecksumSHA256 string + ChecksumCRC32 string + ChecksumCRC32C string + ChecksumSHA1 string + ChecksumSHA256 string + ChecksumCRC64NVME string } // RestoreInfo contains information of the restore operation of an archived object @@ -215,10 +216,11 @@ type ObjectInfo struct { Restore *RestoreInfo // Checksum values - ChecksumCRC32 string - ChecksumCRC32C string - ChecksumSHA1 string - ChecksumSHA256 string + ChecksumCRC32 string + ChecksumCRC32C string + ChecksumSHA1 string + ChecksumSHA256 string + ChecksumCRC64NVME string Internal *struct { K int // Data blocks diff --git a/vendor/github.com/minio/minio-go/v7/api-get-object.go b/vendor/github.com/minio/minio-go/v7/api-get-object.go index d7fd2783..5cc85f61 100644 --- a/vendor/github.com/minio/minio-go/v7/api-get-object.go +++ b/vendor/github.com/minio/minio-go/v7/api-get-object.go @@ -318,7 +318,7 @@ func (o *Object) doGetRequest(request getRequest) (getResponse, error) { response := <-o.resCh // Return any error to the top level. - if response.Error != nil { + if response.Error != nil && response.Error != io.EOF { return response, response.Error } @@ -340,7 +340,7 @@ func (o *Object) doGetRequest(request getRequest) (getResponse, error) { // Data are ready on the wire, no need to reinitiate connection in lower level o.seekData = false - return response, nil + return response, response.Error } // setOffset - handles the setting of offsets for diff --git a/vendor/github.com/minio/minio-go/v7/api-presigned.go b/vendor/github.com/minio/minio-go/v7/api-presigned.go index 9e85f818..29642200 100644 --- a/vendor/github.com/minio/minio-go/v7/api-presigned.go +++ b/vendor/github.com/minio/minio-go/v7/api-presigned.go @@ -140,7 +140,7 @@ func (c *Client) PresignedPostPolicy(ctx context.Context, p *PostPolicy) (u *url } // Get credentials from the configured credentials provider. - credValues, err := c.credsProvider.Get() + credValues, err := c.credsProvider.GetWithContext(c.CredContext()) if err != nil { return nil, nil, err } diff --git a/vendor/github.com/minio/minio-go/v7/api-prompt-object.go b/vendor/github.com/minio/minio-go/v7/api-prompt-object.go new file mode 100644 index 00000000..dac062a7 --- /dev/null +++ b/vendor/github.com/minio/minio-go/v7/api-prompt-object.go @@ -0,0 +1,78 @@ +/* + * MinIO Go Library for Amazon S3 Compatible Cloud Storage + * Copyright 2015-2024 MinIO, Inc. + * + * Licensed under the Apache License, Version 2.0 (the "License"); + * you may not use this file except in compliance with the License. + * You may obtain a copy of the License at + * + * http://www.apache.org/licenses/LICENSE-2.0 + * + * Unless required by applicable law or agreed to in writing, software + * distributed under the License is distributed on an "AS IS" BASIS, + * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. + * See the License for the specific language governing permissions and + * limitations under the License. + */ + +package minio + +import ( + "bytes" + "context" + "io" + "net/http" + + "github.com/goccy/go-json" + "github.com/minio/minio-go/v7/pkg/s3utils" +) + +// PromptObject performs language model inference with the prompt and referenced object as context. +// Inference is performed using a Lambda handler that can process the prompt and object. +// Currently, this functionality is limited to certain MinIO servers. +func (c *Client) PromptObject(ctx context.Context, bucketName, objectName, prompt string, opts PromptObjectOptions) (io.ReadCloser, error) { + // Input validation. + if err := s3utils.CheckValidBucketName(bucketName); err != nil { + return nil, ErrorResponse{ + StatusCode: http.StatusBadRequest, + Code: "InvalidBucketName", + Message: err.Error(), + } + } + if err := s3utils.CheckValidObjectName(objectName); err != nil { + return nil, ErrorResponse{ + StatusCode: http.StatusBadRequest, + Code: "XMinioInvalidObjectName", + Message: err.Error(), + } + } + + opts.AddLambdaArnToReqParams(opts.LambdaArn) + opts.SetHeader("Content-Type", "application/json") + opts.AddPromptArg("prompt", prompt) + promptReqBytes, err := json.Marshal(opts.PromptArgs) + if err != nil { + return nil, err + } + + // Execute POST on bucket/object. + resp, err := c.executeMethod(ctx, http.MethodPost, requestMetadata{ + bucketName: bucketName, + objectName: objectName, + queryValues: opts.toQueryValues(), + customHeader: opts.Header(), + contentSHA256Hex: sum256Hex(promptReqBytes), + contentBody: bytes.NewReader(promptReqBytes), + contentLength: int64(len(promptReqBytes)), + }) + if err != nil { + return nil, err + } + + if resp.StatusCode != http.StatusOK { + defer closeResponse(resp) + return nil, httpRespToErrorResponse(resp, bucketName, objectName) + } + + return resp.Body, nil +} diff --git a/vendor/github.com/minio/minio-go/v7/api-prompt-options.go b/vendor/github.com/minio/minio-go/v7/api-prompt-options.go new file mode 100644 index 00000000..4493a75d --- /dev/null +++ b/vendor/github.com/minio/minio-go/v7/api-prompt-options.go @@ -0,0 +1,84 @@ +/* + * MinIO Go Library for Amazon S3 Compatible Cloud Storage + * Copyright 2015-2024 MinIO, Inc. + * + * Licensed under the Apache License, Version 2.0 (the "License"); + * you may not use this file except in compliance with the License. + * You may obtain a copy of the License at + * + * http://www.apache.org/licenses/LICENSE-2.0 + * + * Unless required by applicable law or agreed to in writing, software + * distributed under the License is distributed on an "AS IS" BASIS, + * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. + * See the License for the specific language governing permissions and + * limitations under the License. + */ + +package minio + +import ( + "net/http" + "net/url" +) + +// PromptObjectOptions provides options to PromptObject call. +// LambdaArn is the ARN of the Prompt Lambda to be invoked. +// PromptArgs is a map of key-value pairs to be passed to the inference action on the Prompt Lambda. +// "prompt" is a reserved key and should not be used as a key in PromptArgs. +type PromptObjectOptions struct { + LambdaArn string + PromptArgs map[string]any + headers map[string]string + reqParams url.Values +} + +// Header returns the http.Header representation of the POST options. +func (o PromptObjectOptions) Header() http.Header { + headers := make(http.Header, len(o.headers)) + for k, v := range o.headers { + headers.Set(k, v) + } + return headers +} + +// AddPromptArg Add a key value pair to the prompt arguments where the key is a string and +// the value is a JSON serializable. +func (o *PromptObjectOptions) AddPromptArg(key string, value any) { + if o.PromptArgs == nil { + o.PromptArgs = make(map[string]any) + } + o.PromptArgs[key] = value +} + +// AddLambdaArnToReqParams adds the lambdaArn to the request query string parameters. +func (o *PromptObjectOptions) AddLambdaArnToReqParams(lambdaArn string) { + if o.reqParams == nil { + o.reqParams = make(url.Values) + } + o.reqParams.Add("lambdaArn", lambdaArn) +} + +// SetHeader adds a key value pair to the options. The +// key-value pair will be part of the HTTP POST request +// headers. +func (o *PromptObjectOptions) SetHeader(key, value string) { + if o.headers == nil { + o.headers = make(map[string]string) + } + o.headers[http.CanonicalHeaderKey(key)] = value +} + +// toQueryValues - Convert the reqParams in Options to query string parameters. +func (o *PromptObjectOptions) toQueryValues() url.Values { + urlValues := make(url.Values) + if o.reqParams != nil { + for key, values := range o.reqParams { + for _, value := range values { + urlValues.Add(key, value) + } + } + } + + return urlValues +} diff --git a/vendor/github.com/minio/minio-go/v7/api-put-object-fan-out.go b/vendor/github.com/minio/minio-go/v7/api-put-object-fan-out.go index 0ae9142e..3023b949 100644 --- a/vendor/github.com/minio/minio-go/v7/api-put-object-fan-out.go +++ b/vendor/github.com/minio/minio-go/v7/api-put-object-fan-out.go @@ -85,7 +85,10 @@ func (c *Client) PutObjectFanOut(ctx context.Context, bucket string, fanOutData policy.SetEncryption(fanOutReq.SSE) // Set checksum headers if any. - policy.SetChecksum(fanOutReq.Checksum) + err := policy.SetChecksum(fanOutReq.Checksum) + if err != nil { + return nil, err + } url, formData, err := c.PresignedPostPolicy(ctx, policy) if err != nil { diff --git a/vendor/github.com/minio/minio-go/v7/api-put-object-multipart.go b/vendor/github.com/minio/minio-go/v7/api-put-object-multipart.go index a70cbea9..03bd34f7 100644 --- a/vendor/github.com/minio/minio-go/v7/api-put-object-multipart.go +++ b/vendor/github.com/minio/minio-go/v7/api-put-object-multipart.go @@ -83,10 +83,7 @@ func (c *Client) putObjectMultipartNoStream(ctx context.Context, bucketName, obj // HTTPS connection. hashAlgos, hashSums := c.hashMaterials(opts.SendContentMd5, !opts.DisableContentSha256) if len(hashSums) == 0 { - if opts.UserMetadata == nil { - opts.UserMetadata = make(map[string]string, 1) - } - opts.UserMetadata["X-Amz-Checksum-Algorithm"] = opts.AutoChecksum.String() + addAutoChecksumHeaders(&opts) } // Initiate a new multipart upload. @@ -113,7 +110,6 @@ func (c *Client) putObjectMultipartNoStream(ctx context.Context, bucketName, obj // Create checksums // CRC32C is ~50% faster on AMD64 @ 30GB/s - var crcBytes []byte customHeader := make(http.Header) crc := opts.AutoChecksum.Hasher() for partNumber <= totalPartsCount { @@ -154,7 +150,6 @@ func (c *Client) putObjectMultipartNoStream(ctx context.Context, bucketName, obj crc.Write(buf[:length]) cSum := crc.Sum(nil) customHeader.Set(opts.AutoChecksum.Key(), base64.StdEncoding.EncodeToString(cSum)) - crcBytes = append(crcBytes, cSum...) } p := uploadPartParams{bucketName: bucketName, objectName: objectName, uploadID: uploadID, reader: rd, partNumber: partNumber, md5Base64: md5Base64, sha256Hex: sha256Hex, size: int64(length), sse: opts.ServerSideEncryption, streamSha256: !opts.DisableContentSha256, customHeader: customHeader} @@ -182,18 +177,21 @@ func (c *Client) putObjectMultipartNoStream(ctx context.Context, bucketName, obj // Loop over total uploaded parts to save them in // Parts array before completing the multipart request. + allParts := make([]ObjectPart, 0, len(partsInfo)) for i := 1; i < partNumber; i++ { part, ok := partsInfo[i] if !ok { return UploadInfo{}, errInvalidArgument(fmt.Sprintf("Missing part number %d", i)) } + allParts = append(allParts, part) complMultipartUpload.Parts = append(complMultipartUpload.Parts, CompletePart{ - ETag: part.ETag, - PartNumber: part.PartNumber, - ChecksumCRC32: part.ChecksumCRC32, - ChecksumCRC32C: part.ChecksumCRC32C, - ChecksumSHA1: part.ChecksumSHA1, - ChecksumSHA256: part.ChecksumSHA256, + ETag: part.ETag, + PartNumber: part.PartNumber, + ChecksumCRC32: part.ChecksumCRC32, + ChecksumCRC32C: part.ChecksumCRC32C, + ChecksumSHA1: part.ChecksumSHA1, + ChecksumSHA256: part.ChecksumSHA256, + ChecksumCRC64NVME: part.ChecksumCRC64NVME, }) } @@ -203,12 +201,8 @@ func (c *Client) putObjectMultipartNoStream(ctx context.Context, bucketName, obj ServerSideEncryption: opts.ServerSideEncryption, AutoChecksum: opts.AutoChecksum, } - if len(crcBytes) > 0 { - // Add hash of hashes. - crc.Reset() - crc.Write(crcBytes) - opts.UserMetadata = map[string]string{opts.AutoChecksum.Key(): base64.StdEncoding.EncodeToString(crc.Sum(nil))} - } + applyAutoChecksum(&opts, allParts) + uploadInfo, err := c.completeMultipartUpload(ctx, bucketName, objectName, uploadID, complMultipartUpload, opts) if err != nil { return UploadInfo{}, err @@ -354,10 +348,11 @@ func (c *Client) uploadPart(ctx context.Context, p uploadPartParams) (ObjectPart // Once successfully uploaded, return completed part. h := resp.Header objPart := ObjectPart{ - ChecksumCRC32: h.Get("x-amz-checksum-crc32"), - ChecksumCRC32C: h.Get("x-amz-checksum-crc32c"), - ChecksumSHA1: h.Get("x-amz-checksum-sha1"), - ChecksumSHA256: h.Get("x-amz-checksum-sha256"), + ChecksumCRC32: h.Get(ChecksumCRC32.Key()), + ChecksumCRC32C: h.Get(ChecksumCRC32C.Key()), + ChecksumSHA1: h.Get(ChecksumSHA1.Key()), + ChecksumSHA256: h.Get(ChecksumSHA256.Key()), + ChecksumCRC64NVME: h.Get(ChecksumCRC64NVME.Key()), } objPart.Size = p.size objPart.PartNumber = p.partNumber @@ -457,9 +452,10 @@ func (c *Client) completeMultipartUpload(ctx context.Context, bucketName, object Expiration: expTime, ExpirationRuleID: ruleID, - ChecksumSHA256: completeMultipartUploadResult.ChecksumSHA256, - ChecksumSHA1: completeMultipartUploadResult.ChecksumSHA1, - ChecksumCRC32: completeMultipartUploadResult.ChecksumCRC32, - ChecksumCRC32C: completeMultipartUploadResult.ChecksumCRC32C, + ChecksumSHA256: completeMultipartUploadResult.ChecksumSHA256, + ChecksumSHA1: completeMultipartUploadResult.ChecksumSHA1, + ChecksumCRC32: completeMultipartUploadResult.ChecksumCRC32, + ChecksumCRC32C: completeMultipartUploadResult.ChecksumCRC32C, + ChecksumCRC64NVME: completeMultipartUploadResult.ChecksumCRC64NVME, }, nil } diff --git a/vendor/github.com/minio/minio-go/v7/api-put-object-streaming.go b/vendor/github.com/minio/minio-go/v7/api-put-object-streaming.go index dac4c0ef..3ff3b69e 100644 --- a/vendor/github.com/minio/minio-go/v7/api-put-object-streaming.go +++ b/vendor/github.com/minio/minio-go/v7/api-put-object-streaming.go @@ -113,10 +113,7 @@ func (c *Client) putObjectMultipartStreamFromReadAt(ctx context.Context, bucketN } withChecksum := c.trailingHeaderSupport if withChecksum { - if opts.UserMetadata == nil { - opts.UserMetadata = make(map[string]string, 1) - } - opts.UserMetadata["X-Amz-Checksum-Algorithm"] = opts.AutoChecksum.String() + addAutoChecksumHeaders(&opts) } // Initiate a new multipart upload. uploadID, err := c.newUploadID(ctx, bucketName, objectName, opts) @@ -240,6 +237,7 @@ func (c *Client) putObjectMultipartStreamFromReadAt(ctx context.Context, bucketN // Gather the responses as they occur and update any // progress bar. + allParts := make([]ObjectPart, 0, totalPartsCount) for u := 1; u <= totalPartsCount; u++ { select { case <-ctx.Done(): @@ -248,16 +246,17 @@ func (c *Client) putObjectMultipartStreamFromReadAt(ctx context.Context, bucketN if uploadRes.Error != nil { return UploadInfo{}, uploadRes.Error } - + allParts = append(allParts, uploadRes.Part) // Update the totalUploadedSize. totalUploadedSize += uploadRes.Size complMultipartUpload.Parts = append(complMultipartUpload.Parts, CompletePart{ - ETag: uploadRes.Part.ETag, - PartNumber: uploadRes.Part.PartNumber, - ChecksumCRC32: uploadRes.Part.ChecksumCRC32, - ChecksumCRC32C: uploadRes.Part.ChecksumCRC32C, - ChecksumSHA1: uploadRes.Part.ChecksumSHA1, - ChecksumSHA256: uploadRes.Part.ChecksumSHA256, + ETag: uploadRes.Part.ETag, + PartNumber: uploadRes.Part.PartNumber, + ChecksumCRC32: uploadRes.Part.ChecksumCRC32, + ChecksumCRC32C: uploadRes.Part.ChecksumCRC32C, + ChecksumSHA1: uploadRes.Part.ChecksumSHA1, + ChecksumSHA256: uploadRes.Part.ChecksumSHA256, + ChecksumCRC64NVME: uploadRes.Part.ChecksumCRC64NVME, }) } } @@ -275,15 +274,7 @@ func (c *Client) putObjectMultipartStreamFromReadAt(ctx context.Context, bucketN AutoChecksum: opts.AutoChecksum, } if withChecksum { - // Add hash of hashes. - crc := opts.AutoChecksum.Hasher() - for _, part := range complMultipartUpload.Parts { - cs, err := base64.StdEncoding.DecodeString(part.Checksum(opts.AutoChecksum)) - if err == nil { - crc.Write(cs) - } - } - opts.UserMetadata = map[string]string{opts.AutoChecksum.KeyCapitalized(): base64.StdEncoding.EncodeToString(crc.Sum(nil))} + applyAutoChecksum(&opts, allParts) } uploadInfo, err := c.completeMultipartUpload(ctx, bucketName, objectName, uploadID, complMultipartUpload, opts) @@ -312,10 +303,7 @@ func (c *Client) putObjectMultipartStreamOptionalChecksum(ctx context.Context, b } if !opts.SendContentMd5 { - if opts.UserMetadata == nil { - opts.UserMetadata = make(map[string]string, 1) - } - opts.UserMetadata["X-Amz-Checksum-Algorithm"] = opts.AutoChecksum.String() + addAutoChecksumHeaders(&opts) } // Calculate the optimal parts info for a given size. @@ -342,7 +330,6 @@ func (c *Client) putObjectMultipartStreamOptionalChecksum(ctx context.Context, b // Create checksums // CRC32C is ~50% faster on AMD64 @ 30GB/s - var crcBytes []byte customHeader := make(http.Header) crc := opts.AutoChecksum.Hasher() md5Hash := c.md5Hasher() @@ -389,7 +376,6 @@ func (c *Client) putObjectMultipartStreamOptionalChecksum(ctx context.Context, b crc.Write(buf[:length]) cSum := crc.Sum(nil) customHeader.Set(opts.AutoChecksum.KeyCapitalized(), base64.StdEncoding.EncodeToString(cSum)) - crcBytes = append(crcBytes, cSum...) } // Update progress reader appropriately to the latest offset @@ -420,18 +406,21 @@ func (c *Client) putObjectMultipartStreamOptionalChecksum(ctx context.Context, b // Loop over total uploaded parts to save them in // Parts array before completing the multipart request. + allParts := make([]ObjectPart, 0, len(partsInfo)) for i := 1; i < partNumber; i++ { part, ok := partsInfo[i] if !ok { return UploadInfo{}, errInvalidArgument(fmt.Sprintf("Missing part number %d", i)) } + allParts = append(allParts, part) complMultipartUpload.Parts = append(complMultipartUpload.Parts, CompletePart{ - ETag: part.ETag, - PartNumber: part.PartNumber, - ChecksumCRC32: part.ChecksumCRC32, - ChecksumCRC32C: part.ChecksumCRC32C, - ChecksumSHA1: part.ChecksumSHA1, - ChecksumSHA256: part.ChecksumSHA256, + ETag: part.ETag, + PartNumber: part.PartNumber, + ChecksumCRC32: part.ChecksumCRC32, + ChecksumCRC32C: part.ChecksumCRC32C, + ChecksumSHA1: part.ChecksumSHA1, + ChecksumSHA256: part.ChecksumSHA256, + ChecksumCRC64NVME: part.ChecksumCRC64NVME, }) } @@ -442,12 +431,7 @@ func (c *Client) putObjectMultipartStreamOptionalChecksum(ctx context.Context, b ServerSideEncryption: opts.ServerSideEncryption, AutoChecksum: opts.AutoChecksum, } - if len(crcBytes) > 0 { - // Add hash of hashes. - crc.Reset() - crc.Write(crcBytes) - opts.UserMetadata = map[string]string{opts.AutoChecksum.KeyCapitalized(): base64.StdEncoding.EncodeToString(crc.Sum(nil))} - } + applyAutoChecksum(&opts, allParts) uploadInfo, err := c.completeMultipartUpload(ctx, bucketName, objectName, uploadID, complMultipartUpload, opts) if err != nil { return UploadInfo{}, err @@ -475,10 +459,7 @@ func (c *Client) putObjectMultipartStreamParallel(ctx context.Context, bucketNam opts.AutoChecksum = opts.Checksum } if !opts.SendContentMd5 { - if opts.UserMetadata == nil { - opts.UserMetadata = make(map[string]string, 1) - } - opts.UserMetadata["X-Amz-Checksum-Algorithm"] = opts.AutoChecksum.String() + addAutoChecksumHeaders(&opts) } // Cancel all when an error occurs. @@ -510,7 +491,6 @@ func (c *Client) putObjectMultipartStreamParallel(ctx context.Context, bucketNam // Create checksums // CRC32C is ~50% faster on AMD64 @ 30GB/s - var crcBytes []byte crc := opts.AutoChecksum.Hasher() // Total data read and written to server. should be equal to 'size' at the end of the call. @@ -570,7 +550,6 @@ func (c *Client) putObjectMultipartStreamParallel(ctx context.Context, bucketNam crc.Write(buf[:length]) cSum := crc.Sum(nil) customHeader.Set(opts.AutoChecksum.Key(), base64.StdEncoding.EncodeToString(cSum)) - crcBytes = append(crcBytes, cSum...) } wg.Add(1) @@ -630,18 +609,21 @@ func (c *Client) putObjectMultipartStreamParallel(ctx context.Context, bucketNam // Loop over total uploaded parts to save them in // Parts array before completing the multipart request. + allParts := make([]ObjectPart, 0, len(partsInfo)) for i := 1; i < partNumber; i++ { part, ok := partsInfo[i] if !ok { return UploadInfo{}, errInvalidArgument(fmt.Sprintf("Missing part number %d", i)) } + allParts = append(allParts, part) complMultipartUpload.Parts = append(complMultipartUpload.Parts, CompletePart{ - ETag: part.ETag, - PartNumber: part.PartNumber, - ChecksumCRC32: part.ChecksumCRC32, - ChecksumCRC32C: part.ChecksumCRC32C, - ChecksumSHA1: part.ChecksumSHA1, - ChecksumSHA256: part.ChecksumSHA256, + ETag: part.ETag, + PartNumber: part.PartNumber, + ChecksumCRC32: part.ChecksumCRC32, + ChecksumCRC32C: part.ChecksumCRC32C, + ChecksumSHA1: part.ChecksumSHA1, + ChecksumSHA256: part.ChecksumSHA256, + ChecksumCRC64NVME: part.ChecksumCRC64NVME, }) } @@ -652,12 +634,8 @@ func (c *Client) putObjectMultipartStreamParallel(ctx context.Context, bucketNam ServerSideEncryption: opts.ServerSideEncryption, AutoChecksum: opts.AutoChecksum, } - if len(crcBytes) > 0 { - // Add hash of hashes. - crc.Reset() - crc.Write(crcBytes) - opts.UserMetadata = map[string]string{opts.AutoChecksum.KeyCapitalized(): base64.StdEncoding.EncodeToString(crc.Sum(nil))} - } + applyAutoChecksum(&opts, allParts) + uploadInfo, err := c.completeMultipartUpload(ctx, bucketName, objectName, uploadID, complMultipartUpload, opts) if err != nil { return UploadInfo{}, err @@ -823,9 +801,10 @@ func (c *Client) putObjectDo(ctx context.Context, bucketName, objectName string, ExpirationRuleID: ruleID, // Checksum values - ChecksumCRC32: h.Get("x-amz-checksum-crc32"), - ChecksumCRC32C: h.Get("x-amz-checksum-crc32c"), - ChecksumSHA1: h.Get("x-amz-checksum-sha1"), - ChecksumSHA256: h.Get("x-amz-checksum-sha256"), + ChecksumCRC32: h.Get(ChecksumCRC32.Key()), + ChecksumCRC32C: h.Get(ChecksumCRC32C.Key()), + ChecksumSHA1: h.Get(ChecksumSHA1.Key()), + ChecksumSHA256: h.Get(ChecksumSHA256.Key()), + ChecksumCRC64NVME: h.Get(ChecksumCRC64NVME.Key()), }, nil } diff --git a/vendor/github.com/minio/minio-go/v7/api-put-object.go b/vendor/github.com/minio/minio-go/v7/api-put-object.go index 10131a5b..09817578 100644 --- a/vendor/github.com/minio/minio-go/v7/api-put-object.go +++ b/vendor/github.com/minio/minio-go/v7/api-put-object.go @@ -387,10 +387,7 @@ func (c *Client) putObjectMultipartStreamNoLength(ctx context.Context, bucketNam opts.AutoChecksum = opts.Checksum } if !opts.SendContentMd5 { - if opts.UserMetadata == nil { - opts.UserMetadata = make(map[string]string, 1) - } - opts.UserMetadata["X-Amz-Checksum-Algorithm"] = opts.AutoChecksum.String() + addAutoChecksumHeaders(&opts) } // Initiate a new multipart upload. @@ -417,7 +414,6 @@ func (c *Client) putObjectMultipartStreamNoLength(ctx context.Context, bucketNam // Create checksums // CRC32C is ~50% faster on AMD64 @ 30GB/s - var crcBytes []byte customHeader := make(http.Header) crc := opts.AutoChecksum.Hasher() @@ -443,7 +439,6 @@ func (c *Client) putObjectMultipartStreamNoLength(ctx context.Context, bucketNam crc.Write(buf[:length]) cSum := crc.Sum(nil) customHeader.Set(opts.AutoChecksum.Key(), base64.StdEncoding.EncodeToString(cSum)) - crcBytes = append(crcBytes, cSum...) } // Update progress reader appropriately to the latest offset @@ -475,18 +470,21 @@ func (c *Client) putObjectMultipartStreamNoLength(ctx context.Context, bucketNam // Loop over total uploaded parts to save them in // Parts array before completing the multipart request. + allParts := make([]ObjectPart, 0, len(partsInfo)) for i := 1; i < partNumber; i++ { part, ok := partsInfo[i] if !ok { return UploadInfo{}, errInvalidArgument(fmt.Sprintf("Missing part number %d", i)) } + allParts = append(allParts, part) complMultipartUpload.Parts = append(complMultipartUpload.Parts, CompletePart{ - ETag: part.ETag, - PartNumber: part.PartNumber, - ChecksumCRC32: part.ChecksumCRC32, - ChecksumCRC32C: part.ChecksumCRC32C, - ChecksumSHA1: part.ChecksumSHA1, - ChecksumSHA256: part.ChecksumSHA256, + ETag: part.ETag, + PartNumber: part.PartNumber, + ChecksumCRC32: part.ChecksumCRC32, + ChecksumCRC32C: part.ChecksumCRC32C, + ChecksumSHA1: part.ChecksumSHA1, + ChecksumSHA256: part.ChecksumSHA256, + ChecksumCRC64NVME: part.ChecksumCRC64NVME, }) } @@ -497,12 +495,8 @@ func (c *Client) putObjectMultipartStreamNoLength(ctx context.Context, bucketNam ServerSideEncryption: opts.ServerSideEncryption, AutoChecksum: opts.AutoChecksum, } - if len(crcBytes) > 0 { - // Add hash of hashes. - crc.Reset() - crc.Write(crcBytes) - opts.UserMetadata = map[string]string{opts.AutoChecksum.KeyCapitalized(): base64.StdEncoding.EncodeToString(crc.Sum(nil))} - } + applyAutoChecksum(&opts, allParts) + uploadInfo, err := c.completeMultipartUpload(ctx, bucketName, objectName, uploadID, complMultipartUpload, opts) if err != nil { return UploadInfo{}, err diff --git a/vendor/github.com/minio/minio-go/v7/api-s3-datatypes.go b/vendor/github.com/minio/minio-go/v7/api-s3-datatypes.go index 790606c5..5e015fb8 100644 --- a/vendor/github.com/minio/minio-go/v7/api-s3-datatypes.go +++ b/vendor/github.com/minio/minio-go/v7/api-s3-datatypes.go @@ -18,6 +18,7 @@ package minio import ( + "encoding/base64" "encoding/xml" "errors" "io" @@ -276,10 +277,45 @@ type ObjectPart struct { Size int64 // Checksum values of each part. - ChecksumCRC32 string - ChecksumCRC32C string - ChecksumSHA1 string - ChecksumSHA256 string + ChecksumCRC32 string + ChecksumCRC32C string + ChecksumSHA1 string + ChecksumSHA256 string + ChecksumCRC64NVME string +} + +// Checksum will return the checksum for the given type. +// Will return the empty string if not set. +func (c ObjectPart) Checksum(t ChecksumType) string { + switch { + case t.Is(ChecksumCRC32C): + return c.ChecksumCRC32C + case t.Is(ChecksumCRC32): + return c.ChecksumCRC32 + case t.Is(ChecksumSHA1): + return c.ChecksumSHA1 + case t.Is(ChecksumSHA256): + return c.ChecksumSHA256 + case t.Is(ChecksumCRC64NVME): + return c.ChecksumCRC64NVME + } + return "" +} + +// ChecksumRaw returns the decoded checksum from the part. +func (c ObjectPart) ChecksumRaw(t ChecksumType) ([]byte, error) { + b64 := c.Checksum(t) + if b64 == "" { + return nil, errors.New("no checksum set") + } + decoded, err := base64.StdEncoding.DecodeString(b64) + if err != nil { + return nil, err + } + if len(decoded) != t.RawByteLen() { + return nil, errors.New("checksum length mismatch") + } + return decoded, nil } // ListObjectPartsResult container for ListObjectParts response. @@ -296,6 +332,12 @@ type ListObjectPartsResult struct { NextPartNumberMarker int MaxParts int + // ChecksumAlgorithm will be CRC32, CRC32C, etc. + ChecksumAlgorithm string + + // ChecksumType is FULL_OBJECT or COMPOSITE (assume COMPOSITE when unset) + ChecksumType string + // Indicates whether the returned list of parts is truncated. IsTruncated bool ObjectParts []ObjectPart `xml:"Part"` @@ -320,10 +362,11 @@ type completeMultipartUploadResult struct { ETag string // Checksum values, hash of hashes of parts. - ChecksumCRC32 string - ChecksumCRC32C string - ChecksumSHA1 string - ChecksumSHA256 string + ChecksumCRC32 string + ChecksumCRC32C string + ChecksumSHA1 string + ChecksumSHA256 string + ChecksumCRC64NVME string } // CompletePart sub container lists individual part numbers and their @@ -334,10 +377,11 @@ type CompletePart struct { ETag string // Checksum values - ChecksumCRC32 string `xml:"ChecksumCRC32,omitempty"` - ChecksumCRC32C string `xml:"ChecksumCRC32C,omitempty"` - ChecksumSHA1 string `xml:"ChecksumSHA1,omitempty"` - ChecksumSHA256 string `xml:"ChecksumSHA256,omitempty"` + ChecksumCRC32 string `xml:"ChecksumCRC32,omitempty"` + ChecksumCRC32C string `xml:"ChecksumCRC32C,omitempty"` + ChecksumSHA1 string `xml:"ChecksumSHA1,omitempty"` + ChecksumSHA256 string `xml:"ChecksumSHA256,omitempty"` + ChecksumCRC64NVME string `xml:",omitempty"` } // Checksum will return the checksum for the given type. @@ -352,6 +396,8 @@ func (c CompletePart) Checksum(t ChecksumType) string { return c.ChecksumSHA1 case t.Is(ChecksumSHA256): return c.ChecksumSHA256 + case t.Is(ChecksumCRC64NVME): + return c.ChecksumCRC64NVME } return "" } diff --git a/vendor/github.com/minio/minio-go/v7/api.go b/vendor/github.com/minio/minio-go/v7/api.go index 380ec4fd..cc0ded2c 100644 --- a/vendor/github.com/minio/minio-go/v7/api.go +++ b/vendor/github.com/minio/minio-go/v7/api.go @@ -133,7 +133,7 @@ type Options struct { // Global constants. const ( libraryName = "minio-go" - libraryVersion = "v7.0.80" + libraryVersion = "v7.0.84" ) // User Agent should always following the below style. @@ -600,9 +600,9 @@ func (c *Client) executeMethod(ctx context.Context, method string, metadata requ return nil, errors.New(c.endpointURL.String() + " is offline.") } - var retryable bool // Indicates if request can be retried. - var bodySeeker io.Seeker // Extracted seeker from io.Reader. - var reqRetry = c.maxRetries // Indicates how many times we can retry the request + var retryable bool // Indicates if request can be retried. + var bodySeeker io.Seeker // Extracted seeker from io.Reader. + reqRetry := c.maxRetries // Indicates how many times we can retry the request if metadata.contentBody != nil { // Check if body is seekable then it is retryable. @@ -808,7 +808,7 @@ func (c *Client) newRequest(ctx context.Context, method string, metadata request } // Get credentials from the configured credentials provider. - value, err := c.credsProvider.Get() + value, err := c.credsProvider.GetWithContext(c.CredContext()) if err != nil { return nil, err } @@ -1018,3 +1018,15 @@ func (c *Client) isVirtualHostStyleRequest(url url.URL, bucketName string) bool // path style requests return s3utils.IsVirtualHostSupported(url, bucketName) } + +// CredContext returns the context for fetching credentials +func (c *Client) CredContext() *credentials.CredContext { + httpClient := c.httpClient + if httpClient == nil { + httpClient = http.DefaultClient + } + return &credentials.CredContext{ + Client: httpClient, + Endpoint: c.endpointURL.String(), + } +} diff --git a/vendor/github.com/minio/minio-go/v7/bucket-cache.go b/vendor/github.com/minio/minio-go/v7/bucket-cache.go index b1d3b385..4e4305ac 100644 --- a/vendor/github.com/minio/minio-go/v7/bucket-cache.go +++ b/vendor/github.com/minio/minio-go/v7/bucket-cache.go @@ -212,7 +212,7 @@ func (c *Client) getBucketLocationRequest(ctx context.Context, bucketName string c.setUserAgent(req) // Get credentials from the configured credentials provider. - value, err := c.credsProvider.Get() + value, err := c.credsProvider.GetWithContext(c.CredContext()) if err != nil { return nil, err } diff --git a/vendor/github.com/minio/minio-go/v7/checksum.go b/vendor/github.com/minio/minio-go/v7/checksum.go index 7eb1bf25..8e4c27ce 100644 --- a/vendor/github.com/minio/minio-go/v7/checksum.go +++ b/vendor/github.com/minio/minio-go/v7/checksum.go @@ -21,11 +21,15 @@ import ( "crypto/sha1" "crypto/sha256" "encoding/base64" + "encoding/binary" + "errors" "hash" "hash/crc32" + "hash/crc64" "io" "math/bits" "net/http" + "sort" ) // ChecksumType contains information about the checksum type. @@ -41,23 +45,41 @@ const ( ChecksumCRC32 // ChecksumCRC32C indicates a CRC32 checksum with Castagnoli table. ChecksumCRC32C + // ChecksumCRC64NVME indicates CRC64 with 0xad93d23594c93659 polynomial. + ChecksumCRC64NVME // Keep after all valid checksums checksumLast + // ChecksumFullObject is a modifier that can be used on CRC32 and CRC32C + // to indicate full object checksums. + ChecksumFullObject + // checksumMask is a mask for valid checksum types. checksumMask = checksumLast - 1 // ChecksumNone indicates no checksum. ChecksumNone ChecksumType = 0 - amzChecksumAlgo = "x-amz-checksum-algorithm" - amzChecksumCRC32 = "x-amz-checksum-crc32" - amzChecksumCRC32C = "x-amz-checksum-crc32c" - amzChecksumSHA1 = "x-amz-checksum-sha1" - amzChecksumSHA256 = "x-amz-checksum-sha256" + // ChecksumFullObjectCRC32 indicates full object CRC32 + ChecksumFullObjectCRC32 = ChecksumCRC32 | ChecksumFullObject + + // ChecksumFullObjectCRC32C indicates full object CRC32C + ChecksumFullObjectCRC32C = ChecksumCRC32C | ChecksumFullObject + + amzChecksumAlgo = "x-amz-checksum-algorithm" + amzChecksumCRC32 = "x-amz-checksum-crc32" + amzChecksumCRC32C = "x-amz-checksum-crc32c" + amzChecksumSHA1 = "x-amz-checksum-sha1" + amzChecksumSHA256 = "x-amz-checksum-sha256" + amzChecksumCRC64NVME = "x-amz-checksum-crc64nvme" ) +// Base returns the base type, without modifiers. +func (c ChecksumType) Base() ChecksumType { + return c & checksumMask +} + // Is returns if c is all of t. func (c ChecksumType) Is(t ChecksumType) bool { return c&t == t @@ -75,10 +97,39 @@ func (c ChecksumType) Key() string { return amzChecksumSHA1 case ChecksumSHA256: return amzChecksumSHA256 + case ChecksumCRC64NVME: + return amzChecksumCRC64NVME } return "" } +// CanComposite will return if the checksum type can be used for composite multipart upload on AWS. +func (c ChecksumType) CanComposite() bool { + switch c & checksumMask { + case ChecksumSHA256, ChecksumSHA1, ChecksumCRC32, ChecksumCRC32C: + return true + } + return false +} + +// CanMergeCRC will return if the checksum type can be used for multipart upload on AWS. +func (c ChecksumType) CanMergeCRC() bool { + switch c & checksumMask { + case ChecksumCRC32, ChecksumCRC32C, ChecksumCRC64NVME: + return true + } + return false +} + +// FullObjectRequested will return if the checksum type indicates full object checksum was requested. +func (c ChecksumType) FullObjectRequested() bool { + switch c & (ChecksumFullObject | checksumMask) { + case ChecksumFullObjectCRC32C, ChecksumFullObjectCRC32, ChecksumCRC64NVME: + return true + } + return false +} + // KeyCapitalized returns the capitalized key as used in HTTP headers. func (c ChecksumType) KeyCapitalized() string { return http.CanonicalHeaderKey(c.Key()) @@ -93,10 +144,17 @@ func (c ChecksumType) RawByteLen() int { return sha1.Size case ChecksumSHA256: return sha256.Size + case ChecksumCRC64NVME: + return crc64.Size } return 0 } +const crc64NVMEPolynomial = 0xad93d23594c93659 + +// crc64 uses reversed polynomials. +var crc64Table = crc64.MakeTable(bits.Reverse64(crc64NVMEPolynomial)) + // Hasher returns a hasher corresponding to the checksum type. // Returns nil if no checksum. func (c ChecksumType) Hasher() hash.Hash { @@ -109,13 +167,15 @@ func (c ChecksumType) Hasher() hash.Hash { return sha1.New() case ChecksumSHA256: return sha256.New() + case ChecksumCRC64NVME: + return crc64.New(crc64Table) } return nil } // IsSet returns whether the type is valid and known. func (c ChecksumType) IsSet() bool { - return bits.OnesCount32(uint32(c)) == 1 + return bits.OnesCount32(uint32(c&checksumMask)) == 1 } // SetDefault will set the checksum if not already set. @@ -125,6 +185,16 @@ func (c *ChecksumType) SetDefault(t ChecksumType) { } } +// EncodeToString the encoded hash value of the content provided in b. +func (c ChecksumType) EncodeToString(b []byte) string { + if !c.IsSet() { + return "" + } + h := c.Hasher() + h.Write(b) + return base64.StdEncoding.EncodeToString(h.Sum(nil)) +} + // String returns the type as a string. // CRC32, CRC32C, SHA1, and SHA256 for valid values. // Empty string for unset and "" if not valid. @@ -140,6 +210,8 @@ func (c ChecksumType) String() string { return "SHA256" case ChecksumNone: return "" + case ChecksumCRC64NVME: + return "CRC64NVME" } return "" } @@ -221,3 +293,129 @@ func (c Checksum) Raw() []byte { } return c.r } + +// CompositeChecksum returns the composite checksum of all provided parts. +func (c ChecksumType) CompositeChecksum(p []ObjectPart) (*Checksum, error) { + if !c.CanComposite() { + return nil, errors.New("cannot do composite checksum") + } + sort.Slice(p, func(i, j int) bool { + return p[i].PartNumber < p[j].PartNumber + }) + c = c.Base() + crcBytes := make([]byte, 0, len(p)*c.RawByteLen()) + for _, part := range p { + pCrc, err := part.ChecksumRaw(c) + if err != nil { + return nil, err + } + crcBytes = append(crcBytes, pCrc...) + } + h := c.Hasher() + h.Write(crcBytes) + return &Checksum{Type: c, r: h.Sum(nil)}, nil +} + +// FullObjectChecksum will return the full object checksum from provided parts. +func (c ChecksumType) FullObjectChecksum(p []ObjectPart) (*Checksum, error) { + if !c.CanMergeCRC() { + return nil, errors.New("cannot merge this checksum type") + } + c = c.Base() + sort.Slice(p, func(i, j int) bool { + return p[i].PartNumber < p[j].PartNumber + }) + + switch len(p) { + case 0: + return nil, errors.New("no parts given") + case 1: + check, err := p[0].ChecksumRaw(c) + if err != nil { + return nil, err + } + return &Checksum{ + Type: c, + r: check, + }, nil + } + var merged uint32 + var merged64 uint64 + first, err := p[0].ChecksumRaw(c) + if err != nil { + return nil, err + } + sz := p[0].Size + switch c { + case ChecksumCRC32, ChecksumCRC32C: + merged = binary.BigEndian.Uint32(first) + case ChecksumCRC64NVME: + merged64 = binary.BigEndian.Uint64(first) + } + + poly32 := uint32(crc32.IEEE) + if c.Is(ChecksumCRC32C) { + poly32 = crc32.Castagnoli + } + for _, part := range p[1:] { + if part.Size == 0 { + continue + } + sz += part.Size + pCrc, err := part.ChecksumRaw(c) + if err != nil { + return nil, err + } + switch c { + case ChecksumCRC32, ChecksumCRC32C: + merged = crc32Combine(poly32, merged, binary.BigEndian.Uint32(pCrc), part.Size) + case ChecksumCRC64NVME: + merged64 = crc64Combine(bits.Reverse64(crc64NVMEPolynomial), merged64, binary.BigEndian.Uint64(pCrc), part.Size) + } + } + var tmp [8]byte + switch c { + case ChecksumCRC32, ChecksumCRC32C: + binary.BigEndian.PutUint32(tmp[:], merged) + return &Checksum{ + Type: c, + r: tmp[:4], + }, nil + case ChecksumCRC64NVME: + binary.BigEndian.PutUint64(tmp[:], merged64) + return &Checksum{ + Type: c, + r: tmp[:8], + }, nil + default: + return nil, errors.New("unknown checksum type") + } +} + +func addAutoChecksumHeaders(opts *PutObjectOptions) { + if opts.UserMetadata == nil { + opts.UserMetadata = make(map[string]string, 1) + } + opts.UserMetadata["X-Amz-Checksum-Algorithm"] = opts.AutoChecksum.String() + if opts.AutoChecksum.FullObjectRequested() { + opts.UserMetadata["X-Amz-Checksum-Type"] = "FULL_OBJECT" + } +} + +func applyAutoChecksum(opts *PutObjectOptions, allParts []ObjectPart) { + if !opts.AutoChecksum.IsSet() { + return + } + if opts.AutoChecksum.CanComposite() && !opts.AutoChecksum.Is(ChecksumFullObject) { + // Add composite hash of hashes. + crc, err := opts.AutoChecksum.CompositeChecksum(allParts) + if err == nil { + opts.UserMetadata = map[string]string{opts.AutoChecksum.Key(): crc.Encoded()} + } + } else if opts.AutoChecksum.CanMergeCRC() { + crc, err := opts.AutoChecksum.FullObjectChecksum(allParts) + if err == nil { + opts.UserMetadata = map[string]string{opts.AutoChecksum.KeyCapitalized(): crc.Encoded(), "X-Amz-Checksum-Type": "FULL_OBJECT"} + } + } +} diff --git a/vendor/github.com/minio/minio-go/v7/functional_tests.go b/vendor/github.com/minio/minio-go/v7/functional_tests.go index c0180b36..33e87e6e 100644 --- a/vendor/github.com/minio/minio-go/v7/functional_tests.go +++ b/vendor/github.com/minio/minio-go/v7/functional_tests.go @@ -160,7 +160,7 @@ func logError(testName, function string, args map[string]interface{}, startTime } else { logFailure(testName, function, args, startTime, alert, message, err) if !isRunOnFail() { - panic(err) + panic(fmt.Sprintf("Test failed with message: %s, err: %v", message, err)) } } } @@ -393,6 +393,42 @@ func getFuncNameLoc(caller int) string { return strings.TrimPrefix(runtime.FuncForPC(pc).Name(), "main.") } +type ClientConfig struct { + // MinIO client configuration + TraceOn bool // Turn on tracing of HTTP requests and responses to stderr + CredsV2 bool // Use V2 credentials if true, otherwise use v4 + TrailingHeaders bool // Send trailing headers in requests +} + +func NewClient(config ClientConfig) (*minio.Client, error) { + // Instantiate new MinIO client + var creds *credentials.Credentials + if config.CredsV2 { + creds = credentials.NewStaticV2(os.Getenv(accessKey), os.Getenv(secretKey), "") + } else { + creds = credentials.NewStaticV4(os.Getenv(accessKey), os.Getenv(secretKey), "") + } + opts := &minio.Options{ + Creds: creds, + Transport: createHTTPTransport(), + Secure: mustParseBool(os.Getenv(enableHTTPS)), + TrailingHeaders: config.TrailingHeaders, + } + client, err := minio.New(os.Getenv(serverEndpoint), opts) + if err != nil { + return nil, err + } + + if config.TraceOn { + client.TraceOn(os.Stderr) + } + + // Set user agent. + client.SetAppInfo("MinIO-go-FunctionalTest", appVersion) + + return client, nil +} + // Tests bucket re-create errors. func testMakeBucketError() { region := "eu-central-1" @@ -407,27 +443,12 @@ func testMakeBucketError() { "region": region, } - // Seed random based on current time. - rand.Seed(time.Now().Unix()) - - // Instantiate new minio client object. - c, err := minio.New(os.Getenv(serverEndpoint), - &minio.Options{ - Creds: credentials.NewStaticV4(os.Getenv(accessKey), os.Getenv(secretKey), ""), - Secure: mustParseBool(os.Getenv(enableHTTPS)), - Transport: createHTTPTransport(), - }) + c, err := NewClient(ClientConfig{}) if err != nil { logError(testName, function, args, startTime, "", "MinIO client creation failed", err) return } - // Enable tracing, write to stderr. - // c.TraceOn(os.Stderr) - - // Set user agent. - c.SetAppInfo("MinIO-go-FunctionalTest", appVersion) - // Generate a new random bucket name. bucketName := randString(60, rand.NewSource(time.Now().UnixNano()), "minio-go-test-") args["bucketName"] = bucketName @@ -462,20 +483,12 @@ func testMetadataSizeLimit() { "objectName": "", "opts.UserMetadata": "", } - rand.Seed(startTime.Unix()) - // Instantiate new minio client object. - c, err := minio.New(os.Getenv(serverEndpoint), - &minio.Options{ - Creds: credentials.NewStaticV4(os.Getenv(accessKey), os.Getenv(secretKey), ""), - Secure: mustParseBool(os.Getenv(enableHTTPS)), - Transport: createHTTPTransport(), - }) + c, err := NewClient(ClientConfig{}) if err != nil { logError(testName, function, args, startTime, "", "MinIO client creation failed", err) return } - c.SetAppInfo("MinIO-go-FunctionalTest", appVersion) bucketName := randString(60, rand.NewSource(time.Now().UnixNano()), "minio-go-test-") args["bucketName"] = bucketName @@ -531,27 +544,12 @@ func testMakeBucketRegions() { "region": region, } - // Seed random based on current time. - rand.Seed(time.Now().Unix()) - - // Instantiate new minio client object. - c, err := minio.New(os.Getenv(serverEndpoint), - &minio.Options{ - Creds: credentials.NewStaticV4(os.Getenv(accessKey), os.Getenv(secretKey), ""), - Transport: createHTTPTransport(), - Secure: mustParseBool(os.Getenv(enableHTTPS)), - }) + c, err := NewClient(ClientConfig{}) if err != nil { logError(testName, function, args, startTime, "", "MinIO client creation failed", err) return } - // Enable tracing, write to stderr. - // c.TraceOn(os.Stderr) - - // Set user agent. - c.SetAppInfo("MinIO-go-FunctionalTest", appVersion) - // Generate a new random bucket name. bucketName := randString(60, rand.NewSource(time.Now().UnixNano()), "minio-go-test-") args["bucketName"] = bucketName @@ -598,27 +596,12 @@ func testPutObjectReadAt() { "opts": "objectContentType", } - // Seed random based on current time. - rand.Seed(time.Now().Unix()) - - // Instantiate new minio client object. - c, err := minio.New(os.Getenv(serverEndpoint), - &minio.Options{ - Creds: credentials.NewStaticV4(os.Getenv(accessKey), os.Getenv(secretKey), ""), - Transport: createHTTPTransport(), - Secure: mustParseBool(os.Getenv(enableHTTPS)), - }) + c, err := NewClient(ClientConfig{}) if err != nil { logError(testName, function, args, startTime, "", "MinIO client object creation failed", err) return } - // Enable tracing, write to stderr. - // c.TraceOn(os.Stderr) - - // Set user agent. - c.SetAppInfo("MinIO-go-FunctionalTest", appVersion) - // Generate a new random bucket name. bucketName := randString(60, rand.NewSource(time.Now().UnixNano()), "minio-go-test-") args["bucketName"] = bucketName @@ -697,27 +680,12 @@ func testListObjectVersions() { "recursive": "", } - // Seed random based on current time. - rand.Seed(time.Now().Unix()) - - // Instantiate new minio client object. - c, err := minio.New(os.Getenv(serverEndpoint), - &minio.Options{ - Creds: credentials.NewStaticV4(os.Getenv(accessKey), os.Getenv(secretKey), ""), - Transport: createHTTPTransport(), - Secure: mustParseBool(os.Getenv(enableHTTPS)), - }) + c, err := NewClient(ClientConfig{}) if err != nil { logError(testName, function, args, startTime, "", "MinIO client object creation failed", err) return } - // Enable tracing, write to stderr. - // c.TraceOn(os.Stderr) - - // Set user agent. - c.SetAppInfo("MinIO-go-FunctionalTest", appVersion) - // Generate a new random bucket name. bucketName := randString(60, rand.NewSource(time.Now().UnixNano()), "minio-go-test-") args["bucketName"] = bucketName @@ -817,27 +785,12 @@ func testStatObjectWithVersioning() { function := "StatObject" args := map[string]interface{}{} - // Seed random based on current time. - rand.Seed(time.Now().Unix()) - - // Instantiate new minio client object. - c, err := minio.New(os.Getenv(serverEndpoint), - &minio.Options{ - Creds: credentials.NewStaticV4(os.Getenv(accessKey), os.Getenv(secretKey), ""), - Transport: createHTTPTransport(), - Secure: mustParseBool(os.Getenv(enableHTTPS)), - }) + c, err := NewClient(ClientConfig{}) if err != nil { logError(testName, function, args, startTime, "", "MinIO client object creation failed", err) return } - // Enable tracing, write to stderr. - // c.TraceOn(os.Stderr) - - // Set user agent. - c.SetAppInfo("MinIO-go-FunctionalTest", appVersion) - // Generate a new random bucket name. bucketName := randString(60, rand.NewSource(time.Now().UnixNano()), "minio-go-test-") args["bucketName"] = bucketName @@ -935,27 +888,12 @@ func testGetObjectWithVersioning() { function := "GetObject()" args := map[string]interface{}{} - // Seed random based on current time. - rand.Seed(time.Now().Unix()) - - // Instantiate new minio client object. - c, err := minio.New(os.Getenv(serverEndpoint), - &minio.Options{ - Creds: credentials.NewStaticV4(os.Getenv(accessKey), os.Getenv(secretKey), ""), - Transport: createHTTPTransport(), - Secure: mustParseBool(os.Getenv(enableHTTPS)), - }) + c, err := NewClient(ClientConfig{}) if err != nil { logError(testName, function, args, startTime, "", "MinIO client object creation failed", err) return } - // Enable tracing, write to stderr. - // c.TraceOn(os.Stderr) - - // Set user agent. - c.SetAppInfo("MinIO-go-FunctionalTest", appVersion) - // Generate a new random bucket name. bucketName := randString(60, rand.NewSource(time.Now().UnixNano()), "minio-go-test-") args["bucketName"] = bucketName @@ -1075,27 +1013,12 @@ func testPutObjectWithVersioning() { function := "GetObject()" args := map[string]interface{}{} - // Seed random based on current time. - rand.Seed(time.Now().Unix()) - - // Instantiate new minio client object. - c, err := minio.New(os.Getenv(serverEndpoint), - &minio.Options{ - Creds: credentials.NewStaticV4(os.Getenv(accessKey), os.Getenv(secretKey), ""), - Transport: createHTTPTransport(), - Secure: mustParseBool(os.Getenv(enableHTTPS)), - }) + c, err := NewClient(ClientConfig{}) if err != nil { logError(testName, function, args, startTime, "", "MinIO client object creation failed", err) return } - // Enable tracing, write to stderr. - // c.TraceOn(os.Stderr) - - // Set user agent. - c.SetAppInfo("MinIO-go-FunctionalTest", appVersion) - // Generate a new random bucket name. bucketName := randString(60, rand.NewSource(time.Now().UnixNano()), "minio-go-test-") args["bucketName"] = bucketName @@ -1223,28 +1146,12 @@ func testListMultipartUpload() { function := "GetObject()" args := map[string]interface{}{} - // Instantiate new minio client object. - opts := &minio.Options{ - Creds: credentials.NewStaticV4(os.Getenv(accessKey), os.Getenv(secretKey), ""), - Transport: createHTTPTransport(), - Secure: mustParseBool(os.Getenv(enableHTTPS)), - } - c, err := minio.New(os.Getenv(serverEndpoint), opts) + c, err := NewClient(ClientConfig{}) if err != nil { logError(testName, function, args, startTime, "", "MinIO client object creation failed", err) return } - core, err := minio.NewCore(os.Getenv(serverEndpoint), opts) - if err != nil { - logError(testName, function, args, startTime, "", "MinIO core client object creation failed", err) - return - } - - // Enable tracing, write to stderr. - // c.TraceOn(os.Stderr) - - // Set user agent. - c.SetAppInfo("MinIO-go-FunctionalTest", appVersion) + core := minio.Core{Client: c} // Generate a new random bucket name. bucketName := randString(60, rand.NewSource(time.Now().UnixNano()), "minio-go-test-") @@ -1347,27 +1254,12 @@ func testCopyObjectWithVersioning() { function := "CopyObject()" args := map[string]interface{}{} - // Seed random based on current time. - rand.Seed(time.Now().Unix()) - - // Instantiate new minio client object. - c, err := minio.New(os.Getenv(serverEndpoint), - &minio.Options{ - Creds: credentials.NewStaticV4(os.Getenv(accessKey), os.Getenv(secretKey), ""), - Transport: createHTTPTransport(), - Secure: mustParseBool(os.Getenv(enableHTTPS)), - }) + c, err := NewClient(ClientConfig{}) if err != nil { logError(testName, function, args, startTime, "", "MinIO client object creation failed", err) return } - // Enable tracing, write to stderr. - // c.TraceOn(os.Stderr) - - // Set user agent. - c.SetAppInfo("MinIO-go-FunctionalTest", appVersion) - // Generate a new random bucket name. bucketName := randString(60, rand.NewSource(time.Now().UnixNano()), "minio-go-test-") args["bucketName"] = bucketName @@ -1485,27 +1377,12 @@ func testConcurrentCopyObjectWithVersioning() { function := "CopyObject()" args := map[string]interface{}{} - // Seed random based on current time. - rand.Seed(time.Now().Unix()) - - // Instantiate new minio client object. - c, err := minio.New(os.Getenv(serverEndpoint), - &minio.Options{ - Creds: credentials.NewStaticV4(os.Getenv(accessKey), os.Getenv(secretKey), ""), - Transport: createHTTPTransport(), - Secure: mustParseBool(os.Getenv(enableHTTPS)), - }) + c, err := NewClient(ClientConfig{}) if err != nil { logError(testName, function, args, startTime, "", "MinIO client object creation failed", err) return } - // Enable tracing, write to stderr. - // c.TraceOn(os.Stderr) - - // Set user agent. - c.SetAppInfo("MinIO-go-FunctionalTest", appVersion) - // Generate a new random bucket name. bucketName := randString(60, rand.NewSource(time.Now().UnixNano()), "minio-go-test-") args["bucketName"] = bucketName @@ -1646,27 +1523,12 @@ func testComposeObjectWithVersioning() { function := "ComposeObject()" args := map[string]interface{}{} - // Seed random based on current time. - rand.Seed(time.Now().Unix()) - - // Instantiate new minio client object. - c, err := minio.New(os.Getenv(serverEndpoint), - &minio.Options{ - Creds: credentials.NewStaticV4(os.Getenv(accessKey), os.Getenv(secretKey), ""), - Transport: createHTTPTransport(), - Secure: mustParseBool(os.Getenv(enableHTTPS)), - }) + c, err := NewClient(ClientConfig{}) if err != nil { logError(testName, function, args, startTime, "", "MinIO client object creation failed", err) return } - // Enable tracing, write to stderr. - // c.TraceOn(os.Stderr) - - // Set user agent. - c.SetAppInfo("MinIO-go-FunctionalTest", appVersion) - // Generate a new random bucket name. bucketName := randString(60, rand.NewSource(time.Now().UnixNano()), "minio-go-test-") args["bucketName"] = bucketName @@ -1787,27 +1649,12 @@ func testRemoveObjectWithVersioning() { function := "DeleteObject()" args := map[string]interface{}{} - // Seed random based on current time. - rand.Seed(time.Now().Unix()) - - // Instantiate new minio client object. - c, err := minio.New(os.Getenv(serverEndpoint), - &minio.Options{ - Creds: credentials.NewStaticV4(os.Getenv(accessKey), os.Getenv(secretKey), ""), - Transport: createHTTPTransport(), - Secure: mustParseBool(os.Getenv(enableHTTPS)), - }) + c, err := NewClient(ClientConfig{}) if err != nil { logError(testName, function, args, startTime, "", "MinIO client object creation failed", err) return } - // Enable tracing, write to stderr. - // c.TraceOn(os.Stderr) - - // Set user agent. - c.SetAppInfo("MinIO-go-FunctionalTest", appVersion) - // Generate a new random bucket name. bucketName := randString(60, rand.NewSource(time.Now().UnixNano()), "minio-go-test-") args["bucketName"] = bucketName @@ -1900,27 +1747,12 @@ func testRemoveObjectsWithVersioning() { function := "DeleteObjects()" args := map[string]interface{}{} - // Seed random based on current time. - rand.Seed(time.Now().Unix()) - - // Instantiate new minio client object. - c, err := minio.New(os.Getenv(serverEndpoint), - &minio.Options{ - Creds: credentials.NewStaticV4(os.Getenv(accessKey), os.Getenv(secretKey), ""), - Transport: createHTTPTransport(), - Secure: mustParseBool(os.Getenv(enableHTTPS)), - }) + c, err := NewClient(ClientConfig{}) if err != nil { logError(testName, function, args, startTime, "", "MinIO client object creation failed", err) return } - // Enable tracing, write to stderr. - // c.TraceOn(os.Stderr) - - // Set user agent. - c.SetAppInfo("MinIO-go-FunctionalTest", appVersion) - // Generate a new random bucket name. bucketName := randString(60, rand.NewSource(time.Now().UnixNano()), "minio-go-test-") args["bucketName"] = bucketName @@ -1996,27 +1828,12 @@ func testObjectTaggingWithVersioning() { function := "{Get,Set,Remove}ObjectTagging()" args := map[string]interface{}{} - // Seed random based on current time. - rand.Seed(time.Now().Unix()) - - // Instantiate new minio client object. - c, err := minio.New(os.Getenv(serverEndpoint), - &minio.Options{ - Creds: credentials.NewStaticV4(os.Getenv(accessKey), os.Getenv(secretKey), ""), - Transport: createHTTPTransport(), - Secure: mustParseBool(os.Getenv(enableHTTPS)), - }) + c, err := NewClient(ClientConfig{}) if err != nil { logError(testName, function, args, startTime, "", "MinIO client object creation failed", err) return } - // Enable tracing, write to stderr. - // c.TraceOn(os.Stderr) - - // Set user agent. - c.SetAppInfo("MinIO-go-FunctionalTest", appVersion) - // Generate a new random bucket name. bucketName := randString(60, rand.NewSource(time.Now().UnixNano()), "minio-go-test-") args["bucketName"] = bucketName @@ -2164,27 +1981,12 @@ func testPutObjectWithChecksums() { return } - // Seed random based on current time. - rand.Seed(time.Now().Unix()) - - // Instantiate new minio client object. - c, err := minio.New(os.Getenv(serverEndpoint), - &minio.Options{ - Creds: credentials.NewStaticV4(os.Getenv(accessKey), os.Getenv(secretKey), ""), - Transport: createHTTPTransport(), - Secure: mustParseBool(os.Getenv(enableHTTPS)), - }) + c, err := NewClient(ClientConfig{}) if err != nil { logError(testName, function, args, startTime, "", "MinIO client object creation failed", err) return } - // Enable tracing, write to stderr. - // c.TraceOn(os.Stderr) - - // Set user agent. - c.SetAppInfo("MinIO-go-FunctionalTest", appVersion) - // Generate a new random bucket name. bucketName := randString(60, rand.NewSource(time.Now().UnixNano()), "minio-go-test-") args["bucketName"] = bucketName @@ -2204,9 +2006,13 @@ func testPutObjectWithChecksums() { {cs: minio.ChecksumCRC32}, {cs: minio.ChecksumSHA1}, {cs: minio.ChecksumSHA256}, + {cs: minio.ChecksumCRC64NVME}, } for _, test := range tests { + if os.Getenv("MINT_NO_FULL_OBJECT") != "" && test.cs.FullObjectRequested() { + continue + } bufSize := dataFileMap["datafile-10-kB"] // Save the data @@ -2230,7 +2036,7 @@ func testPutObjectWithChecksums() { h := test.cs.Hasher() h.Reset() - // Test with Wrong CRC. + // Test with a bad CRC - we haven't called h.Write(b), so this is a checksum of empty data meta[test.cs.Key()] = base64.StdEncoding.EncodeToString(h.Sum(nil)) args["metadata"] = meta args["range"] = "false" @@ -2263,6 +2069,7 @@ func testPutObjectWithChecksums() { cmpChecksum(resp.ChecksumSHA1, meta["x-amz-checksum-sha1"]) cmpChecksum(resp.ChecksumCRC32, meta["x-amz-checksum-crc32"]) cmpChecksum(resp.ChecksumCRC32C, meta["x-amz-checksum-crc32c"]) + cmpChecksum(resp.ChecksumCRC64NVME, meta["x-amz-checksum-crc64nvme"]) // Read the data back gopts := minio.GetObjectOptions{Checksum: true} @@ -2282,6 +2089,7 @@ func testPutObjectWithChecksums() { cmpChecksum(st.ChecksumSHA1, meta["x-amz-checksum-sha1"]) cmpChecksum(st.ChecksumCRC32, meta["x-amz-checksum-crc32"]) cmpChecksum(st.ChecksumCRC32C, meta["x-amz-checksum-crc32c"]) + cmpChecksum(st.ChecksumCRC64NVME, meta["x-amz-checksum-crc64nvme"]) if st.Size != int64(bufSize) { logError(testName, function, args, startTime, "", "Number of bytes returned by PutObject does not match GetObject, expected "+string(bufSize)+" got "+string(st.Size), err) @@ -2325,12 +2133,12 @@ func testPutObjectWithChecksums() { cmpChecksum(st.ChecksumSHA1, "") cmpChecksum(st.ChecksumCRC32, "") cmpChecksum(st.ChecksumCRC32C, "") + cmpChecksum(st.ChecksumCRC64NVME, "") delete(args, "range") delete(args, "metadata") + logSuccess(testName, function, args, startTime) } - - logSuccess(testName, function, args, startTime) } // Test PutObject with custom checksums. @@ -2350,28 +2158,12 @@ func testPutObjectWithTrailingChecksums() { return } - // Seed random based on current time. - rand.Seed(time.Now().Unix()) - - // Instantiate new minio client object. - c, err := minio.New(os.Getenv(serverEndpoint), - &minio.Options{ - Creds: credentials.NewStaticV4(os.Getenv(accessKey), os.Getenv(secretKey), ""), - Transport: createHTTPTransport(), - Secure: mustParseBool(os.Getenv(enableHTTPS)), - TrailingHeaders: true, - }) + c, err := NewClient(ClientConfig{TrailingHeaders: true}) if err != nil { logError(testName, function, args, startTime, "", "MinIO client object creation failed", err) return } - // Enable tracing, write to stderr. - // c.TraceOn(os.Stderr) - - // Set user agent. - c.SetAppInfo("MinIO-go-FunctionalTest", appVersion) - // Generate a new random bucket name. bucketName := randString(60, rand.NewSource(time.Now().UnixNano()), "minio-go-test-") args["bucketName"] = bucketName @@ -2387,13 +2179,16 @@ func testPutObjectWithTrailingChecksums() { tests := []struct { cs minio.ChecksumType }{ + {cs: minio.ChecksumCRC64NVME}, {cs: minio.ChecksumCRC32C}, {cs: minio.ChecksumCRC32}, {cs: minio.ChecksumSHA1}, {cs: minio.ChecksumSHA256}, } - for _, test := range tests { + if os.Getenv("MINT_NO_FULL_OBJECT") != "" && test.cs.FullObjectRequested() { + continue + } function := "PutObject(bucketName, objectName, reader,size, opts)" bufSize := dataFileMap["datafile-10-kB"] @@ -2441,6 +2236,7 @@ func testPutObjectWithTrailingChecksums() { cmpChecksum(resp.ChecksumSHA1, meta["x-amz-checksum-sha1"]) cmpChecksum(resp.ChecksumCRC32, meta["x-amz-checksum-crc32"]) cmpChecksum(resp.ChecksumCRC32C, meta["x-amz-checksum-crc32c"]) + cmpChecksum(resp.ChecksumCRC64NVME, meta["x-amz-checksum-crc64nvme"]) // Read the data back gopts := minio.GetObjectOptions{Checksum: true} @@ -2461,6 +2257,7 @@ func testPutObjectWithTrailingChecksums() { cmpChecksum(st.ChecksumSHA1, meta["x-amz-checksum-sha1"]) cmpChecksum(st.ChecksumCRC32, meta["x-amz-checksum-crc32"]) cmpChecksum(st.ChecksumCRC32C, meta["x-amz-checksum-crc32c"]) + cmpChecksum(resp.ChecksumCRC64NVME, meta["x-amz-checksum-crc64nvme"]) if st.Size != int64(bufSize) { logError(testName, function, args, startTime, "", "Number of bytes returned by PutObject does not match GetObject, expected "+string(bufSize)+" got "+string(st.Size), err) @@ -2505,6 +2302,7 @@ func testPutObjectWithTrailingChecksums() { cmpChecksum(st.ChecksumSHA1, "") cmpChecksum(st.ChecksumCRC32, "") cmpChecksum(st.ChecksumCRC32C, "") + cmpChecksum(st.ChecksumCRC64NVME, "") function = "GetObjectAttributes(...)" s, err := c.GetObjectAttributes(context.Background(), bucketName, objectName, minio.ObjectAttributesOptions{}) @@ -2519,9 +2317,8 @@ func testPutObjectWithTrailingChecksums() { delete(args, "range") delete(args, "metadata") + logSuccess(testName, function, args, startTime) } - - logSuccess(testName, function, args, startTime) } // Test PutObject with custom checksums. @@ -2533,7 +2330,7 @@ func testPutMultipartObjectWithChecksums(trailing bool) { args := map[string]interface{}{ "bucketName": "", "objectName": "", - "opts": fmt.Sprintf("minio.PutObjectOptions{UserMetadata: metadata, Progress: progress Checksum: %v}", trailing), + "opts": fmt.Sprintf("minio.PutObjectOptions{UserMetadata: metadata, Trailing: %v}", trailing), } if !isFullMode() { @@ -2541,28 +2338,12 @@ func testPutMultipartObjectWithChecksums(trailing bool) { return } - // Seed random based on current time. - rand.Seed(time.Now().Unix()) - - // Instantiate new minio client object. - c, err := minio.New(os.Getenv(serverEndpoint), - &minio.Options{ - Creds: credentials.NewStaticV4(os.Getenv(accessKey), os.Getenv(secretKey), ""), - Transport: createHTTPTransport(), - Secure: mustParseBool(os.Getenv(enableHTTPS)), - TrailingHeaders: trailing, - }) + c, err := NewClient(ClientConfig{TrailingHeaders: trailing}) if err != nil { logError(testName, function, args, startTime, "", "MinIO client object creation failed", err) return } - // Enable tracing, write to stderr. - // c.TraceOn(os.Stderr) - - // Set user agent. - c.SetAppInfo("MinIO-go-FunctionalTest", appVersion) - // Generate a new random bucket name. bucketName := randString(60, rand.NewSource(time.Now().UnixNano()), "minio-go-test-") args["bucketName"] = bucketName @@ -2574,14 +2355,18 @@ func testPutMultipartObjectWithChecksums(trailing bool) { return } - hashMultiPart := func(b []byte, partSize int, hasher hash.Hash) string { + hashMultiPart := func(b []byte, partSize int, cs minio.ChecksumType) string { r := bytes.NewReader(b) + hasher := cs.Hasher() + if cs.FullObjectRequested() { + partSize = len(b) + } tmp := make([]byte, partSize) parts := 0 var all []byte for { n, err := io.ReadFull(r, tmp) - if err != nil && err != io.ErrUnexpectedEOF { + if err != nil && err != io.ErrUnexpectedEOF && err != io.EOF { logError(testName, function, args, startTime, "", "Calc crc failed", err) } if n == 0 { @@ -2595,6 +2380,9 @@ func testPutMultipartObjectWithChecksums(trailing bool) { break } } + if parts == 1 { + return base64.StdEncoding.EncodeToString(hasher.Sum(nil)) + } hasher.Reset() hasher.Write(all) return fmt.Sprintf("%s-%d", base64.StdEncoding.EncodeToString(hasher.Sum(nil)), parts) @@ -2603,6 +2391,9 @@ func testPutMultipartObjectWithChecksums(trailing bool) { tests := []struct { cs minio.ChecksumType }{ + {cs: minio.ChecksumFullObjectCRC32}, + {cs: minio.ChecksumFullObjectCRC32C}, + {cs: minio.ChecksumCRC64NVME}, {cs: minio.ChecksumCRC32C}, {cs: minio.ChecksumCRC32}, {cs: minio.ChecksumSHA1}, @@ -2610,8 +2401,12 @@ func testPutMultipartObjectWithChecksums(trailing bool) { } for _, test := range tests { - bufSize := dataFileMap["datafile-129-MB"] + if os.Getenv("MINT_NO_FULL_OBJECT") != "" && test.cs.FullObjectRequested() { + continue + } + args["section"] = "prep" + bufSize := dataFileMap["datafile-129-MB"] // Save the data objectName := randString(60, rand.NewSource(time.Now().UnixNano()), "") args["objectName"] = objectName @@ -2620,7 +2415,7 @@ func testPutMultipartObjectWithChecksums(trailing bool) { cmpChecksum := func(got, want string) { if want != got { logError(testName, function, args, startTime, "", "checksum mismatch", fmt.Errorf("want %s, got %s", want, got)) - //fmt.Printf("want %s, got %s\n", want, got) + // fmt.Printf("want %s, got %s\n", want, got) return } } @@ -2635,7 +2430,7 @@ func testPutMultipartObjectWithChecksums(trailing bool) { reader.Close() h := test.cs.Hasher() h.Reset() - want := hashMultiPart(b, partSize, test.cs.Hasher()) + want := hashMultiPart(b, partSize, test.cs) var cs minio.ChecksumType rd := io.Reader(io.NopCloser(bytes.NewReader(b))) @@ -2643,7 +2438,9 @@ func testPutMultipartObjectWithChecksums(trailing bool) { cs = test.cs rd = bytes.NewReader(b) } + // Set correct CRC. + args["section"] = "PutObject" resp, err := c.PutObject(context.Background(), bucketName, objectName, rd, int64(bufSize), minio.PutObjectOptions{ DisableContentSha256: true, DisableMultipart: false, @@ -2657,7 +2454,7 @@ func testPutMultipartObjectWithChecksums(trailing bool) { return } - switch test.cs { + switch test.cs.Base() { case minio.ChecksumCRC32C: cmpChecksum(resp.ChecksumCRC32C, want) case minio.ChecksumCRC32: @@ -2666,15 +2463,41 @@ func testPutMultipartObjectWithChecksums(trailing bool) { cmpChecksum(resp.ChecksumSHA1, want) case minio.ChecksumSHA256: cmpChecksum(resp.ChecksumSHA256, want) + case minio.ChecksumCRC64NVME: + cmpChecksum(resp.ChecksumCRC64NVME, want) } + args["section"] = "HeadObject" + st, err := c.StatObject(context.Background(), bucketName, objectName, minio.StatObjectOptions{Checksum: true}) + if err != nil { + logError(testName, function, args, startTime, "", "StatObject failed", err) + return + } + switch test.cs.Base() { + case minio.ChecksumCRC32C: + cmpChecksum(st.ChecksumCRC32C, want) + case minio.ChecksumCRC32: + cmpChecksum(st.ChecksumCRC32, want) + case minio.ChecksumSHA1: + cmpChecksum(st.ChecksumSHA1, want) + case minio.ChecksumSHA256: + cmpChecksum(st.ChecksumSHA256, want) + case minio.ChecksumCRC64NVME: + cmpChecksum(st.ChecksumCRC64NVME, want) + } + + args["section"] = "GetObjectAttributes" s, err := c.GetObjectAttributes(context.Background(), bucketName, objectName, minio.ObjectAttributesOptions{}) if err != nil { logError(testName, function, args, startTime, "", "GetObjectAttributes failed", err) return } - want = want[:strings.IndexByte(want, '-')] + + if strings.ContainsRune(want, '-') { + want = want[:strings.IndexByte(want, '-')] + } switch test.cs { + // Full Object CRC does not return anything with GetObjectAttributes case minio.ChecksumCRC32C: cmpChecksum(s.Checksum.ChecksumCRC32C, want) case minio.ChecksumCRC32: @@ -2690,13 +2513,14 @@ func testPutMultipartObjectWithChecksums(trailing bool) { gopts.PartNumber = 2 // We cannot use StatObject, since it ignores partnumber. + args["section"] = "GetObject-Part" r, err := c.GetObject(context.Background(), bucketName, objectName, gopts) if err != nil { logError(testName, function, args, startTime, "", "GetObject failed", err) return } io.Copy(io.Discard, r) - st, err := r.Stat() + st, err = r.Stat() if err != nil { logError(testName, function, args, startTime, "", "Stat failed", err) return @@ -2708,6 +2532,7 @@ func testPutMultipartObjectWithChecksums(trailing bool) { want = base64.StdEncoding.EncodeToString(h.Sum(nil)) switch test.cs { + // Full Object CRC does not return any part CRC for whatever reason. case minio.ChecksumCRC32C: cmpChecksum(st.ChecksumCRC32C, want) case minio.ChecksumCRC32: @@ -2716,12 +2541,17 @@ func testPutMultipartObjectWithChecksums(trailing bool) { cmpChecksum(st.ChecksumSHA1, want) case minio.ChecksumSHA256: cmpChecksum(st.ChecksumSHA256, want) + case minio.ChecksumCRC64NVME: + // AWS doesn't return part checksum, but may in the future. + if st.ChecksumCRC64NVME != "" { + cmpChecksum(st.ChecksumCRC64NVME, want) + } } delete(args, "metadata") + delete(args, "section") + logSuccess(testName, function, args, startTime) } - - logSuccess(testName, function, args, startTime) } // Test PutObject with trailing checksums. @@ -2741,25 +2571,12 @@ func testTrailingChecksums() { return } - // Instantiate new minio client object. - c, err := minio.New(os.Getenv(serverEndpoint), - &minio.Options{ - Creds: credentials.NewStaticV4(os.Getenv(accessKey), os.Getenv(secretKey), ""), - Transport: createHTTPTransport(), - Secure: mustParseBool(os.Getenv(enableHTTPS)), - TrailingHeaders: true, - }) + c, err := NewClient(ClientConfig{TrailingHeaders: true}) if err != nil { logError(testName, function, args, startTime, "", "MinIO client object creation failed", err) return } - // Enable tracing, write to stderr. - // c.TraceOn(os.Stderr) - - // Set user agent. - c.SetAppInfo("MinIO-go-FunctionalTest", appVersion) - // Generate a new random bucket name. bucketName := randString(60, rand.NewSource(time.Now().UnixNano()), "minio-go-test-") args["bucketName"] = bucketName @@ -2881,7 +2698,6 @@ func testTrailingChecksums() { test.ChecksumCRC32C = hashMultiPart(b, int(test.PO.PartSize), test.hasher) // Set correct CRC. - // c.TraceOn(os.Stderr) resp, err := c.PutObject(context.Background(), bucketName, objectName, bytes.NewReader(b), int64(bufSize), test.PO) if err != nil { logError(testName, function, args, startTime, "", "PutObject failed", err) @@ -2932,6 +2748,7 @@ func testTrailingChecksums() { } delete(args, "metadata") + logSuccess(testName, function, args, startTime) } } @@ -2952,25 +2769,12 @@ func testPutObjectWithAutomaticChecksums() { return } - // Seed random based on current time. - rand.Seed(time.Now().Unix()) - - // Instantiate new minio client object. - c, err := minio.New(os.Getenv(serverEndpoint), - &minio.Options{ - Creds: credentials.NewStaticV4(os.Getenv(accessKey), os.Getenv(secretKey), ""), - Transport: createHTTPTransport(), - Secure: mustParseBool(os.Getenv(enableHTTPS)), - TrailingHeaders: true, - }) + c, err := NewClient(ClientConfig{TrailingHeaders: true}) if err != nil { logError(testName, function, args, startTime, "", "MinIO client object creation failed", err) return } - // Set user agent. - c.SetAppInfo("MinIO-go-FunctionalTest", appVersion) - // Generate a new random bucket name. bucketName := randString(60, rand.NewSource(time.Now().UnixNano()), "minio-go-test-") args["bucketName"] = bucketName @@ -2997,8 +2801,6 @@ func testPutObjectWithAutomaticChecksums() { {header: "x-amz-checksum-crc32c", hasher: crc32.New(crc32.MakeTable(crc32.Castagnoli))}, } - // Enable tracing, write to stderr. - // c.TraceOn(os.Stderr) // defer c.TraceOff() for i, test := range tests { @@ -3108,20 +2910,12 @@ func testGetObjectAttributes() { return } - c, err := minio.New(os.Getenv(serverEndpoint), - &minio.Options{ - TrailingHeaders: true, - Creds: credentials.NewStaticV4(os.Getenv(accessKey), os.Getenv(secretKey), ""), - Transport: createHTTPTransport(), - Secure: mustParseBool(os.Getenv(enableHTTPS)), - }) + c, err := NewClient(ClientConfig{TrailingHeaders: true}) if err != nil { logError(testName, function, args, startTime, "", "MinIO client object creation failed", err) return } - c.SetAppInfo("MinIO-go-FunctionalTest", appVersion) - bucketName := randString(60, rand.NewSource(time.Now().UnixNano()), "minio-go-test-") args["bucketName"] = bucketName err = c.MakeBucket( @@ -3315,19 +3109,12 @@ func testGetObjectAttributesSSECEncryption() { return } - c, err := minio.New(os.Getenv(serverEndpoint), - &minio.Options{ - TrailingHeaders: true, - Creds: credentials.NewStaticV4(os.Getenv(accessKey), os.Getenv(secretKey), ""), - Secure: mustParseBool(os.Getenv(enableHTTPS)), - Transport: createHTTPTransport(), - }) + c, err := NewClient(ClientConfig{TrailingHeaders: true}) if err != nil { logError(testName, function, args, startTime, "", "MinIO client object creation failed", err) return } - c.SetAppInfo("MinIO-go-FunctionalTest", appVersion) bucketName := randString(60, rand.NewSource(time.Now().UnixNano()), "minio-go-test-") args["bucketName"] = bucketName err = c.MakeBucket( @@ -3401,19 +3188,12 @@ func testGetObjectAttributesErrorCases() { return } - c, err := minio.New(os.Getenv(serverEndpoint), - &minio.Options{ - TrailingHeaders: true, - Creds: credentials.NewStaticV4(os.Getenv(accessKey), os.Getenv(secretKey), ""), - Transport: createHTTPTransport(), - Secure: mustParseBool(os.Getenv(enableHTTPS)), - }) + c, err := NewClient(ClientConfig{TrailingHeaders: true}) if err != nil { logError(testName, function, args, startTime, "", "MinIO client object creation failed", err) return } - c.SetAppInfo("MinIO-go-FunctionalTest", appVersion) unknownBucket := randString(60, rand.NewSource(time.Now().UnixNano()), "minio-bucket-") unknownObject := randString(60, rand.NewSource(time.Now().UnixNano()), "minio-object-") @@ -3657,27 +3437,12 @@ func testPutObjectWithMetadata() { return } - // Seed random based on current time. - rand.Seed(time.Now().Unix()) - - // Instantiate new minio client object. - c, err := minio.New(os.Getenv(serverEndpoint), - &minio.Options{ - Creds: credentials.NewStaticV4(os.Getenv(accessKey), os.Getenv(secretKey), ""), - Transport: createHTTPTransport(), - Secure: mustParseBool(os.Getenv(enableHTTPS)), - }) + c, err := NewClient(ClientConfig{}) if err != nil { logError(testName, function, args, startTime, "", "MinIO client object creation failed", err) return } - // Enable tracing, write to stderr. - // c.TraceOn(os.Stderr) - - // Set user agent. - c.SetAppInfo("MinIO-go-FunctionalTest", appVersion) - // Generate a new random bucket name. bucketName := randString(60, rand.NewSource(time.Now().UnixNano()), "minio-go-test-") args["bucketName"] = bucketName @@ -3764,27 +3529,12 @@ func testPutObjectWithContentLanguage() { "opts": "", } - // Seed random based on current time. - rand.Seed(time.Now().Unix()) - - // Instantiate new minio client object. - c, err := minio.New(os.Getenv(serverEndpoint), - &minio.Options{ - Creds: credentials.NewStaticV4(os.Getenv(accessKey), os.Getenv(secretKey), ""), - Transport: createHTTPTransport(), - Secure: mustParseBool(os.Getenv(enableHTTPS)), - }) + c, err := NewClient(ClientConfig{}) if err != nil { logError(testName, function, args, startTime, "", "MinIO client object creation failed", err) return } - // Enable tracing, write to stderr. - // c.TraceOn(os.Stderr) - - // Set user agent. - c.SetAppInfo("MinIO-go-FunctionalTest", appVersion) - // Generate a new random bucket name. bucketName := randString(60, rand.NewSource(time.Now().UnixNano()), "minio-go-test-") args["bucketName"] = bucketName @@ -3834,27 +3584,12 @@ func testPutObjectStreaming() { "opts": "", } - // Seed random based on current time. - rand.Seed(time.Now().Unix()) - - // Instantiate new minio client object. - c, err := minio.New(os.Getenv(serverEndpoint), - &minio.Options{ - Creds: credentials.NewStaticV4(os.Getenv(accessKey), os.Getenv(secretKey), ""), - Transport: createHTTPTransport(), - Secure: mustParseBool(os.Getenv(enableHTTPS)), - }) + c, err := NewClient(ClientConfig{}) if err != nil { logError(testName, function, args, startTime, "", "MinIO client object creation failed", err) return } - // Enable tracing, write to stderr. - // c.TraceOn(os.Stderr) - - // Set user agent. - c.SetAppInfo("MinIO-go-FunctionalTest", appVersion) - // Generate a new random bucket name. bucketName := randString(60, rand.NewSource(time.Now().UnixNano()), "minio-go-test-") args["bucketName"] = bucketName @@ -3906,27 +3641,12 @@ func testGetObjectSeekEnd() { function := "GetObject(bucketName, objectName)" args := map[string]interface{}{} - // Seed random based on current time. - rand.Seed(time.Now().Unix()) - - // Instantiate new minio client object. - c, err := minio.New(os.Getenv(serverEndpoint), - &minio.Options{ - Creds: credentials.NewStaticV4(os.Getenv(accessKey), os.Getenv(secretKey), ""), - Transport: createHTTPTransport(), - Secure: mustParseBool(os.Getenv(enableHTTPS)), - }) + c, err := NewClient(ClientConfig{}) if err != nil { logError(testName, function, args, startTime, "", "MinIO client object creation failed", err) return } - // Enable tracing, write to stderr. - // c.TraceOn(os.Stderr) - - // Set user agent. - c.SetAppInfo("MinIO-go-FunctionalTest", appVersion) - // Generate a new random bucket name. bucketName := randString(60, rand.NewSource(time.Now().UnixNano()), "minio-go-test-") args["bucketName"] = bucketName @@ -4029,27 +3749,12 @@ func testGetObjectClosedTwice() { function := "GetObject(bucketName, objectName)" args := map[string]interface{}{} - // Seed random based on current time. - rand.Seed(time.Now().Unix()) - - // Instantiate new minio client object. - c, err := minio.New(os.Getenv(serverEndpoint), - &minio.Options{ - Creds: credentials.NewStaticV4(os.Getenv(accessKey), os.Getenv(secretKey), ""), - Transport: createHTTPTransport(), - Secure: mustParseBool(os.Getenv(enableHTTPS)), - }) + c, err := NewClient(ClientConfig{}) if err != nil { logError(testName, function, args, startTime, "", "MinIO client object creation failed", err) return } - // Enable tracing, write to stderr. - // c.TraceOn(os.Stderr) - - // Set user agent. - c.SetAppInfo("MinIO-go-FunctionalTest", appVersion) - // Generate a new random bucket name. bucketName := randString(60, rand.NewSource(time.Now().UnixNano()), "minio-go-test-") args["bucketName"] = bucketName @@ -4120,26 +3825,13 @@ func testRemoveObjectsContext() { "bucketName": "", } - // Seed random based on current tie. - rand.Seed(time.Now().Unix()) - // Instantiate new minio client. - c, err := minio.New(os.Getenv(serverEndpoint), - &minio.Options{ - Creds: credentials.NewStaticV4(os.Getenv(accessKey), os.Getenv(secretKey), ""), - Transport: createHTTPTransport(), - Secure: mustParseBool(os.Getenv(enableHTTPS)), - }) + c, err := NewClient(ClientConfig{}) if err != nil { logError(testName, function, args, startTime, "", "MinIO client object creation failed", err) return } - // Set user agent. - c.SetAppInfo("MinIO-go-FunctionalTest", appVersion) - // Enable tracing, write to stdout. - // c.TraceOn(os.Stderr) - // Generate a new random bucket name. bucketName := randString(60, rand.NewSource(time.Now().UnixNano()), "minio-go-test-") args["bucketName"] = bucketName @@ -4217,27 +3909,12 @@ func testRemoveMultipleObjects() { "bucketName": "", } - // Seed random based on current time. - rand.Seed(time.Now().Unix()) - - // Instantiate new minio client object. - c, err := minio.New(os.Getenv(serverEndpoint), - &minio.Options{ - Creds: credentials.NewStaticV4(os.Getenv(accessKey), os.Getenv(secretKey), ""), - Transport: createHTTPTransport(), - Secure: mustParseBool(os.Getenv(enableHTTPS)), - }) + c, err := NewClient(ClientConfig{}) if err != nil { logError(testName, function, args, startTime, "", "MinIO client object creation failed", err) return } - // Set user agent. - c.SetAppInfo("MinIO-go-FunctionalTest", appVersion) - - // Enable tracing, write to stdout. - // c.TraceOn(os.Stderr) - // Generate a new random bucket name. bucketName := randString(60, rand.NewSource(time.Now().UnixNano()), "minio-go-test-") args["bucketName"] = bucketName @@ -4301,27 +3978,12 @@ func testRemoveMultipleObjectsWithResult() { "bucketName": "", } - // Seed random based on current time. - rand.Seed(time.Now().Unix()) - - // Instantiate new minio client object. - c, err := minio.New(os.Getenv(serverEndpoint), - &minio.Options{ - Creds: credentials.NewStaticV4(os.Getenv(accessKey), os.Getenv(secretKey), ""), - Transport: createHTTPTransport(), - Secure: mustParseBool(os.Getenv(enableHTTPS)), - }) + c, err := NewClient(ClientConfig{}) if err != nil { logError(testName, function, args, startTime, "", "MinIO client object creation failed", err) return } - // Set user agent. - c.SetAppInfo("MinIO-go-FunctionalTest", appVersion) - - // Enable tracing, write to stdout. - // c.TraceOn(os.Stderr) - // Generate a new random bucket name. bucketName := randString(60, rand.NewSource(time.Now().UnixNano()), "minio-go-test-") args["bucketName"] = bucketName @@ -4437,27 +4099,12 @@ func testFPutObjectMultipart() { "opts": "", } - // Seed random based on current time. - rand.Seed(time.Now().Unix()) - - // Instantiate new minio client object. - c, err := minio.New(os.Getenv(serverEndpoint), - &minio.Options{ - Creds: credentials.NewStaticV4(os.Getenv(accessKey), os.Getenv(secretKey), ""), - Transport: createHTTPTransport(), - Secure: mustParseBool(os.Getenv(enableHTTPS)), - }) + c, err := NewClient(ClientConfig{}) if err != nil { logError(testName, function, args, startTime, "", "MinIO client object creation failed", err) return } - // Enable tracing, write to stderr. - // c.TraceOn(os.Stderr) - - // Set user agent. - c.SetAppInfo("MinIO-go-FunctionalTest", appVersion) - // Generate a new random bucket name. bucketName := randString(60, rand.NewSource(time.Now().UnixNano()), "minio-go-test-") args["bucketName"] = bucketName @@ -4543,27 +4190,12 @@ func testFPutObject() { "opts": "", } - // Seed random based on current time. - rand.Seed(time.Now().Unix()) - - // Instantiate new minio client object. - c, err := minio.New(os.Getenv(serverEndpoint), - &minio.Options{ - Creds: credentials.NewStaticV4(os.Getenv(accessKey), os.Getenv(secretKey), ""), - Transport: createHTTPTransport(), - Secure: mustParseBool(os.Getenv(enableHTTPS)), - }) + c, err := NewClient(ClientConfig{}) if err != nil { logError(testName, function, args, startTime, "", "MinIO client object creation failed", err) return } - // Enable tracing, write to stderr. - // c.TraceOn(os.Stderr) - - // Set user agent. - c.SetAppInfo("MinIO-go-FunctionalTest", appVersion) - // Generate a new random bucket name. bucketName := randString(60, rand.NewSource(time.Now().UnixNano()), "minio-go-test-") location := "us-east-1" @@ -4713,27 +4345,13 @@ func testFPutObjectContext() { "fileName": "", "opts": "", } - // Seed random based on current time. - rand.Seed(time.Now().Unix()) - // Instantiate new minio client object. - c, err := minio.New(os.Getenv(serverEndpoint), - &minio.Options{ - Creds: credentials.NewStaticV4(os.Getenv(accessKey), os.Getenv(secretKey), ""), - Transport: createHTTPTransport(), - Secure: mustParseBool(os.Getenv(enableHTTPS)), - }) + c, err := NewClient(ClientConfig{}) if err != nil { logError(testName, function, args, startTime, "", "MinIO client object creation failed", err) return } - // Enable tracing, write to stderr. - // c.TraceOn(os.Stderr) - - // Set user agent. - c.SetAppInfo("MinIO-go-FunctionalTest", appVersion) - // Generate a new random bucket name. bucketName := randString(60, rand.NewSource(time.Now().UnixNano()), "minio-go-test-") args["bucketName"] = bucketName @@ -4814,27 +4432,13 @@ func testFPutObjectContextV2() { "objectName": "", "opts": "minio.PutObjectOptions{ContentType:objectContentType}", } - // Seed random based on current time. - rand.Seed(time.Now().Unix()) - // Instantiate new minio client object. - c, err := minio.New(os.Getenv(serverEndpoint), - &minio.Options{ - Creds: credentials.NewStaticV2(os.Getenv(accessKey), os.Getenv(secretKey), ""), - Transport: createHTTPTransport(), - Secure: mustParseBool(os.Getenv(enableHTTPS)), - }) + c, err := NewClient(ClientConfig{CredsV2: true}) if err != nil { logError(testName, function, args, startTime, "", "MinIO client object creation failed", err) return } - // Enable tracing, write to stderr. - // c.TraceOn(os.Stderr) - - // Set user agent. - c.SetAppInfo("MinIO-go-FunctionalTest", appVersion) - // Generate a new random bucket name. bucketName := randString(60, rand.NewSource(time.Now().UnixNano()), "minio-go-test-") args["bucketName"] = bucketName @@ -4919,24 +4523,12 @@ func testPutObjectContext() { "opts": "", } - // Instantiate new minio client object. - c, err := minio.New(os.Getenv(serverEndpoint), - &minio.Options{ - Creds: credentials.NewStaticV4(os.Getenv(accessKey), os.Getenv(secretKey), ""), - Transport: createHTTPTransport(), - Secure: mustParseBool(os.Getenv(enableHTTPS)), - }) + c, err := NewClient(ClientConfig{}) if err != nil { logError(testName, function, args, startTime, "", "MinIO client object creation failed", err) return } - // Enable tracing, write to stderr. - // c.TraceOn(os.Stderr) - - // Set user agent. - c.SetAppInfo("MinIO-go-FunctionalTest", appVersion) - // Make a new bucket. bucketName := randString(60, rand.NewSource(time.Now().UnixNano()), "minio-go-test-") args["bucketName"] = bucketName @@ -4989,27 +4581,12 @@ func testGetObjectS3Zip() { function := "GetObject(bucketName, objectName)" args := map[string]interface{}{"x-minio-extract": true} - // Seed random based on current time. - rand.Seed(time.Now().Unix()) - - // Instantiate new minio client object. - c, err := minio.New(os.Getenv(serverEndpoint), - &minio.Options{ - Creds: credentials.NewStaticV4(os.Getenv(accessKey), os.Getenv(secretKey), ""), - Transport: createHTTPTransport(), - Secure: mustParseBool(os.Getenv(enableHTTPS)), - }) + c, err := NewClient(ClientConfig{}) if err != nil { logError(testName, function, args, startTime, "", "MinIO client object creation failed", err) return } - // Enable tracing, write to stderr. - // c.TraceOn(os.Stderr) - - // Set user agent. - c.SetAppInfo("MinIO-go-FunctionalTest", appVersion) - // Generate a new random bucket name. bucketName := randString(60, rand.NewSource(time.Now().UnixNano()), "minio-go-test-") args["bucketName"] = bucketName @@ -5173,27 +4750,12 @@ func testGetObjectReadSeekFunctional() { function := "GetObject(bucketName, objectName)" args := map[string]interface{}{} - // Seed random based on current time. - rand.Seed(time.Now().Unix()) - - // Instantiate new minio client object. - c, err := minio.New(os.Getenv(serverEndpoint), - &minio.Options{ - Creds: credentials.NewStaticV4(os.Getenv(accessKey), os.Getenv(secretKey), ""), - Transport: createHTTPTransport(), - Secure: mustParseBool(os.Getenv(enableHTTPS)), - }) + c, err := NewClient(ClientConfig{}) if err != nil { logError(testName, function, args, startTime, "", "MinIO client object creation failed", err) return } - // Enable tracing, write to stderr. - // c.TraceOn(os.Stderr) - - // Set user agent. - c.SetAppInfo("MinIO-go-FunctionalTest", appVersion) - // Generate a new random bucket name. bucketName := randString(60, rand.NewSource(time.Now().UnixNano()), "minio-go-test-") args["bucketName"] = bucketName @@ -5343,27 +4905,12 @@ func testGetObjectReadAtFunctional() { function := "GetObject(bucketName, objectName)" args := map[string]interface{}{} - // Seed random based on current time. - rand.Seed(time.Now().Unix()) - - // Instantiate new minio client object. - c, err := minio.New(os.Getenv(serverEndpoint), - &minio.Options{ - Creds: credentials.NewStaticV4(os.Getenv(accessKey), os.Getenv(secretKey), ""), - Transport: createHTTPTransport(), - Secure: mustParseBool(os.Getenv(enableHTTPS)), - }) + c, err := NewClient(ClientConfig{}) if err != nil { logError(testName, function, args, startTime, "", "MinIO client object creation failed", err) return } - // Enable tracing, write to stderr. - // c.TraceOn(os.Stderr) - - // Set user agent. - c.SetAppInfo("MinIO-go-FunctionalTest", appVersion) - // Generate a new random bucket name. bucketName := randString(60, rand.NewSource(time.Now().UnixNano()), "minio-go-test-") args["bucketName"] = bucketName @@ -5521,27 +5068,12 @@ func testGetObjectReadAtWhenEOFWasReached() { function := "GetObject(bucketName, objectName)" args := map[string]interface{}{} - // Seed random based on current time. - rand.Seed(time.Now().Unix()) - - // Instantiate new minio client object. - c, err := minio.New(os.Getenv(serverEndpoint), - &minio.Options{ - Creds: credentials.NewStaticV4(os.Getenv(accessKey), os.Getenv(secretKey), ""), - Transport: createHTTPTransport(), - Secure: mustParseBool(os.Getenv(enableHTTPS)), - }) + c, err := NewClient(ClientConfig{}) if err != nil { logError(testName, function, args, startTime, "", "MinIO client object creation failed", err) return } - // Enable tracing, write to stderr. - // c.TraceOn(os.Stderr) - - // Set user agent. - c.SetAppInfo("MinIO-go-FunctionalTest", appVersion) - // Generate a new random bucket name. bucketName := randString(60, rand.NewSource(time.Now().UnixNano()), "minio-go-test-") args["bucketName"] = bucketName @@ -5641,27 +5173,12 @@ func testPresignedPostPolicy() { "policy": "", } - // Seed random based on current time. - rand.Seed(time.Now().Unix()) - - // Instantiate new minio client object - c, err := minio.New(os.Getenv(serverEndpoint), - &minio.Options{ - Creds: credentials.NewStaticV4(os.Getenv(accessKey), os.Getenv(secretKey), ""), - Transport: createHTTPTransport(), - Secure: mustParseBool(os.Getenv(enableHTTPS)), - }) + c, err := NewClient(ClientConfig{}) if err != nil { logError(testName, function, args, startTime, "", "MinIO client object creation failed", err) return } - // Enable tracing, write to stderr. - // c.TraceOn(os.Stderr) - - // Set user agent. - c.SetAppInfo("MinIO-go-FunctionalTest", appVersion) - // Generate a new random bucket name. bucketName := randString(60, rand.NewSource(time.Now().UnixNano()), "minio-go-test-") @@ -5689,50 +5206,22 @@ func testPresignedPostPolicy() { return } - // Save the data - _, err = c.PutObject(context.Background(), bucketName, objectName, bytes.NewReader(buf), int64(len(buf)), minio.PutObjectOptions{ContentType: "binary/octet-stream"}) - if err != nil { - logError(testName, function, args, startTime, "", "PutObject failed", err) - return - } - policy := minio.NewPostPolicy() - - if err := policy.SetBucket(""); err == nil { - logError(testName, function, args, startTime, "", "SetBucket did not fail for invalid conditions", err) - return - } - if err := policy.SetKey(""); err == nil { - logError(testName, function, args, startTime, "", "SetKey did not fail for invalid conditions", err) - return - } - if err := policy.SetExpires(time.Date(1, time.January, 1, 0, 0, 0, 0, time.UTC)); err == nil { - logError(testName, function, args, startTime, "", "SetExpires did not fail for invalid conditions", err) - return - } - if err := policy.SetContentType(""); err == nil { - logError(testName, function, args, startTime, "", "SetContentType did not fail for invalid conditions", err) - return - } - if err := policy.SetContentLengthRange(1024*1024, 1024); err == nil { - logError(testName, function, args, startTime, "", "SetContentLengthRange did not fail for invalid conditions", err) - return - } - if err := policy.SetUserMetadata("", ""); err == nil { - logError(testName, function, args, startTime, "", "SetUserMetadata did not fail for invalid conditions", err) - return - } - policy.SetBucket(bucketName) policy.SetKey(objectName) policy.SetExpires(time.Now().UTC().AddDate(0, 0, 10)) // expires in 10 days policy.SetContentType("binary/octet-stream") policy.SetContentLengthRange(10, 1024*1024) policy.SetUserMetadata(metadataKey, metadataValue) + policy.SetContentEncoding("gzip") // Add CRC32C checksum := minio.ChecksumCRC32C.ChecksumBytes(buf) - policy.SetChecksum(checksum) + err = policy.SetChecksum(checksum) + if err != nil { + logError(testName, function, args, startTime, "", "SetChecksum failed", err) + return + } args["policy"] = policy.String() @@ -5828,7 +5317,7 @@ func testPresignedPostPolicy() { expectedLocation := scheme + os.Getenv(serverEndpoint) + "/" + bucketName + "/" + objectName expectedLocationBucketDNS := scheme + bucketName + "." + os.Getenv(serverEndpoint) + "/" + objectName - if !strings.Contains(expectedLocation, "s3.amazonaws.com/") { + if !strings.Contains(expectedLocation, ".amazonaws.com/") { // Test when not against AWS S3. if val, ok := res.Header["Location"]; ok { if val[0] != expectedLocation && val[0] != expectedLocationBucketDNS { @@ -5840,9 +5329,184 @@ func testPresignedPostPolicy() { return } } - want := checksum.Encoded() - if got := res.Header.Get("X-Amz-Checksum-Crc32c"); got != want { - logError(testName, function, args, startTime, "", fmt.Sprintf("Want checksum %q, got %q", want, got), nil) + wantChecksumCrc32c := checksum.Encoded() + if got := res.Header.Get("X-Amz-Checksum-Crc32c"); got != wantChecksumCrc32c { + logError(testName, function, args, startTime, "", fmt.Sprintf("Want checksum %q, got %q", wantChecksumCrc32c, got), nil) + return + } + + // Ensure that when we subsequently GetObject, the checksum is returned + gopts := minio.GetObjectOptions{Checksum: true} + r, err := c.GetObject(context.Background(), bucketName, objectName, gopts) + if err != nil { + logError(testName, function, args, startTime, "", "GetObject failed", err) + return + } + st, err := r.Stat() + if err != nil { + logError(testName, function, args, startTime, "", "Stat failed", err) + return + } + if st.ChecksumCRC32C != wantChecksumCrc32c { + logError(testName, function, args, startTime, "", fmt.Sprintf("Want checksum %s, got %s", wantChecksumCrc32c, st.ChecksumCRC32C), nil) + return + } + + logSuccess(testName, function, args, startTime) +} + +// testPresignedPostPolicyWrongFile tests that when we have a policy with a checksum, we cannot POST the wrong file +func testPresignedPostPolicyWrongFile() { + // initialize logging params + startTime := time.Now() + testName := getFuncName() + function := "PresignedPostPolicy(policy)" + args := map[string]interface{}{ + "policy": "", + } + + c, err := NewClient(ClientConfig{}) + if err != nil { + logError(testName, function, args, startTime, "", "MinIO client object creation failed", err) + return + } + + // Generate a new random bucket name. + bucketName := randString(60, rand.NewSource(time.Now().UnixNano()), "minio-go-test-") + + // Make a new bucket in 'us-east-1' (source bucket). + err = c.MakeBucket(context.Background(), bucketName, minio.MakeBucketOptions{Region: "us-east-1"}) + if err != nil { + logError(testName, function, args, startTime, "", "MakeBucket failed", err) + return + } + + defer cleanupBucket(bucketName, c) + + objectName := randString(60, rand.NewSource(time.Now().UnixNano()), "") + // Azure requires the key to not start with a number + metadataKey := randString(60, rand.NewSource(time.Now().UnixNano()), "user") + metadataValue := randString(60, rand.NewSource(time.Now().UnixNano()), "") + + policy := minio.NewPostPolicy() + policy.SetBucket(bucketName) + policy.SetKey(objectName) + policy.SetExpires(time.Now().UTC().AddDate(0, 0, 10)) // expires in 10 days + policy.SetContentType("binary/octet-stream") + policy.SetContentLengthRange(10, 1024*1024) + policy.SetUserMetadata(metadataKey, metadataValue) + + // Add CRC32C of some data that the policy will explicitly allow. + checksum := minio.ChecksumCRC32C.ChecksumBytes([]byte{0x01, 0x02, 0x03}) + err = policy.SetChecksum(checksum) + if err != nil { + logError(testName, function, args, startTime, "", "SetChecksum failed", err) + return + } + + args["policy"] = policy.String() + + presignedPostPolicyURL, formData, err := c.PresignedPostPolicy(context.Background(), policy) + if err != nil { + logError(testName, function, args, startTime, "", "PresignedPostPolicy failed", err) + return + } + + // At this stage, we have a policy that allows us to upload for a specific checksum. + // Test that uploading datafile-10-kB, with a different checksum, fails as expected + filePath := getMintDataDirFilePath("datafile-10-kB") + if filePath == "" { + // Make a temp file with 10 KB data. + file, err := os.CreateTemp(os.TempDir(), "PresignedPostPolicyTest") + if err != nil { + logError(testName, function, args, startTime, "", "TempFile creation failed", err) + return + } + if _, err = io.Copy(file, getDataReader("datafile-10-kB")); err != nil { + logError(testName, function, args, startTime, "", "Copy failed", err) + return + } + if err = file.Close(); err != nil { + logError(testName, function, args, startTime, "", "File Close failed", err) + return + } + filePath = file.Name() + } + fileReader := getDataReader("datafile-10-kB") + defer fileReader.Close() + buf10k, err := io.ReadAll(fileReader) + if err != nil { + logError(testName, function, args, startTime, "", "ReadAll failed", err) + return + } + otherChecksum := minio.ChecksumCRC32C.ChecksumBytes(buf10k) + + var formBuf bytes.Buffer + writer := multipart.NewWriter(&formBuf) + for k, v := range formData { + if k == "x-amz-checksum-crc32c" { + v = otherChecksum.Encoded() + } + writer.WriteField(k, v) + } + + // Add file to post request + f, err := os.Open(filePath) + defer f.Close() + if err != nil { + logError(testName, function, args, startTime, "", "File open failed", err) + return + } + w, err := writer.CreateFormFile("file", filePath) + if err != nil { + logError(testName, function, args, startTime, "", "CreateFormFile failed", err) + return + } + _, err = io.Copy(w, f) + if err != nil { + logError(testName, function, args, startTime, "", "Copy failed", err) + return + } + writer.Close() + + httpClient := &http.Client{ + Timeout: 30 * time.Second, + Transport: createHTTPTransport(), + } + args["url"] = presignedPostPolicyURL.String() + + req, err := http.NewRequest(http.MethodPost, presignedPostPolicyURL.String(), bytes.NewReader(formBuf.Bytes())) + if err != nil { + logError(testName, function, args, startTime, "", "HTTP request failed", err) + return + } + + req.Header.Set("Content-Type", writer.FormDataContentType()) + + // Make the POST request with the form data. + res, err := httpClient.Do(req) + if err != nil { + logError(testName, function, args, startTime, "", "HTTP request failed", err) + return + } + defer res.Body.Close() + if res.StatusCode != http.StatusForbidden { + logError(testName, function, args, startTime, "", "HTTP request unexpected status", errors.New(res.Status)) + return + } + + // Read the response body, ensure it has checksum failure message + resBody, err := io.ReadAll(res.Body) + if err != nil { + logError(testName, function, args, startTime, "", "ReadAll failed", err) + return + } + + // Normalize the response body, because S3 uses quotes around the policy condition components + // in the error message, MinIO does not. + resBodyStr := strings.ReplaceAll(string(resBody), `"`, "") + if !strings.Contains(resBodyStr, "Policy Condition failed: [eq, $x-amz-checksum-crc32c, 8TDyHg=") { + logError(testName, function, args, startTime, "", "Unexpected response body", errors.New(resBodyStr)) return } @@ -5857,27 +5521,12 @@ func testCopyObject() { function := "CopyObject(dst, src)" args := map[string]interface{}{} - // Seed random based on current time. - rand.Seed(time.Now().Unix()) - - // Instantiate new minio client object - c, err := minio.New(os.Getenv(serverEndpoint), - &minio.Options{ - Creds: credentials.NewStaticV4(os.Getenv(accessKey), os.Getenv(secretKey), ""), - Transport: createHTTPTransport(), - Secure: mustParseBool(os.Getenv(enableHTTPS)), - }) + c, err := NewClient(ClientConfig{}) if err != nil { logError(testName, function, args, startTime, "", "MinIO client object creation failed", err) return } - // Enable tracing, write to stderr. - // c.TraceOn(os.Stderr) - - // Set user agent. - c.SetAppInfo("MinIO-go-FunctionalTest", appVersion) - // Generate a new random bucket name. bucketName := randString(60, rand.NewSource(time.Now().UnixNano()), "minio-go-test-") @@ -6052,27 +5701,12 @@ func testSSECEncryptedGetObjectReadSeekFunctional() { function := "GetObject(bucketName, objectName)" args := map[string]interface{}{} - // Seed random based on current time. - rand.Seed(time.Now().Unix()) - - // Instantiate new minio client object. - c, err := minio.New(os.Getenv(serverEndpoint), - &minio.Options{ - Creds: credentials.NewStaticV4(os.Getenv(accessKey), os.Getenv(secretKey), ""), - Transport: createHTTPTransport(), - Secure: mustParseBool(os.Getenv(enableHTTPS)), - }) + c, err := NewClient(ClientConfig{}) if err != nil { logError(testName, function, args, startTime, "", "MinIO client object creation failed", err) return } - // Enable tracing, write to stderr. - // c.TraceOn(os.Stderr) - - // Set user agent. - c.SetAppInfo("MinIO-go-FunctionalTest", appVersion) - // Generate a new random bucket name. bucketName := randString(60, rand.NewSource(time.Now().UnixNano()), "minio-go-test-") args["bucketName"] = bucketName @@ -6235,27 +5869,12 @@ func testSSES3EncryptedGetObjectReadSeekFunctional() { function := "GetObject(bucketName, objectName)" args := map[string]interface{}{} - // Seed random based on current time. - rand.Seed(time.Now().Unix()) - - // Instantiate new minio client object. - c, err := minio.New(os.Getenv(serverEndpoint), - &minio.Options{ - Creds: credentials.NewStaticV4(os.Getenv(accessKey), os.Getenv(secretKey), ""), - Transport: createHTTPTransport(), - Secure: mustParseBool(os.Getenv(enableHTTPS)), - }) + c, err := NewClient(ClientConfig{}) if err != nil { logError(testName, function, args, startTime, "", "MinIO client object creation failed", err) return } - // Enable tracing, write to stderr. - // c.TraceOn(os.Stderr) - - // Set user agent. - c.SetAppInfo("MinIO-go-FunctionalTest", appVersion) - // Generate a new random bucket name. bucketName := randString(60, rand.NewSource(time.Now().UnixNano()), "minio-go-test-") args["bucketName"] = bucketName @@ -6416,27 +6035,12 @@ func testSSECEncryptedGetObjectReadAtFunctional() { function := "GetObject(bucketName, objectName)" args := map[string]interface{}{} - // Seed random based on current time. - rand.Seed(time.Now().Unix()) - - // Instantiate new minio client object. - c, err := minio.New(os.Getenv(serverEndpoint), - &minio.Options{ - Creds: credentials.NewStaticV4(os.Getenv(accessKey), os.Getenv(secretKey), ""), - Transport: createHTTPTransport(), - Secure: mustParseBool(os.Getenv(enableHTTPS)), - }) + c, err := NewClient(ClientConfig{}) if err != nil { logError(testName, function, args, startTime, "", "MinIO client object creation failed", err) return } - // Enable tracing, write to stderr. - // c.TraceOn(os.Stderr) - - // Set user agent. - c.SetAppInfo("MinIO-go-FunctionalTest", appVersion) - // Generate a new random bucket name. bucketName := randString(60, rand.NewSource(time.Now().UnixNano()), "minio-go-test-") args["bucketName"] = bucketName @@ -6600,27 +6204,12 @@ func testSSES3EncryptedGetObjectReadAtFunctional() { function := "GetObject(bucketName, objectName)" args := map[string]interface{}{} - // Seed random based on current time. - rand.Seed(time.Now().Unix()) - - // Instantiate new minio client object. - c, err := minio.New(os.Getenv(serverEndpoint), - &minio.Options{ - Creds: credentials.NewStaticV4(os.Getenv(accessKey), os.Getenv(secretKey), ""), - Transport: createHTTPTransport(), - Secure: mustParseBool(os.Getenv(enableHTTPS)), - }) + c, err := NewClient(ClientConfig{}) if err != nil { logError(testName, function, args, startTime, "", "MinIO client object creation failed", err) return } - // Enable tracing, write to stderr. - // c.TraceOn(os.Stderr) - - // Set user agent. - c.SetAppInfo("MinIO-go-FunctionalTest", appVersion) - // Generate a new random bucket name. bucketName := randString(60, rand.NewSource(time.Now().UnixNano()), "minio-go-test-") args["bucketName"] = bucketName @@ -6785,27 +6374,13 @@ func testSSECEncryptionPutGet() { "objectName": "", "sse": "", } - // Seed random based on current time. - rand.Seed(time.Now().Unix()) - // Instantiate new minio client object - c, err := minio.New(os.Getenv(serverEndpoint), - &minio.Options{ - Creds: credentials.NewStaticV4(os.Getenv(accessKey), os.Getenv(secretKey), ""), - Transport: createHTTPTransport(), - Secure: mustParseBool(os.Getenv(enableHTTPS)), - }) + c, err := NewClient(ClientConfig{}) if err != nil { logError(testName, function, args, startTime, "", "MinIO client object creation failed", err) return } - // Enable tracing, write to stderr. - // c.TraceOn(os.Stderr) - - // Set user agent. - c.SetAppInfo("MinIO-go-FunctionalTest", appVersion) - // Generate a new random bucket name. bucketName := randString(60, rand.NewSource(time.Now().UnixNano()), "minio-go-test-") args["bucketName"] = bucketName @@ -6895,27 +6470,13 @@ func testSSECEncryptionFPut() { "contentType": "", "sse": "", } - // Seed random based on current time. - rand.Seed(time.Now().Unix()) - // Instantiate new minio client object - c, err := minio.New(os.Getenv(serverEndpoint), - &minio.Options{ - Creds: credentials.NewStaticV4(os.Getenv(accessKey), os.Getenv(secretKey), ""), - Transport: createHTTPTransport(), - Secure: mustParseBool(os.Getenv(enableHTTPS)), - }) + c, err := NewClient(ClientConfig{}) if err != nil { logError(testName, function, args, startTime, "", "MinIO client object creation failed", err) return } - // Enable tracing, write to stderr. - // c.TraceOn(os.Stderr) - - // Set user agent. - c.SetAppInfo("MinIO-go-FunctionalTest", appVersion) - // Generate a new random bucket name. bucketName := randString(60, rand.NewSource(time.Now().UnixNano()), "minio-go-test-") args["bucketName"] = bucketName @@ -7018,27 +6579,13 @@ func testSSES3EncryptionPutGet() { "objectName": "", "sse": "", } - // Seed random based on current time. - rand.Seed(time.Now().Unix()) - // Instantiate new minio client object - c, err := minio.New(os.Getenv(serverEndpoint), - &minio.Options{ - Creds: credentials.NewStaticV4(os.Getenv(accessKey), os.Getenv(secretKey), ""), - Transport: createHTTPTransport(), - Secure: mustParseBool(os.Getenv(enableHTTPS)), - }) + c, err := NewClient(ClientConfig{}) if err != nil { logError(testName, function, args, startTime, "", "MinIO client object creation failed", err) return } - // Enable tracing, write to stderr. - // c.TraceOn(os.Stderr) - - // Set user agent. - c.SetAppInfo("MinIO-go-FunctionalTest", appVersion) - // Generate a new random bucket name. bucketName := randString(60, rand.NewSource(time.Now().UnixNano()), "minio-go-test-") args["bucketName"] = bucketName @@ -7126,27 +6673,13 @@ func testSSES3EncryptionFPut() { "contentType": "", "sse": "", } - // Seed random based on current time. - rand.Seed(time.Now().Unix()) - // Instantiate new minio client object - c, err := minio.New(os.Getenv(serverEndpoint), - &minio.Options{ - Creds: credentials.NewStaticV4(os.Getenv(accessKey), os.Getenv(secretKey), ""), - Transport: createHTTPTransport(), - Secure: mustParseBool(os.Getenv(enableHTTPS)), - }) + c, err := NewClient(ClientConfig{}) if err != nil { logError(testName, function, args, startTime, "", "MinIO client object creation failed", err) return } - // Enable tracing, write to stderr. - // c.TraceOn(os.Stderr) - - // Set user agent. - c.SetAppInfo("MinIO-go-FunctionalTest", appVersion) - // Generate a new random bucket name. bucketName := randString(60, rand.NewSource(time.Now().UnixNano()), "minio-go-test-") args["bucketName"] = bucketName @@ -7255,26 +6788,12 @@ func testBucketNotification() { return } - // Seed random based on current time. - rand.Seed(time.Now().Unix()) - - c, err := minio.New(os.Getenv(serverEndpoint), - &minio.Options{ - Creds: credentials.NewStaticV4(os.Getenv(accessKey), os.Getenv(secretKey), ""), - Transport: createHTTPTransport(), - Secure: mustParseBool(os.Getenv(enableHTTPS)), - }) + c, err := NewClient(ClientConfig{}) if err != nil { logError(testName, function, args, startTime, "", "MinIO client object creation failed", err) return } - // Enable to debug - // c.TraceOn(os.Stderr) - - // Set user agent. - c.SetAppInfo("MinIO-go-FunctionalTest", appVersion) - bucketName := os.Getenv("NOTIFY_BUCKET") args["bucketName"] = bucketName @@ -7350,26 +6869,12 @@ func testFunctional() { functionAll := "" args := map[string]interface{}{} - // Seed random based on current time. - rand.Seed(time.Now().Unix()) - - c, err := minio.New(os.Getenv(serverEndpoint), - &minio.Options{ - Creds: credentials.NewStaticV4(os.Getenv(accessKey), os.Getenv(secretKey), ""), - Transport: createHTTPTransport(), - Secure: mustParseBool(os.Getenv(enableHTTPS)), - }) + c, err := NewClient(ClientConfig{}) if err != nil { logError(testName, function, nil, startTime, "", "MinIO client object creation failed", err) return } - // Enable to debug - // c.TraceOn(os.Stderr) - - // Set user agent. - c.SetAppInfo("MinIO-go-FunctionalTest", appVersion) - // Generate a new random bucket name. bucketName := randString(60, rand.NewSource(time.Now().UnixNano()), "minio-go-test-") @@ -8029,24 +7534,12 @@ func testGetObjectModified() { function := "GetObject(bucketName, objectName)" args := map[string]interface{}{} - // Instantiate new minio client object. - c, err := minio.New(os.Getenv(serverEndpoint), - &minio.Options{ - Creds: credentials.NewStaticV4(os.Getenv(accessKey), os.Getenv(secretKey), ""), - Transport: createHTTPTransport(), - Secure: mustParseBool(os.Getenv(enableHTTPS)), - }) + c, err := NewClient(ClientConfig{}) if err != nil { logError(testName, function, args, startTime, "", "MinIO client object creation failed", err) return } - // Enable tracing, write to stderr. - // c.TraceOn(os.Stderr) - - // Set user agent. - c.SetAppInfo("MinIO-go-FunctionalTest", appVersion) - // Make a new bucket. bucketName := randString(60, rand.NewSource(time.Now().UnixNano()), "minio-go-test-") args["bucketName"] = bucketName @@ -8125,24 +7618,12 @@ func testPutObjectUploadSeekedObject() { "contentType": "binary/octet-stream", } - // Instantiate new minio client object. - c, err := minio.New(os.Getenv(serverEndpoint), - &minio.Options{ - Creds: credentials.NewStaticV4(os.Getenv(accessKey), os.Getenv(secretKey), ""), - Transport: createHTTPTransport(), - Secure: mustParseBool(os.Getenv(enableHTTPS)), - }) + c, err := NewClient(ClientConfig{}) if err != nil { logError(testName, function, args, startTime, "", "MinIO client object creation failed", err) return } - // Enable tracing, write to stderr. - // c.TraceOn(os.Stderr) - - // Set user agent. - c.SetAppInfo("MinIO-go-FunctionalTest", appVersion) - // Make a new bucket. bucketName := randString(60, rand.NewSource(time.Now().UnixNano()), "minio-go-test-") args["bucketName"] = bucketName @@ -8245,27 +7726,12 @@ func testMakeBucketErrorV2() { "region": "eu-west-1", } - // Seed random based on current time. - rand.Seed(time.Now().Unix()) - - // Instantiate new minio client object. - c, err := minio.New(os.Getenv(serverEndpoint), - &minio.Options{ - Creds: credentials.NewStaticV2(os.Getenv(accessKey), os.Getenv(secretKey), ""), - Transport: createHTTPTransport(), - Secure: mustParseBool(os.Getenv(enableHTTPS)), - }) + c, err := NewClient(ClientConfig{CredsV2: true}) if err != nil { logError(testName, function, args, startTime, "", "MinIO v2 client object creation failed", err) return } - // Enable tracing, write to stderr. - // c.TraceOn(os.Stderr) - - // Set user agent. - c.SetAppInfo("MinIO-go-FunctionalTest", appVersion) - // Generate a new random bucket name. bucketName := randString(60, rand.NewSource(time.Now().UnixNano()), "minio-go-test-") region := "eu-west-1" @@ -8305,27 +7771,12 @@ func testGetObjectClosedTwiceV2() { "region": "eu-west-1", } - // Seed random based on current time. - rand.Seed(time.Now().Unix()) - - // Instantiate new minio client object. - c, err := minio.New(os.Getenv(serverEndpoint), - &minio.Options{ - Creds: credentials.NewStaticV2(os.Getenv(accessKey), os.Getenv(secretKey), ""), - Transport: createHTTPTransport(), - Secure: mustParseBool(os.Getenv(enableHTTPS)), - }) + c, err := NewClient(ClientConfig{CredsV2: true}) if err != nil { logError(testName, function, args, startTime, "", "MinIO v2 client object creation failed", err) return } - // Enable tracing, write to stderr. - // c.TraceOn(os.Stderr) - - // Set user agent. - c.SetAppInfo("MinIO-go-FunctionalTest", appVersion) - // Generate a new random bucket name. bucketName := randString(60, rand.NewSource(time.Now().UnixNano()), "minio-go-test-") args["bucketName"] = bucketName @@ -8396,27 +7847,12 @@ func testFPutObjectV2() { "opts": "", } - // Seed random based on current time. - rand.Seed(time.Now().Unix()) - - // Instantiate new minio client object. - c, err := minio.New(os.Getenv(serverEndpoint), - &minio.Options{ - Creds: credentials.NewStaticV2(os.Getenv(accessKey), os.Getenv(secretKey), ""), - Transport: createHTTPTransport(), - Secure: mustParseBool(os.Getenv(enableHTTPS)), - }) + c, err := NewClient(ClientConfig{CredsV2: true}) if err != nil { logError(testName, function, args, startTime, "", "MinIO v2 client object creation failed", err) return } - // Enable tracing, write to stderr. - // c.TraceOn(os.Stderr) - - // Set user agent. - c.SetAppInfo("MinIO-go-FunctionalTest", appVersion) - // Generate a new random bucket name. bucketName := randString(60, rand.NewSource(time.Now().UnixNano()), "minio-go-test-") args["bucketName"] = bucketName @@ -8557,27 +7993,12 @@ func testMakeBucketRegionsV2() { "region": "eu-west-1", } - // Seed random based on current time. - rand.Seed(time.Now().Unix()) - - // Instantiate new minio client object. - c, err := minio.New(os.Getenv(serverEndpoint), - &minio.Options{ - Creds: credentials.NewStaticV2(os.Getenv(accessKey), os.Getenv(secretKey), ""), - Transport: createHTTPTransport(), - Secure: mustParseBool(os.Getenv(enableHTTPS)), - }) + c, err := NewClient(ClientConfig{CredsV2: true}) if err != nil { logError(testName, function, args, startTime, "", "MinIO v2 client object creation failed", err) return } - // Enable tracing, write to stderr. - // c.TraceOn(os.Stderr) - - // Set user agent. - c.SetAppInfo("MinIO-go-FunctionalTest", appVersion) - // Generate a new random bucket name. bucketName := randString(60, rand.NewSource(time.Now().UnixNano()), "minio-go-test-") args["bucketName"] = bucketName @@ -8620,27 +8041,12 @@ func testGetObjectReadSeekFunctionalV2() { function := "GetObject(bucketName, objectName)" args := map[string]interface{}{} - // Seed random based on current time. - rand.Seed(time.Now().Unix()) - - // Instantiate new minio client object. - c, err := minio.New(os.Getenv(serverEndpoint), - &minio.Options{ - Creds: credentials.NewStaticV2(os.Getenv(accessKey), os.Getenv(secretKey), ""), - Transport: createHTTPTransport(), - Secure: mustParseBool(os.Getenv(enableHTTPS)), - }) + c, err := NewClient(ClientConfig{CredsV2: true}) if err != nil { logError(testName, function, args, startTime, "", "MinIO v2 client object creation failed", err) return } - // Enable tracing, write to stderr. - // c.TraceOn(os.Stderr) - - // Set user agent. - c.SetAppInfo("MinIO-go-FunctionalTest", appVersion) - // Generate a new random bucket name. bucketName := randString(60, rand.NewSource(time.Now().UnixNano()), "minio-go-test-") args["bucketName"] = bucketName @@ -8775,27 +8181,12 @@ func testGetObjectReadAtFunctionalV2() { function := "GetObject(bucketName, objectName)" args := map[string]interface{}{} - // Seed random based on current time. - rand.Seed(time.Now().Unix()) - - // Instantiate new minio client object. - c, err := minio.New(os.Getenv(serverEndpoint), - &minio.Options{ - Creds: credentials.NewStaticV2(os.Getenv(accessKey), os.Getenv(secretKey), ""), - Transport: createHTTPTransport(), - Secure: mustParseBool(os.Getenv(enableHTTPS)), - }) + c, err := NewClient(ClientConfig{CredsV2: true}) if err != nil { logError(testName, function, args, startTime, "", "MinIO v2 client object creation failed", err) return } - // Enable tracing, write to stderr. - // c.TraceOn(os.Stderr) - - // Set user agent. - c.SetAppInfo("MinIO-go-FunctionalTest", appVersion) - // Generate a new random bucket name. bucketName := randString(60, rand.NewSource(time.Now().UnixNano()), "minio-go-test-") args["bucketName"] = bucketName @@ -8937,27 +8328,12 @@ func testCopyObjectV2() { function := "CopyObject(destination, source)" args := map[string]interface{}{} - // Seed random based on current time. - rand.Seed(time.Now().Unix()) - - // Instantiate new minio client object - c, err := minio.New(os.Getenv(serverEndpoint), - &minio.Options{ - Creds: credentials.NewStaticV2(os.Getenv(accessKey), os.Getenv(secretKey), ""), - Transport: createHTTPTransport(), - Secure: mustParseBool(os.Getenv(enableHTTPS)), - }) + c, err := NewClient(ClientConfig{CredsV2: true}) if err != nil { logError(testName, function, args, startTime, "", "MinIO v2 client object creation failed", err) return } - // Enable tracing, write to stderr. - // c.TraceOn(os.Stderr) - - // Set user agent. - c.SetAppInfo("MinIO-go-FunctionalTest", appVersion) - // Generate a new random bucket name. bucketName := randString(60, rand.NewSource(time.Now().UnixNano()), "minio-go-test-") @@ -9156,13 +8532,7 @@ func testComposeObjectErrorCasesV2() { function := "ComposeObject(destination, sourceList)" args := map[string]interface{}{} - // Instantiate new minio client object - c, err := minio.New(os.Getenv(serverEndpoint), - &minio.Options{ - Creds: credentials.NewStaticV2(os.Getenv(accessKey), os.Getenv(secretKey), ""), - Transport: createHTTPTransport(), - Secure: mustParseBool(os.Getenv(enableHTTPS)), - }) + c, err := NewClient(ClientConfig{CredsV2: true}) if err != nil { logError(testName, function, args, startTime, "", "MinIO v2 client object creation failed", err) return @@ -9254,13 +8624,7 @@ func testCompose10KSourcesV2() { function := "ComposeObject(destination, sourceList)" args := map[string]interface{}{} - // Instantiate new minio client object - c, err := minio.New(os.Getenv(serverEndpoint), - &minio.Options{ - Creds: credentials.NewStaticV2(os.Getenv(accessKey), os.Getenv(secretKey), ""), - Transport: createHTTPTransport(), - Secure: mustParseBool(os.Getenv(enableHTTPS)), - }) + c, err := NewClient(ClientConfig{CredsV2: true}) if err != nil { logError(testName, function, args, startTime, "", "MinIO v2 client object creation failed", err) return @@ -9276,13 +8640,7 @@ func testEncryptedEmptyObject() { function := "PutObject(bucketName, objectName, reader, objectSize, opts)" args := map[string]interface{}{} - // Instantiate new minio client object - c, err := minio.New(os.Getenv(serverEndpoint), - &minio.Options{ - Creds: credentials.NewStaticV4(os.Getenv(accessKey), os.Getenv(secretKey), ""), - Transport: createHTTPTransport(), - Secure: mustParseBool(os.Getenv(enableHTTPS)), - }) + c, err := NewClient(ClientConfig{}) if err != nil { logError(testName, function, args, startTime, "", "MinIO v4 client object creation failed", err) return @@ -9430,7 +8788,7 @@ func testEncryptedCopyObjectWrapper(c *minio.Client, bucketName string, sseSrc, dstEncryption = sseDst } // 3. get copied object and check if content is equal - coreClient := minio.Core{c} + coreClient := minio.Core{Client: c} reader, _, _, err := coreClient.GetObject(context.Background(), bucketName, "dstObject", minio.GetObjectOptions{ServerSideEncryption: dstEncryption}) if err != nil { logError(testName, function, args, startTime, "", "GetObject failed", err) @@ -9537,13 +8895,7 @@ func testUnencryptedToSSECCopyObject() { function := "CopyObject(destination, source)" args := map[string]interface{}{} - // Instantiate new minio client object - c, err := minio.New(os.Getenv(serverEndpoint), - &minio.Options{ - Creds: credentials.NewStaticV4(os.Getenv(accessKey), os.Getenv(secretKey), ""), - Transport: createHTTPTransport(), - Secure: mustParseBool(os.Getenv(enableHTTPS)), - }) + c, err := NewClient(ClientConfig{}) if err != nil { logError(testName, function, args, startTime, "", "MinIO v2 client object creation failed", err) return @@ -9552,7 +8904,6 @@ func testUnencryptedToSSECCopyObject() { bucketName := randString(60, rand.NewSource(time.Now().UnixNano()), "minio-go-test-") sseDst := encrypt.DefaultPBKDF([]byte("correct horse battery staple"), []byte(bucketName+"dstObject")) - // c.TraceOn(os.Stderr) testEncryptedCopyObjectWrapper(c, bucketName, nil, sseDst) } @@ -9564,13 +8915,7 @@ func testUnencryptedToSSES3CopyObject() { function := "CopyObject(destination, source)" args := map[string]interface{}{} - // Instantiate new minio client object - c, err := minio.New(os.Getenv(serverEndpoint), - &minio.Options{ - Creds: credentials.NewStaticV4(os.Getenv(accessKey), os.Getenv(secretKey), ""), - Transport: createHTTPTransport(), - Secure: mustParseBool(os.Getenv(enableHTTPS)), - }) + c, err := NewClient(ClientConfig{}) if err != nil { logError(testName, function, args, startTime, "", "MinIO v2 client object creation failed", err) return @@ -9580,7 +8925,6 @@ func testUnencryptedToSSES3CopyObject() { var sseSrc encrypt.ServerSide sseDst := encrypt.NewSSE() - // c.TraceOn(os.Stderr) testEncryptedCopyObjectWrapper(c, bucketName, sseSrc, sseDst) } @@ -9592,13 +8936,7 @@ func testUnencryptedToUnencryptedCopyObject() { function := "CopyObject(destination, source)" args := map[string]interface{}{} - // Instantiate new minio client object - c, err := minio.New(os.Getenv(serverEndpoint), - &minio.Options{ - Creds: credentials.NewStaticV4(os.Getenv(accessKey), os.Getenv(secretKey), ""), - Transport: createHTTPTransport(), - Secure: mustParseBool(os.Getenv(enableHTTPS)), - }) + c, err := NewClient(ClientConfig{}) if err != nil { logError(testName, function, args, startTime, "", "MinIO v2 client object creation failed", err) return @@ -9607,7 +8945,6 @@ func testUnencryptedToUnencryptedCopyObject() { bucketName := randString(60, rand.NewSource(time.Now().UnixNano()), "minio-go-test-") var sseSrc, sseDst encrypt.ServerSide - // c.TraceOn(os.Stderr) testEncryptedCopyObjectWrapper(c, bucketName, sseSrc, sseDst) } @@ -9619,13 +8956,7 @@ func testEncryptedSSECToSSECCopyObject() { function := "CopyObject(destination, source)" args := map[string]interface{}{} - // Instantiate new minio client object - c, err := minio.New(os.Getenv(serverEndpoint), - &minio.Options{ - Creds: credentials.NewStaticV4(os.Getenv(accessKey), os.Getenv(secretKey), ""), - Transport: createHTTPTransport(), - Secure: mustParseBool(os.Getenv(enableHTTPS)), - }) + c, err := NewClient(ClientConfig{}) if err != nil { logError(testName, function, args, startTime, "", "MinIO v2 client object creation failed", err) return @@ -9635,7 +8966,6 @@ func testEncryptedSSECToSSECCopyObject() { sseSrc := encrypt.DefaultPBKDF([]byte("correct horse battery staple"), []byte(bucketName+"srcObject")) sseDst := encrypt.DefaultPBKDF([]byte("correct horse battery staple"), []byte(bucketName+"dstObject")) - // c.TraceOn(os.Stderr) testEncryptedCopyObjectWrapper(c, bucketName, sseSrc, sseDst) } @@ -9647,13 +8977,7 @@ func testEncryptedSSECToSSES3CopyObject() { function := "CopyObject(destination, source)" args := map[string]interface{}{} - // Instantiate new minio client object - c, err := minio.New(os.Getenv(serverEndpoint), - &minio.Options{ - Creds: credentials.NewStaticV4(os.Getenv(accessKey), os.Getenv(secretKey), ""), - Transport: createHTTPTransport(), - Secure: mustParseBool(os.Getenv(enableHTTPS)), - }) + c, err := NewClient(ClientConfig{}) if err != nil { logError(testName, function, args, startTime, "", "MinIO v2 client object creation failed", err) return @@ -9663,7 +8987,6 @@ func testEncryptedSSECToSSES3CopyObject() { sseSrc := encrypt.DefaultPBKDF([]byte("correct horse battery staple"), []byte(bucketName+"srcObject")) sseDst := encrypt.NewSSE() - // c.TraceOn(os.Stderr) testEncryptedCopyObjectWrapper(c, bucketName, sseSrc, sseDst) } @@ -9675,13 +8998,7 @@ func testEncryptedSSECToUnencryptedCopyObject() { function := "CopyObject(destination, source)" args := map[string]interface{}{} - // Instantiate new minio client object - c, err := minio.New(os.Getenv(serverEndpoint), - &minio.Options{ - Creds: credentials.NewStaticV4(os.Getenv(accessKey), os.Getenv(secretKey), ""), - Transport: createHTTPTransport(), - Secure: mustParseBool(os.Getenv(enableHTTPS)), - }) + c, err := NewClient(ClientConfig{}) if err != nil { logError(testName, function, args, startTime, "", "MinIO v2 client object creation failed", err) return @@ -9691,7 +9008,6 @@ func testEncryptedSSECToUnencryptedCopyObject() { sseSrc := encrypt.DefaultPBKDF([]byte("correct horse battery staple"), []byte(bucketName+"srcObject")) var sseDst encrypt.ServerSide - // c.TraceOn(os.Stderr) testEncryptedCopyObjectWrapper(c, bucketName, sseSrc, sseDst) } @@ -9703,13 +9019,7 @@ func testEncryptedSSES3ToSSECCopyObject() { function := "CopyObject(destination, source)" args := map[string]interface{}{} - // Instantiate new minio client object - c, err := minio.New(os.Getenv(serverEndpoint), - &minio.Options{ - Creds: credentials.NewStaticV4(os.Getenv(accessKey), os.Getenv(secretKey), ""), - Transport: createHTTPTransport(), - Secure: mustParseBool(os.Getenv(enableHTTPS)), - }) + c, err := NewClient(ClientConfig{}) if err != nil { logError(testName, function, args, startTime, "", "MinIO v2 client object creation failed", err) return @@ -9719,7 +9029,6 @@ func testEncryptedSSES3ToSSECCopyObject() { sseSrc := encrypt.NewSSE() sseDst := encrypt.DefaultPBKDF([]byte("correct horse battery staple"), []byte(bucketName+"dstObject")) - // c.TraceOn(os.Stderr) testEncryptedCopyObjectWrapper(c, bucketName, sseSrc, sseDst) } @@ -9731,13 +9040,7 @@ func testEncryptedSSES3ToSSES3CopyObject() { function := "CopyObject(destination, source)" args := map[string]interface{}{} - // Instantiate new minio client object - c, err := minio.New(os.Getenv(serverEndpoint), - &minio.Options{ - Creds: credentials.NewStaticV4(os.Getenv(accessKey), os.Getenv(secretKey), ""), - Transport: createHTTPTransport(), - Secure: mustParseBool(os.Getenv(enableHTTPS)), - }) + c, err := NewClient(ClientConfig{}) if err != nil { logError(testName, function, args, startTime, "", "MinIO v2 client object creation failed", err) return @@ -9747,7 +9050,6 @@ func testEncryptedSSES3ToSSES3CopyObject() { sseSrc := encrypt.NewSSE() sseDst := encrypt.NewSSE() - // c.TraceOn(os.Stderr) testEncryptedCopyObjectWrapper(c, bucketName, sseSrc, sseDst) } @@ -9759,13 +9061,7 @@ func testEncryptedSSES3ToUnencryptedCopyObject() { function := "CopyObject(destination, source)" args := map[string]interface{}{} - // Instantiate new minio client object - c, err := minio.New(os.Getenv(serverEndpoint), - &minio.Options{ - Creds: credentials.NewStaticV4(os.Getenv(accessKey), os.Getenv(secretKey), ""), - Transport: createHTTPTransport(), - Secure: mustParseBool(os.Getenv(enableHTTPS)), - }) + c, err := NewClient(ClientConfig{}) if err != nil { logError(testName, function, args, startTime, "", "MinIO v2 client object creation failed", err) return @@ -9775,7 +9071,6 @@ func testEncryptedSSES3ToUnencryptedCopyObject() { sseSrc := encrypt.NewSSE() var sseDst encrypt.ServerSide - // c.TraceOn(os.Stderr) testEncryptedCopyObjectWrapper(c, bucketName, sseSrc, sseDst) } @@ -9787,13 +9082,7 @@ func testEncryptedCopyObjectV2() { function := "CopyObject(destination, source)" args := map[string]interface{}{} - // Instantiate new minio client object - c, err := minio.New(os.Getenv(serverEndpoint), - &minio.Options{ - Creds: credentials.NewStaticV2(os.Getenv(accessKey), os.Getenv(secretKey), ""), - Transport: createHTTPTransport(), - Secure: mustParseBool(os.Getenv(enableHTTPS)), - }) + c, err := NewClient(ClientConfig{CredsV2: true}) if err != nil { logError(testName, function, args, startTime, "", "MinIO v2 client object creation failed", err) return @@ -9803,7 +9092,6 @@ func testEncryptedCopyObjectV2() { sseSrc := encrypt.DefaultPBKDF([]byte("correct horse battery staple"), []byte(bucketName+"srcObject")) sseDst := encrypt.DefaultPBKDF([]byte("correct horse battery staple"), []byte(bucketName+"dstObject")) - // c.TraceOn(os.Stderr) testEncryptedCopyObjectWrapper(c, bucketName, sseSrc, sseDst) } @@ -9814,13 +9102,7 @@ func testDecryptedCopyObject() { function := "CopyObject(destination, source)" args := map[string]interface{}{} - // Instantiate new minio client object - c, err := minio.New(os.Getenv(serverEndpoint), - &minio.Options{ - Creds: credentials.NewStaticV4(os.Getenv(accessKey), os.Getenv(secretKey), ""), - Transport: createHTTPTransport(), - Secure: mustParseBool(os.Getenv(enableHTTPS)), - }) + c, err := NewClient(ClientConfig{}) if err != nil { logError(testName, function, args, startTime, "", "MinIO v2 client object creation failed", err) return @@ -9874,26 +9156,14 @@ func testSSECMultipartEncryptedToSSECCopyObjectPart() { function := "CopyObjectPart(destination, source)" args := map[string]interface{}{} - // Instantiate new minio client object - client, err := minio.New(os.Getenv(serverEndpoint), - &minio.Options{ - Creds: credentials.NewStaticV4(os.Getenv(accessKey), os.Getenv(secretKey), ""), - Transport: createHTTPTransport(), - Secure: mustParseBool(os.Getenv(enableHTTPS)), - }) + client, err := NewClient(ClientConfig{}) if err != nil { logError(testName, function, args, startTime, "", "MinIO v4 client object creation failed", err) return } // Instantiate new core client object. - c := minio.Core{client} - - // Enable tracing, write to stderr. - // c.TraceOn(os.Stderr) - - // Set user agent. - c.SetAppInfo("MinIO-go-FunctionalTest", appVersion) + c := minio.Core{Client: client} // Generate a new random bucket name. bucketName := randString(60, rand.NewSource(time.Now().UnixNano()), "minio-go-test") @@ -10072,26 +9342,14 @@ func testSSECEncryptedToSSECCopyObjectPart() { function := "CopyObjectPart(destination, source)" args := map[string]interface{}{} - // Instantiate new minio client object - client, err := minio.New(os.Getenv(serverEndpoint), - &minio.Options{ - Creds: credentials.NewStaticV4(os.Getenv(accessKey), os.Getenv(secretKey), ""), - Transport: createHTTPTransport(), - Secure: mustParseBool(os.Getenv(enableHTTPS)), - }) + client, err := NewClient(ClientConfig{}) if err != nil { logError(testName, function, args, startTime, "", "MinIO v4 client object creation failed", err) return } // Instantiate new core client object. - c := minio.Core{client} - - // Enable tracing, write to stderr. - // c.TraceOn(os.Stderr) - - // Set user agent. - c.SetAppInfo("MinIO-go-FunctionalTest", appVersion) + c := minio.Core{Client: client} // Generate a new random bucket name. bucketName := randString(60, rand.NewSource(time.Now().UnixNano()), "minio-go-test") @@ -10250,26 +9508,14 @@ func testSSECEncryptedToUnencryptedCopyPart() { function := "CopyObjectPart(destination, source)" args := map[string]interface{}{} - // Instantiate new minio client object - client, err := minio.New(os.Getenv(serverEndpoint), - &minio.Options{ - Creds: credentials.NewStaticV4(os.Getenv(accessKey), os.Getenv(secretKey), ""), - Transport: createHTTPTransport(), - Secure: mustParseBool(os.Getenv(enableHTTPS)), - }) + client, err := NewClient(ClientConfig{}) if err != nil { logError(testName, function, args, startTime, "", "MinIO v4 client object creation failed", err) return } // Instantiate new core client object. - c := minio.Core{client} - - // Enable tracing, write to stderr. - // c.TraceOn(os.Stderr) - - // Set user agent. - c.SetAppInfo("MinIO-go-FunctionalTest", appVersion) + c := minio.Core{Client: client} // Generate a new random bucket name. bucketName := randString(60, rand.NewSource(time.Now().UnixNano()), "minio-go-test") @@ -10427,26 +9673,14 @@ func testSSECEncryptedToSSES3CopyObjectPart() { function := "CopyObjectPart(destination, source)" args := map[string]interface{}{} - // Instantiate new minio client object - client, err := minio.New(os.Getenv(serverEndpoint), - &minio.Options{ - Creds: credentials.NewStaticV4(os.Getenv(accessKey), os.Getenv(secretKey), ""), - Transport: createHTTPTransport(), - Secure: mustParseBool(os.Getenv(enableHTTPS)), - }) + client, err := NewClient(ClientConfig{}) if err != nil { logError(testName, function, args, startTime, "", "MinIO v4 client object creation failed", err) return } // Instantiate new core client object. - c := minio.Core{client} - - // Enable tracing, write to stderr. - // c.TraceOn(os.Stderr) - - // Set user agent. - c.SetAppInfo("MinIO-go-FunctionalTest", appVersion) + c := minio.Core{Client: client} // Generate a new random bucket name. bucketName := randString(60, rand.NewSource(time.Now().UnixNano()), "minio-go-test") @@ -10607,26 +9841,14 @@ func testUnencryptedToSSECCopyObjectPart() { function := "CopyObjectPart(destination, source)" args := map[string]interface{}{} - // Instantiate new minio client object - client, err := minio.New(os.Getenv(serverEndpoint), - &minio.Options{ - Creds: credentials.NewStaticV4(os.Getenv(accessKey), os.Getenv(secretKey), ""), - Transport: createHTTPTransport(), - Secure: mustParseBool(os.Getenv(enableHTTPS)), - }) + client, err := NewClient(ClientConfig{}) if err != nil { logError(testName, function, args, startTime, "", "MinIO v4 client object creation failed", err) return } // Instantiate new core client object. - c := minio.Core{client} - - // Enable tracing, write to stderr. - // c.TraceOn(os.Stderr) - - // Set user agent. - c.SetAppInfo("MinIO-go-FunctionalTest", appVersion) + c := minio.Core{Client: client} // Generate a new random bucket name. bucketName := randString(60, rand.NewSource(time.Now().UnixNano()), "minio-go-test") @@ -10782,26 +10004,14 @@ func testUnencryptedToUnencryptedCopyPart() { function := "CopyObjectPart(destination, source)" args := map[string]interface{}{} - // Instantiate new minio client object - client, err := minio.New(os.Getenv(serverEndpoint), - &minio.Options{ - Creds: credentials.NewStaticV4(os.Getenv(accessKey), os.Getenv(secretKey), ""), - Transport: createHTTPTransport(), - Secure: mustParseBool(os.Getenv(enableHTTPS)), - }) + client, err := NewClient(ClientConfig{}) if err != nil { logError(testName, function, args, startTime, "", "MinIO v4 client object creation failed", err) return } // Instantiate new core client object. - c := minio.Core{client} - - // Enable tracing, write to stderr. - // c.TraceOn(os.Stderr) - - // Set user agent. - c.SetAppInfo("MinIO-go-FunctionalTest", appVersion) + c := minio.Core{Client: client} // Generate a new random bucket name. bucketName := randString(60, rand.NewSource(time.Now().UnixNano()), "minio-go-test") @@ -10953,26 +10163,14 @@ func testUnencryptedToSSES3CopyObjectPart() { function := "CopyObjectPart(destination, source)" args := map[string]interface{}{} - // Instantiate new minio client object - client, err := minio.New(os.Getenv(serverEndpoint), - &minio.Options{ - Creds: credentials.NewStaticV4(os.Getenv(accessKey), os.Getenv(secretKey), ""), - Transport: createHTTPTransport(), - Secure: mustParseBool(os.Getenv(enableHTTPS)), - }) + client, err := NewClient(ClientConfig{}) if err != nil { logError(testName, function, args, startTime, "", "MinIO v4 client object creation failed", err) return } // Instantiate new core client object. - c := minio.Core{client} - - // Enable tracing, write to stderr. - // c.TraceOn(os.Stderr) - - // Set user agent. - c.SetAppInfo("MinIO-go-FunctionalTest", appVersion) + c := minio.Core{Client: client} // Generate a new random bucket name. bucketName := randString(60, rand.NewSource(time.Now().UnixNano()), "minio-go-test") @@ -11126,26 +10324,14 @@ func testSSES3EncryptedToSSECCopyObjectPart() { function := "CopyObjectPart(destination, source)" args := map[string]interface{}{} - // Instantiate new minio client object - client, err := minio.New(os.Getenv(serverEndpoint), - &minio.Options{ - Creds: credentials.NewStaticV4(os.Getenv(accessKey), os.Getenv(secretKey), ""), - Transport: createHTTPTransport(), - Secure: mustParseBool(os.Getenv(enableHTTPS)), - }) + client, err := NewClient(ClientConfig{}) if err != nil { logError(testName, function, args, startTime, "", "MinIO v4 client object creation failed", err) return } // Instantiate new core client object. - c := minio.Core{client} - - // Enable tracing, write to stderr. - // c.TraceOn(os.Stderr) - - // Set user agent. - c.SetAppInfo("MinIO-go-FunctionalTest", appVersion) + c := minio.Core{Client: client} // Generate a new random bucket name. bucketName := randString(60, rand.NewSource(time.Now().UnixNano()), "minio-go-test") @@ -11302,26 +10488,14 @@ func testSSES3EncryptedToUnencryptedCopyPart() { function := "CopyObjectPart(destination, source)" args := map[string]interface{}{} - // Instantiate new minio client object - client, err := minio.New(os.Getenv(serverEndpoint), - &minio.Options{ - Creds: credentials.NewStaticV4(os.Getenv(accessKey), os.Getenv(secretKey), ""), - Transport: createHTTPTransport(), - Secure: mustParseBool(os.Getenv(enableHTTPS)), - }) + client, err := NewClient(ClientConfig{}) if err != nil { logError(testName, function, args, startTime, "", "MinIO v4 client object creation failed", err) return } // Instantiate new core client object. - c := minio.Core{client} - - // Enable tracing, write to stderr. - // c.TraceOn(os.Stderr) - - // Set user agent. - c.SetAppInfo("MinIO-go-FunctionalTest", appVersion) + c := minio.Core{Client: client} // Generate a new random bucket name. bucketName := randString(60, rand.NewSource(time.Now().UnixNano()), "minio-go-test") @@ -11474,26 +10648,14 @@ func testSSES3EncryptedToSSES3CopyObjectPart() { function := "CopyObjectPart(destination, source)" args := map[string]interface{}{} - // Instantiate new minio client object - client, err := minio.New(os.Getenv(serverEndpoint), - &minio.Options{ - Creds: credentials.NewStaticV4(os.Getenv(accessKey), os.Getenv(secretKey), ""), - Transport: createHTTPTransport(), - Secure: mustParseBool(os.Getenv(enableHTTPS)), - }) + client, err := NewClient(ClientConfig{}) if err != nil { logError(testName, function, args, startTime, "", "MinIO v4 client object creation failed", err) return } // Instantiate new core client object. - c := minio.Core{client} - - // Enable tracing, write to stderr. - // c.TraceOn(os.Stderr) - - // Set user agent. - c.SetAppInfo("MinIO-go-FunctionalTest", appVersion) + c := minio.Core{Client: client} // Generate a new random bucket name. bucketName := randString(60, rand.NewSource(time.Now().UnixNano()), "minio-go-test") @@ -11648,19 +10810,12 @@ func testUserMetadataCopying() { function := "CopyObject(destination, source)" args := map[string]interface{}{} - // Instantiate new minio client object - c, err := minio.New(os.Getenv(serverEndpoint), - &minio.Options{ - Creds: credentials.NewStaticV4(os.Getenv(accessKey), os.Getenv(secretKey), ""), - Transport: createHTTPTransport(), - Secure: mustParseBool(os.Getenv(enableHTTPS)), - }) + c, err := NewClient(ClientConfig{}) if err != nil { logError(testName, function, args, startTime, "", "MinIO client object creation failed", err) return } - // c.TraceOn(os.Stderr) testUserMetadataCopyingWrapper(c) } @@ -11825,19 +10980,12 @@ func testUserMetadataCopyingV2() { function := "CopyObject(destination, source)" args := map[string]interface{}{} - // Instantiate new minio client object - c, err := minio.New(os.Getenv(serverEndpoint), - &minio.Options{ - Creds: credentials.NewStaticV2(os.Getenv(accessKey), os.Getenv(secretKey), ""), - Transport: createHTTPTransport(), - Secure: mustParseBool(os.Getenv(enableHTTPS)), - }) + c, err := NewClient(ClientConfig{CredsV2: true}) if err != nil { logError(testName, function, args, startTime, "", "MinIO client v2 object creation failed", err) return } - // c.TraceOn(os.Stderr) testUserMetadataCopyingWrapper(c) } @@ -11848,13 +10996,7 @@ func testStorageClassMetadataPutObject() { args := map[string]interface{}{} testName := getFuncName() - // Instantiate new minio client object - c, err := minio.New(os.Getenv(serverEndpoint), - &minio.Options{ - Creds: credentials.NewStaticV4(os.Getenv(accessKey), os.Getenv(secretKey), ""), - Transport: createHTTPTransport(), - Secure: mustParseBool(os.Getenv(enableHTTPS)), - }) + c, err := NewClient(ClientConfig{}) if err != nil { logError(testName, function, args, startTime, "", "MinIO v4 client object creation failed", err) return @@ -11936,13 +11078,7 @@ func testStorageClassInvalidMetadataPutObject() { args := map[string]interface{}{} testName := getFuncName() - // Instantiate new minio client object - c, err := minio.New(os.Getenv(serverEndpoint), - &minio.Options{ - Creds: credentials.NewStaticV4(os.Getenv(accessKey), os.Getenv(secretKey), ""), - Transport: createHTTPTransport(), - Secure: mustParseBool(os.Getenv(enableHTTPS)), - }) + c, err := NewClient(ClientConfig{}) if err != nil { logError(testName, function, args, startTime, "", "MinIO v4 client object creation failed", err) return @@ -11979,13 +11115,7 @@ func testStorageClassMetadataCopyObject() { args := map[string]interface{}{} testName := getFuncName() - // Instantiate new minio client object - c, err := minio.New(os.Getenv(serverEndpoint), - &minio.Options{ - Creds: credentials.NewStaticV4(os.Getenv(accessKey), os.Getenv(secretKey), ""), - Secure: mustParseBool(os.Getenv(enableHTTPS)), - Transport: createHTTPTransport(), - }) + c, err := NewClient(ClientConfig{}) if err != nil { logError(testName, function, args, startTime, "", "MinIO v4 client object creation failed", err) return @@ -12106,27 +11236,12 @@ func testPutObjectNoLengthV2() { "opts": "", } - // Seed random based on current time. - rand.Seed(time.Now().Unix()) - - // Instantiate new minio client object. - c, err := minio.New(os.Getenv(serverEndpoint), - &minio.Options{ - Creds: credentials.NewStaticV2(os.Getenv(accessKey), os.Getenv(secretKey), ""), - Transport: createHTTPTransport(), - Secure: mustParseBool(os.Getenv(enableHTTPS)), - }) + c, err := NewClient(ClientConfig{CredsV2: true}) if err != nil { - logError(testName, function, args, startTime, "", "MinIO client v2 object creation failed", err) + logError(testName, function, args, startTime, "", "MinIO v2 client object creation failed", err) return } - // Enable tracing, write to stderr. - // c.TraceOn(os.Stderr) - - // Set user agent. - c.SetAppInfo("MinIO-go-FunctionalTest", appVersion) - // Generate a new random bucket name. bucketName := randString(60, rand.NewSource(time.Now().UnixNano()), "minio-go-test-") args["bucketName"] = bucketName @@ -12182,27 +11297,12 @@ func testPutObjectsUnknownV2() { "opts": "", } - // Seed random based on current time. - rand.Seed(time.Now().Unix()) - - // Instantiate new minio client object. - c, err := minio.New(os.Getenv(serverEndpoint), - &minio.Options{ - Creds: credentials.NewStaticV2(os.Getenv(accessKey), os.Getenv(secretKey), ""), - Transport: createHTTPTransport(), - Secure: mustParseBool(os.Getenv(enableHTTPS)), - }) + c, err := NewClient(ClientConfig{CredsV2: true}) if err != nil { - logError(testName, function, args, startTime, "", "MinIO client v2 object creation failed", err) + logError(testName, function, args, startTime, "", "MinIO v2 client object creation failed", err) return } - // Enable tracing, write to stderr. - // c.TraceOn(os.Stderr) - - // Set user agent. - c.SetAppInfo("MinIO-go-FunctionalTest", appVersion) - // Generate a new random bucket name. bucketName := randString(60, rand.NewSource(time.Now().UnixNano()), "minio-go-test-") args["bucketName"] = bucketName @@ -12273,27 +11373,12 @@ func testPutObject0ByteV2() { "opts": "", } - // Seed random based on current time. - rand.Seed(time.Now().Unix()) - - // Instantiate new minio client object. - c, err := minio.New(os.Getenv(serverEndpoint), - &minio.Options{ - Creds: credentials.NewStaticV2(os.Getenv(accessKey), os.Getenv(secretKey), ""), - Transport: createHTTPTransport(), - Secure: mustParseBool(os.Getenv(enableHTTPS)), - }) + c, err := NewClient(ClientConfig{CredsV2: true}) if err != nil { - logError(testName, function, args, startTime, "", "MinIO client v2 object creation failed", err) + logError(testName, function, args, startTime, "", "MinIO v2 client object creation failed", err) return } - // Enable tracing, write to stderr. - // c.TraceOn(os.Stderr) - - // Set user agent. - c.SetAppInfo("MinIO-go-FunctionalTest", appVersion) - // Generate a new random bucket name. bucketName := randString(60, rand.NewSource(time.Now().UnixNano()), "minio-go-test-") args["bucketName"] = bucketName @@ -12338,13 +11423,7 @@ func testComposeObjectErrorCases() { function := "ComposeObject(destination, sourceList)" args := map[string]interface{}{} - // Instantiate new minio client object - c, err := minio.New(os.Getenv(serverEndpoint), - &minio.Options{ - Creds: credentials.NewStaticV4(os.Getenv(accessKey), os.Getenv(secretKey), ""), - Transport: createHTTPTransport(), - Secure: mustParseBool(os.Getenv(enableHTTPS)), - }) + c, err := NewClient(ClientConfig{}) if err != nil { logError(testName, function, args, startTime, "", "MinIO client object creation failed", err) return @@ -12361,13 +11440,7 @@ func testCompose10KSources() { function := "ComposeObject(destination, sourceList)" args := map[string]interface{}{} - // Instantiate new minio client object - c, err := minio.New(os.Getenv(serverEndpoint), - &minio.Options{ - Creds: credentials.NewStaticV4(os.Getenv(accessKey), os.Getenv(secretKey), ""), - Transport: createHTTPTransport(), - Secure: mustParseBool(os.Getenv(enableHTTPS)), - }) + c, err := NewClient(ClientConfig{}) if err != nil { logError(testName, function, args, startTime, "", "MinIO client object creation failed", err) return @@ -12385,26 +11458,12 @@ func testFunctionalV2() { functionAll := "" args := map[string]interface{}{} - // Seed random based on current time. - rand.Seed(time.Now().Unix()) - - c, err := minio.New(os.Getenv(serverEndpoint), - &minio.Options{ - Creds: credentials.NewStaticV2(os.Getenv(accessKey), os.Getenv(secretKey), ""), - Secure: mustParseBool(os.Getenv(enableHTTPS)), - Transport: createHTTPTransport(), - }) + c, err := NewClient(ClientConfig{CredsV2: true}) if err != nil { logError(testName, function, args, startTime, "", "MinIO client v2 object creation failed", err) return } - // Enable to debug - // c.TraceOn(os.Stderr) - - // Set user agent. - c.SetAppInfo("MinIO-go-FunctionalTest", appVersion) - // Generate a new random bucket name. bucketName := randString(60, rand.NewSource(time.Now().UnixNano()), "minio-go-test-") location := "us-east-1" @@ -12838,27 +11897,13 @@ func testGetObjectContext() { "bucketName": "", "objectName": "", } - // Seed random based on current time. - rand.Seed(time.Now().Unix()) - // Instantiate new minio client object. - c, err := minio.New(os.Getenv(serverEndpoint), - &minio.Options{ - Creds: credentials.NewStaticV4(os.Getenv(accessKey), os.Getenv(secretKey), ""), - Transport: createHTTPTransport(), - Secure: mustParseBool(os.Getenv(enableHTTPS)), - }) + c, err := NewClient(ClientConfig{}) if err != nil { logError(testName, function, args, startTime, "", "MinIO client v4 object creation failed", err) return } - // Enable tracing, write to stderr. - // c.TraceOn(os.Stderr) - - // Set user agent. - c.SetAppInfo("MinIO-go-FunctionalTest", appVersion) - // Generate a new random bucket name. bucketName := randString(60, rand.NewSource(time.Now().UnixNano()), "minio-go-test-") args["bucketName"] = bucketName @@ -12941,27 +11986,13 @@ func testFGetObjectContext() { "objectName": "", "fileName": "", } - // Seed random based on current time. - rand.Seed(time.Now().Unix()) - // Instantiate new minio client object. - c, err := minio.New(os.Getenv(serverEndpoint), - &minio.Options{ - Creds: credentials.NewStaticV4(os.Getenv(accessKey), os.Getenv(secretKey), ""), - Transport: createHTTPTransport(), - Secure: mustParseBool(os.Getenv(enableHTTPS)), - }) + c, err := NewClient(ClientConfig{}) if err != nil { logError(testName, function, args, startTime, "", "MinIO client v4 object creation failed", err) return } - // Enable tracing, write to stderr. - // c.TraceOn(os.Stderr) - - // Set user agent. - c.SetAppInfo("MinIO-go-FunctionalTest", appVersion) - // Generate a new random bucket name. bucketName := randString(60, rand.NewSource(time.Now().UnixNano()), "minio-go-test-") args["bucketName"] = bucketName @@ -13033,24 +12064,12 @@ func testGetObjectRanges() { defer cancel() rng := rand.NewSource(time.Now().UnixNano()) - // Instantiate new minio client object. - c, err := minio.New(os.Getenv(serverEndpoint), - &minio.Options{ - Creds: credentials.NewStaticV4(os.Getenv(accessKey), os.Getenv(secretKey), ""), - Transport: createHTTPTransport(), - Secure: mustParseBool(os.Getenv(enableHTTPS)), - }) + c, err := NewClient(ClientConfig{}) if err != nil { logError(testName, function, args, startTime, "", "MinIO client v4 object creation failed", err) return } - // Enable tracing, write to stderr. - // c.TraceOn(os.Stderr) - - // Set user agent. - c.SetAppInfo("MinIO-go-FunctionalTest", appVersion) - // Generate a new random bucket name. bucketName := randString(60, rng, "minio-go-test-") args["bucketName"] = bucketName @@ -13140,27 +12159,13 @@ func testGetObjectACLContext() { "bucketName": "", "objectName": "", } - // Seed random based on current time. - rand.Seed(time.Now().Unix()) - // Instantiate new minio client object. - c, err := minio.New(os.Getenv(serverEndpoint), - &minio.Options{ - Creds: credentials.NewStaticV4(os.Getenv(accessKey), os.Getenv(secretKey), ""), - Transport: createHTTPTransport(), - Secure: mustParseBool(os.Getenv(enableHTTPS)), - }) + c, err := NewClient(ClientConfig{}) if err != nil { logError(testName, function, args, startTime, "", "MinIO client v4 object creation failed", err) return } - // Enable tracing, write to stderr. - // c.TraceOn(os.Stderr) - - // Set user agent. - c.SetAppInfo("MinIO-go-FunctionalTest", appVersion) - // Generate a new random bucket name. bucketName := randString(60, rand.NewSource(time.Now().UnixNano()), "minio-go-test-") args["bucketName"] = bucketName @@ -13318,24 +12323,12 @@ func testPutObjectContextV2() { "size": "", "opts": "", } - // Instantiate new minio client object. - c, err := minio.New(os.Getenv(serverEndpoint), - &minio.Options{ - Creds: credentials.NewStaticV2(os.Getenv(accessKey), os.Getenv(secretKey), ""), - Transport: createHTTPTransport(), - Secure: mustParseBool(os.Getenv(enableHTTPS)), - }) + c, err := NewClient(ClientConfig{CredsV2: true}) if err != nil { - logError(testName, function, args, startTime, "", "MinIO client v2 object creation failed", err) + logError(testName, function, args, startTime, "", "MinIO v2 client object creation failed", err) return } - // Enable tracing, write to stderr. - // c.TraceOn(os.Stderr) - - // Set user agent. - c.SetAppInfo("MinIO-go-FunctionalTest", appVersion) - // Make a new bucket. bucketName := randString(60, rand.NewSource(time.Now().UnixNano()), "minio-go-test-") args["bucketName"] = bucketName @@ -13390,27 +12383,13 @@ func testGetObjectContextV2() { "bucketName": "", "objectName": "", } - // Seed random based on current time. - rand.Seed(time.Now().Unix()) - // Instantiate new minio client object. - c, err := minio.New(os.Getenv(serverEndpoint), - &minio.Options{ - Creds: credentials.NewStaticV2(os.Getenv(accessKey), os.Getenv(secretKey), ""), - Transport: createHTTPTransport(), - Secure: mustParseBool(os.Getenv(enableHTTPS)), - }) + c, err := NewClient(ClientConfig{CredsV2: true}) if err != nil { - logError(testName, function, args, startTime, "", "MinIO client v2 object creation failed", err) + logError(testName, function, args, startTime, "", "MinIO v2 client object creation failed", err) return } - // Enable tracing, write to stderr. - // c.TraceOn(os.Stderr) - - // Set user agent. - c.SetAppInfo("MinIO-go-FunctionalTest", appVersion) - // Generate a new random bucket name. bucketName := randString(60, rand.NewSource(time.Now().UnixNano()), "minio-go-test-") args["bucketName"] = bucketName @@ -13491,27 +12470,13 @@ func testFGetObjectContextV2() { "objectName": "", "fileName": "", } - // Seed random based on current time. - rand.Seed(time.Now().Unix()) - // Instantiate new minio client object. - c, err := minio.New(os.Getenv(serverEndpoint), - &minio.Options{ - Creds: credentials.NewStaticV2(os.Getenv(accessKey), os.Getenv(secretKey), ""), - Transport: createHTTPTransport(), - Secure: mustParseBool(os.Getenv(enableHTTPS)), - }) + c, err := NewClient(ClientConfig{CredsV2: true}) if err != nil { - logError(testName, function, args, startTime, "", "MinIO client v2 object creation failed", err) + logError(testName, function, args, startTime, "", "MinIO v2 client object creation failed", err) return } - // Enable tracing, write to stderr. - // c.TraceOn(os.Stderr) - - // Set user agent. - c.SetAppInfo("MinIO-go-FunctionalTest", appVersion) - // Generate a new random bucket name. bucketName := randString(60, rand.NewSource(time.Now().UnixNano()), "minio-go-test-") args["bucketName"] = bucketName @@ -13580,27 +12545,13 @@ func testListObjects() { "objectPrefix": "", "recursive": "true", } - // Seed random based on current time. - rand.Seed(time.Now().Unix()) - // Instantiate new minio client object. - c, err := minio.New(os.Getenv(serverEndpoint), - &minio.Options{ - Creds: credentials.NewStaticV4(os.Getenv(accessKey), os.Getenv(secretKey), ""), - Transport: createHTTPTransport(), - Secure: mustParseBool(os.Getenv(enableHTTPS)), - }) + c, err := NewClient(ClientConfig{}) if err != nil { logError(testName, function, args, startTime, "", "MinIO client v4 object creation failed", err) return } - // Enable tracing, write to stderr. - // c.TraceOn(os.Stderr) - - // Set user agent. - c.SetAppInfo("MinIO-go-FunctionalTest", appVersion) - // Generate a new random bucket name. bucketName := randString(60, rand.NewSource(time.Now().UnixNano()), "minio-go-test-") args["bucketName"] = bucketName @@ -13684,24 +12635,12 @@ func testCors() { "cors": "", } - // Instantiate new minio client object - c, err := minio.New(os.Getenv(serverEndpoint), - &minio.Options{ - Creds: credentials.NewStaticV4(os.Getenv(accessKey), os.Getenv(secretKey), ""), - Transport: createHTTPTransport(), - Secure: mustParseBool(os.Getenv(enableHTTPS)), - }) + c, err := NewClient(ClientConfig{}) if err != nil { logError(testName, function, args, startTime, "", "MinIO client object creation failed", err) return } - // Enable tracing, write to stderr. - // c.TraceOn(os.Stderr) - - // Set user agent. - c.SetAppInfo("MinIO-go-FunctionalTest", appVersion) - // Create or reuse a bucket that will get cors settings applied to it and deleted when done bucketName := os.Getenv("MINIO_GO_TEST_BUCKET_CORS") if bucketName == "" { @@ -14420,24 +13359,12 @@ func testCorsSetGetDelete() { "cors": "", } - // Instantiate new minio client object - c, err := minio.New(os.Getenv(serverEndpoint), - &minio.Options{ - Creds: credentials.NewStaticV4(os.Getenv(accessKey), os.Getenv(secretKey), ""), - Transport: createHTTPTransport(), - Secure: mustParseBool(os.Getenv(enableHTTPS)), - }) + c, err := NewClient(ClientConfig{}) if err != nil { logError(testName, function, args, startTime, "", "MinIO client object creation failed", err) return } - // Enable tracing, write to stderr. - // c.TraceOn(os.Stderr) - - // Set user agent. - c.SetAppInfo("MinIO-go-FunctionalTest", appVersion) - // Generate a new random bucket name. bucketName := randString(60, rand.NewSource(time.Now().UnixNano()), "minio-go-test-") args["bucketName"] = bucketName @@ -14519,27 +13446,13 @@ func testRemoveObjects() { "objectPrefix": "", "recursive": "true", } - // Seed random based on current time. - rand.Seed(time.Now().Unix()) - // Instantiate new minio client object. - c, err := minio.New(os.Getenv(serverEndpoint), - &minio.Options{ - Creds: credentials.NewStaticV4(os.Getenv(accessKey), os.Getenv(secretKey), ""), - Transport: createHTTPTransport(), - Secure: mustParseBool(os.Getenv(enableHTTPS)), - }) + c, err := NewClient(ClientConfig{}) if err != nil { logError(testName, function, args, startTime, "", "MinIO client v4 object creation failed", err) return } - // Enable tracing, write to stderr. - // c.TraceOn(os.Stderr) - - // Set user agent. - c.SetAppInfo("MinIO-go-FunctionalTest", appVersion) - // Generate a new random bucket name. bucketName := randString(60, rand.NewSource(time.Now().UnixNano()), "minio-go-test-") args["bucketName"] = bucketName @@ -14653,27 +13566,13 @@ func testGetBucketTagging() { args := map[string]interface{}{ "bucketName": "", } - // Seed random based on current time. - rand.Seed(time.Now().Unix()) - // Instantiate new minio client object. - c, err := minio.New(os.Getenv(serverEndpoint), - &minio.Options{ - Creds: credentials.NewStaticV4(os.Getenv(accessKey), os.Getenv(secretKey), ""), - Transport: createHTTPTransport(), - Secure: mustParseBool(os.Getenv(enableHTTPS)), - }) + c, err := NewClient(ClientConfig{}) if err != nil { logError(testName, function, args, startTime, "", "MinIO client v4 object creation failed", err) return } - // Enable tracing, write to stderr. - // c.TraceOn(os.Stderr) - - // Set user agent. - c.SetAppInfo("MinIO-go-FunctionalTest", appVersion) - // Generate a new random bucket name. bucketName := randString(60, rand.NewSource(time.Now().UnixNano()), "minio-go-test-") args["bucketName"] = bucketName @@ -14709,27 +13608,13 @@ func testSetBucketTagging() { "bucketName": "", "tags": "", } - // Seed random based on current time. - rand.Seed(time.Now().Unix()) - // Instantiate new minio client object. - c, err := minio.New(os.Getenv(serverEndpoint), - &minio.Options{ - Creds: credentials.NewStaticV4(os.Getenv(accessKey), os.Getenv(secretKey), ""), - Transport: createHTTPTransport(), - Secure: mustParseBool(os.Getenv(enableHTTPS)), - }) + c, err := NewClient(ClientConfig{}) if err != nil { logError(testName, function, args, startTime, "", "MinIO client v4 object creation failed", err) return } - // Enable tracing, write to stderr. - // c.TraceOn(os.Stderr) - - // Set user agent. - c.SetAppInfo("MinIO-go-FunctionalTest", appVersion) - // Generate a new random bucket name. bucketName := randString(60, rand.NewSource(time.Now().UnixNano()), "minio-go-test-") args["bucketName"] = bucketName @@ -14795,27 +13680,13 @@ func testRemoveBucketTagging() { args := map[string]interface{}{ "bucketName": "", } - // Seed random based on current time. - rand.Seed(time.Now().Unix()) - // Instantiate new minio client object. - c, err := minio.New(os.Getenv(serverEndpoint), - &minio.Options{ - Creds: credentials.NewStaticV4(os.Getenv(accessKey), os.Getenv(secretKey), ""), - Transport: createHTTPTransport(), - Secure: mustParseBool(os.Getenv(enableHTTPS)), - }) + c, err := NewClient(ClientConfig{}) if err != nil { logError(testName, function, args, startTime, "", "MinIO client v4 object creation failed", err) return } - // Enable tracing, write to stderr. - // c.TraceOn(os.Stderr) - - // Set user agent. - c.SetAppInfo("MinIO-go-FunctionalTest", appVersion) - // Generate a new random bucket name. bucketName := randString(60, rand.NewSource(time.Now().UnixNano()), "minio-go-test-") args["bucketName"] = bucketName @@ -14961,6 +13832,7 @@ func main() { testGetObjectReadAtFunctional() testGetObjectReadAtWhenEOFWasReached() testPresignedPostPolicy() + testPresignedPostPolicyWrongFile() testCopyObject() testComposeObjectErrorCases() testCompose10KSources() diff --git a/vendor/github.com/minio/minio-go/v7/pkg/credentials/assume_role.go b/vendor/github.com/minio/minio-go/v7/pkg/credentials/assume_role.go index d245bc07..cd0a641b 100644 --- a/vendor/github.com/minio/minio-go/v7/pkg/credentials/assume_role.go +++ b/vendor/github.com/minio/minio-go/v7/pkg/credentials/assume_role.go @@ -76,7 +76,8 @@ type AssumeRoleResult struct { type STSAssumeRole struct { Expiry - // Required http Client to use when connecting to MinIO STS service. + // Optional http Client to use when connecting to MinIO STS service + // (overrides default client in CredContext) Client *http.Client // STS endpoint to fetch STS credentials. @@ -108,16 +109,10 @@ type STSAssumeRoleOptions struct { // NewSTSAssumeRole returns a pointer to a new // Credentials object wrapping the STSAssumeRole. func NewSTSAssumeRole(stsEndpoint string, opts STSAssumeRoleOptions) (*Credentials, error) { - if stsEndpoint == "" { - return nil, errors.New("STS endpoint cannot be empty") - } if opts.AccessKey == "" || opts.SecretKey == "" { return nil, errors.New("AssumeRole credentials access/secretkey is mandatory") } return New(&STSAssumeRole{ - Client: &http.Client{ - Transport: http.DefaultTransport, - }, STSEndpoint: stsEndpoint, Options: opts, }), nil @@ -222,10 +217,30 @@ func getAssumeRoleCredentials(clnt *http.Client, endpoint string, opts STSAssume return a, nil } -// Retrieve retrieves credentials from the MinIO service. -// Error will be returned if the request fails. -func (m *STSAssumeRole) Retrieve() (Value, error) { - a, err := getAssumeRoleCredentials(m.Client, m.STSEndpoint, m.Options) +// RetrieveWithCredContext retrieves credentials from the MinIO service. +// Error will be returned if the request fails, optional cred context. +func (m *STSAssumeRole) RetrieveWithCredContext(cc *CredContext) (Value, error) { + if cc == nil { + cc = defaultCredContext + } + + client := m.Client + if client == nil { + client = cc.Client + } + if client == nil { + client = defaultCredContext.Client + } + + stsEndpoint := m.STSEndpoint + if stsEndpoint == "" { + stsEndpoint = cc.Endpoint + } + if stsEndpoint == "" { + return Value{}, errors.New("STS endpoint unknown") + } + + a, err := getAssumeRoleCredentials(client, stsEndpoint, m.Options) if err != nil { return Value{}, err } @@ -241,3 +256,9 @@ func (m *STSAssumeRole) Retrieve() (Value, error) { SignerType: SignatureV4, }, nil } + +// Retrieve retrieves credentials from the MinIO service. +// Error will be returned if the request fails. +func (m *STSAssumeRole) Retrieve() (Value, error) { + return m.RetrieveWithCredContext(nil) +} diff --git a/vendor/github.com/minio/minio-go/v7/pkg/credentials/chain.go b/vendor/github.com/minio/minio-go/v7/pkg/credentials/chain.go index ddccfb17..5ef3597d 100644 --- a/vendor/github.com/minio/minio-go/v7/pkg/credentials/chain.go +++ b/vendor/github.com/minio/minio-go/v7/pkg/credentials/chain.go @@ -55,6 +55,24 @@ func NewChainCredentials(providers []Provider) *Credentials { }) } +// RetrieveWithCredContext is like Retrieve with CredContext +func (c *Chain) RetrieveWithCredContext(cc *CredContext) (Value, error) { + for _, p := range c.Providers { + creds, _ := p.RetrieveWithCredContext(cc) + // Always prioritize non-anonymous providers, if any. + if creds.AccessKeyID == "" && creds.SecretAccessKey == "" { + continue + } + c.curr = p + return creds, nil + } + // At this point we have exhausted all the providers and + // are left without any credentials return anonymous. + return Value{ + SignerType: SignatureAnonymous, + }, nil +} + // Retrieve returns the credentials value, returns no credentials(anonymous) // if no credentials provider returned any value. // diff --git a/vendor/github.com/minio/minio-go/v7/pkg/credentials/credentials.go b/vendor/github.com/minio/minio-go/v7/pkg/credentials/credentials.go index 68f9b381..52aff9a5 100644 --- a/vendor/github.com/minio/minio-go/v7/pkg/credentials/credentials.go +++ b/vendor/github.com/minio/minio-go/v7/pkg/credentials/credentials.go @@ -18,6 +18,7 @@ package credentials import ( + "net/http" "sync" "time" ) @@ -30,6 +31,10 @@ const ( defaultExpiryWindow = 0.8 ) +// defaultCredContext is used when the credential context doesn't +// actually matter or the default context is suitable. +var defaultCredContext = &CredContext{Client: http.DefaultClient} + // A Value is the S3 credentials value for individual credential fields. type Value struct { // S3 Access key ID @@ -52,8 +57,17 @@ type Value struct { // Value. A provider is required to manage its own Expired state, and what to // be expired means. type Provider interface { + // RetrieveWithCredContext returns nil if it successfully retrieved the + // value. Error is returned if the value were not obtainable, or empty. + // optionally takes CredContext for additional context to retrieve credentials. + RetrieveWithCredContext(cc *CredContext) (Value, error) + // Retrieve returns nil if it successfully retrieved the value. // Error is returned if the value were not obtainable, or empty. + // + // Deprecated: Retrieve() exists for historical compatibility and should not + // be used. To get new credentials use the RetrieveWithCredContext function + // to ensure the proper context (i.e. HTTP client) will be used. Retrieve() (Value, error) // IsExpired returns if the credentials are no longer valid, and need @@ -61,6 +75,18 @@ type Provider interface { IsExpired() bool } +// CredContext is passed to the Retrieve function of a provider to provide +// some additional context to retrieve credentials. +type CredContext struct { + // Client specifies the HTTP client that should be used if an HTTP + // request is to be made to fetch the credentials. + Client *http.Client + + // Endpoint specifies the MinIO endpoint that will be used if no + // explicit endpoint is provided. + Endpoint string +} + // A Expiry provides shared expiration logic to be used by credentials // providers to implement expiry functionality. // @@ -146,16 +172,36 @@ func New(provider Provider) *Credentials { // // If Credentials.Expire() was called the credentials Value will be force // expired, and the next call to Get() will cause them to be refreshed. +// +// Deprecated: Get() exists for historical compatibility and should not be +// used. To get new credentials use the Credentials.GetWithContext function +// to ensure the proper context (i.e. HTTP client) will be used. func (c *Credentials) Get() (Value, error) { + return c.GetWithContext(nil) +} + +// GetWithContext returns the credentials value, or error if the +// credentials Value failed to be retrieved. +// +// Will return the cached credentials Value if it has not expired. If the +// credentials Value has expired the Provider's Retrieve() will be called +// to refresh the credentials. +// +// If Credentials.Expire() was called the credentials Value will be force +// expired, and the next call to Get() will cause them to be refreshed. +func (c *Credentials) GetWithContext(cc *CredContext) (Value, error) { if c == nil { return Value{}, nil } + if cc == nil { + cc = defaultCredContext + } c.Lock() defer c.Unlock() if c.isExpired() { - creds, err := c.provider.Retrieve() + creds, err := c.provider.RetrieveWithCredContext(cc) if err != nil { return Value{}, err } diff --git a/vendor/github.com/minio/minio-go/v7/pkg/credentials/env_aws.go b/vendor/github.com/minio/minio-go/v7/pkg/credentials/env_aws.go index b6e60d0e..21ab0a38 100644 --- a/vendor/github.com/minio/minio-go/v7/pkg/credentials/env_aws.go +++ b/vendor/github.com/minio/minio-go/v7/pkg/credentials/env_aws.go @@ -37,8 +37,7 @@ func NewEnvAWS() *Credentials { return New(&EnvAWS{}) } -// Retrieve retrieves the keys from the environment. -func (e *EnvAWS) Retrieve() (Value, error) { +func (e *EnvAWS) retrieve() (Value, error) { e.retrieved = false id := os.Getenv("AWS_ACCESS_KEY_ID") @@ -65,6 +64,16 @@ func (e *EnvAWS) Retrieve() (Value, error) { }, nil } +// Retrieve retrieves the keys from the environment. +func (e *EnvAWS) Retrieve() (Value, error) { + return e.retrieve() +} + +// RetrieveWithCredContext is like Retrieve (no-op input of Cred Context) +func (e *EnvAWS) RetrieveWithCredContext(_ *CredContext) (Value, error) { + return e.retrieve() +} + // IsExpired returns if the credentials have been retrieved. func (e *EnvAWS) IsExpired() bool { return !e.retrieved diff --git a/vendor/github.com/minio/minio-go/v7/pkg/credentials/env_minio.go b/vendor/github.com/minio/minio-go/v7/pkg/credentials/env_minio.go index 5bfeab14..dbfbdfce 100644 --- a/vendor/github.com/minio/minio-go/v7/pkg/credentials/env_minio.go +++ b/vendor/github.com/minio/minio-go/v7/pkg/credentials/env_minio.go @@ -38,8 +38,7 @@ func NewEnvMinio() *Credentials { return New(&EnvMinio{}) } -// Retrieve retrieves the keys from the environment. -func (e *EnvMinio) Retrieve() (Value, error) { +func (e *EnvMinio) retrieve() (Value, error) { e.retrieved = false id := os.Getenv("MINIO_ROOT_USER") @@ -62,6 +61,16 @@ func (e *EnvMinio) Retrieve() (Value, error) { }, nil } +// Retrieve retrieves the keys from the environment. +func (e *EnvMinio) Retrieve() (Value, error) { + return e.retrieve() +} + +// RetrieveWithCredContext is like Retrieve() (no-op input cred context) +func (e *EnvMinio) RetrieveWithCredContext(_ *CredContext) (Value, error) { + return e.retrieve() +} + // IsExpired returns if the credentials have been retrieved. func (e *EnvMinio) IsExpired() bool { return !e.retrieved diff --git a/vendor/github.com/minio/minio-go/v7/pkg/credentials/file_aws_credentials.go b/vendor/github.com/minio/minio-go/v7/pkg/credentials/file_aws_credentials.go index 541e1a72..0c83fc7f 100644 --- a/vendor/github.com/minio/minio-go/v7/pkg/credentials/file_aws_credentials.go +++ b/vendor/github.com/minio/minio-go/v7/pkg/credentials/file_aws_credentials.go @@ -71,9 +71,7 @@ func NewFileAWSCredentials(filename, profile string) *Credentials { }) } -// Retrieve reads and extracts the shared credentials from the current -// users home directory. -func (p *FileAWSCredentials) Retrieve() (Value, error) { +func (p *FileAWSCredentials) retrieve() (Value, error) { if p.Filename == "" { p.Filename = os.Getenv("AWS_SHARED_CREDENTIALS_FILE") if p.Filename == "" { @@ -142,6 +140,17 @@ func (p *FileAWSCredentials) Retrieve() (Value, error) { }, nil } +// Retrieve reads and extracts the shared credentials from the current +// users home directory. +func (p *FileAWSCredentials) Retrieve() (Value, error) { + return p.retrieve() +} + +// RetrieveWithCredContext is like Retrieve(), cred context is no-op for File credentials +func (p *FileAWSCredentials) RetrieveWithCredContext(_ *CredContext) (Value, error) { + return p.retrieve() +} + // loadProfiles loads from the file pointed to by shared credentials filename for profile. // The credentials retrieved from the profile will be returned or error. Error will be // returned if it fails to read from the file, or the data is invalid. diff --git a/vendor/github.com/minio/minio-go/v7/pkg/credentials/file_minio_client.go b/vendor/github.com/minio/minio-go/v7/pkg/credentials/file_minio_client.go index 750e26ff..5805281f 100644 --- a/vendor/github.com/minio/minio-go/v7/pkg/credentials/file_minio_client.go +++ b/vendor/github.com/minio/minio-go/v7/pkg/credentials/file_minio_client.go @@ -56,9 +56,7 @@ func NewFileMinioClient(filename, alias string) *Credentials { }) } -// Retrieve reads and extracts the shared credentials from the current -// users home directory. -func (p *FileMinioClient) Retrieve() (Value, error) { +func (p *FileMinioClient) retrieve() (Value, error) { if p.Filename == "" { if value, ok := os.LookupEnv("MINIO_SHARED_CREDENTIALS_FILE"); ok { p.Filename = value @@ -96,6 +94,17 @@ func (p *FileMinioClient) Retrieve() (Value, error) { }, nil } +// Retrieve reads and extracts the shared credentials from the current +// users home directory. +func (p *FileMinioClient) Retrieve() (Value, error) { + return p.retrieve() +} + +// RetrieveWithCredContext - is like Retrieve() +func (p *FileMinioClient) RetrieveWithCredContext(_ *CredContext) (Value, error) { + return p.retrieve() +} + // IsExpired returns if the shared credentials have expired. func (p *FileMinioClient) IsExpired() bool { return !p.retrieved diff --git a/vendor/github.com/minio/minio-go/v7/pkg/credentials/iam_aws.go b/vendor/github.com/minio/minio-go/v7/pkg/credentials/iam_aws.go index ea4b3ef9..e3230bb1 100644 --- a/vendor/github.com/minio/minio-go/v7/pkg/credentials/iam_aws.go +++ b/vendor/github.com/minio/minio-go/v7/pkg/credentials/iam_aws.go @@ -49,7 +49,8 @@ const DefaultExpiryWindow = -1 type IAM struct { Expiry - // Required http Client to use when connecting to IAM metadata service. + // Optional http Client to use when connecting to IAM metadata service + // (overrides default client in CredContext) Client *http.Client // Custom endpoint to fetch IAM role credentials. @@ -90,17 +91,16 @@ const ( // NewIAM returns a pointer to a new Credentials object wrapping the IAM. func NewIAM(endpoint string) *Credentials { return New(&IAM{ - Client: &http.Client{ - Transport: http.DefaultTransport, - }, Endpoint: endpoint, }) } -// Retrieve retrieves credentials from the EC2 service. -// Error will be returned if the request fails, or unable to extract -// the desired -func (m *IAM) Retrieve() (Value, error) { +// RetrieveWithCredContext is like Retrieve with Cred Context +func (m *IAM) RetrieveWithCredContext(cc *CredContext) (Value, error) { + if cc == nil { + cc = defaultCredContext + } + token := os.Getenv("AWS_CONTAINER_AUTHORIZATION_TOKEN") if token == "" { token = m.Container.AuthorizationToken @@ -144,7 +144,16 @@ func (m *IAM) Retrieve() (Value, error) { var roleCreds ec2RoleCredRespBody var err error + client := m.Client + if client == nil { + client = cc.Client + } + if client == nil { + client = defaultCredContext.Client + } + endpoint := m.Endpoint + switch { case identityFile != "": if len(endpoint) == 0 { @@ -160,7 +169,7 @@ func (m *IAM) Retrieve() (Value, error) { } creds := &STSWebIdentity{ - Client: m.Client, + Client: client, STSEndpoint: endpoint, GetWebIDTokenExpiry: func() (*WebIdentityToken, error) { token, err := os.ReadFile(identityFile) @@ -174,7 +183,7 @@ func (m *IAM) Retrieve() (Value, error) { roleSessionName: roleSessionName, } - stsWebIdentityCreds, err := creds.Retrieve() + stsWebIdentityCreds, err := creds.RetrieveWithCredContext(cc) if err == nil { m.SetExpiration(creds.Expiration(), DefaultExpiryWindow) } @@ -185,11 +194,11 @@ func (m *IAM) Retrieve() (Value, error) { endpoint = fmt.Sprintf("%s%s", DefaultECSRoleEndpoint, relativeURI) } - roleCreds, err = getEcsTaskCredentials(m.Client, endpoint, token) + roleCreds, err = getEcsTaskCredentials(client, endpoint, token) case tokenFile != "" && fullURI != "": endpoint = fullURI - roleCreds, err = getEKSPodIdentityCredentials(m.Client, endpoint, tokenFile) + roleCreds, err = getEKSPodIdentityCredentials(client, endpoint, tokenFile) case fullURI != "": if len(endpoint) == 0 { @@ -203,10 +212,10 @@ func (m *IAM) Retrieve() (Value, error) { } } - roleCreds, err = getEcsTaskCredentials(m.Client, endpoint, token) + roleCreds, err = getEcsTaskCredentials(client, endpoint, token) default: - roleCreds, err = getCredentials(m.Client, endpoint) + roleCreds, err = getCredentials(client, endpoint) } if err != nil { @@ -224,6 +233,13 @@ func (m *IAM) Retrieve() (Value, error) { }, nil } +// Retrieve retrieves credentials from the EC2 service. +// Error will be returned if the request fails, or unable to extract +// the desired +func (m *IAM) Retrieve() (Value, error) { + return m.RetrieveWithCredContext(nil) +} + // A ec2RoleCredRespBody provides the shape for unmarshaling credential // request responses. type ec2RoleCredRespBody struct { diff --git a/vendor/github.com/minio/minio-go/v7/pkg/credentials/static.go b/vendor/github.com/minio/minio-go/v7/pkg/credentials/static.go index 7dde00b0..d90c98c8 100644 --- a/vendor/github.com/minio/minio-go/v7/pkg/credentials/static.go +++ b/vendor/github.com/minio/minio-go/v7/pkg/credentials/static.go @@ -59,6 +59,11 @@ func (s *Static) Retrieve() (Value, error) { return s.Value, nil } +// RetrieveWithCredContext returns the static credentials. +func (s *Static) RetrieveWithCredContext(_ *CredContext) (Value, error) { + return s.Retrieve() +} + // IsExpired returns if the credentials are expired. // // For Static, the credentials never expired. diff --git a/vendor/github.com/minio/minio-go/v7/pkg/credentials/sts_client_grants.go b/vendor/github.com/minio/minio-go/v7/pkg/credentials/sts_client_grants.go index 62bfbb6b..ef6f436b 100644 --- a/vendor/github.com/minio/minio-go/v7/pkg/credentials/sts_client_grants.go +++ b/vendor/github.com/minio/minio-go/v7/pkg/credentials/sts_client_grants.go @@ -72,7 +72,8 @@ type ClientGrantsToken struct { type STSClientGrants struct { Expiry - // Required http Client to use when connecting to MinIO STS service. + // Optional http Client to use when connecting to MinIO STS service. + // (overrides default client in CredContext) Client *http.Client // MinIO endpoint to fetch STS credentials. @@ -90,16 +91,10 @@ type STSClientGrants struct { // NewSTSClientGrants returns a pointer to a new // Credentials object wrapping the STSClientGrants. func NewSTSClientGrants(stsEndpoint string, getClientGrantsTokenExpiry func() (*ClientGrantsToken, error)) (*Credentials, error) { - if stsEndpoint == "" { - return nil, errors.New("STS endpoint cannot be empty") - } if getClientGrantsTokenExpiry == nil { return nil, errors.New("Client grants access token and expiry retrieval function should be defined") } return New(&STSClientGrants{ - Client: &http.Client{ - Transport: http.DefaultTransport, - }, STSEndpoint: stsEndpoint, GetClientGrantsTokenExpiry: getClientGrantsTokenExpiry, }), nil @@ -162,10 +157,29 @@ func getClientGrantsCredentials(clnt *http.Client, endpoint string, return a, nil } -// Retrieve retrieves credentials from the MinIO service. -// Error will be returned if the request fails. -func (m *STSClientGrants) Retrieve() (Value, error) { - a, err := getClientGrantsCredentials(m.Client, m.STSEndpoint, m.GetClientGrantsTokenExpiry) +// RetrieveWithCredContext is like Retrieve() with cred context +func (m *STSClientGrants) RetrieveWithCredContext(cc *CredContext) (Value, error) { + if cc == nil { + cc = defaultCredContext + } + + client := m.Client + if client == nil { + client = cc.Client + } + if client == nil { + client = defaultCredContext.Client + } + + stsEndpoint := m.STSEndpoint + if stsEndpoint == "" { + stsEndpoint = cc.Endpoint + } + if stsEndpoint == "" { + return Value{}, errors.New("STS endpoint unknown") + } + + a, err := getClientGrantsCredentials(client, stsEndpoint, m.GetClientGrantsTokenExpiry) if err != nil { return Value{}, err } @@ -181,3 +195,9 @@ func (m *STSClientGrants) Retrieve() (Value, error) { SignerType: SignatureV4, }, nil } + +// Retrieve retrieves credentials from the MinIO service. +// Error will be returned if the request fails. +func (m *STSClientGrants) Retrieve() (Value, error) { + return m.RetrieveWithCredContext(nil) +} diff --git a/vendor/github.com/minio/minio-go/v7/pkg/credentials/sts_custom_identity.go b/vendor/github.com/minio/minio-go/v7/pkg/credentials/sts_custom_identity.go index 75e1a77d..0021f931 100644 --- a/vendor/github.com/minio/minio-go/v7/pkg/credentials/sts_custom_identity.go +++ b/vendor/github.com/minio/minio-go/v7/pkg/credentials/sts_custom_identity.go @@ -53,6 +53,8 @@ type AssumeRoleWithCustomTokenResponse struct { type CustomTokenIdentity struct { Expiry + // Optional http Client to use when connecting to MinIO STS service. + // (overrides default client in CredContext) Client *http.Client // MinIO server STS endpoint to fetch STS credentials. @@ -69,9 +71,21 @@ type CustomTokenIdentity struct { RequestedExpiry time.Duration } -// Retrieve - to satisfy Provider interface; fetches credentials from MinIO. -func (c *CustomTokenIdentity) Retrieve() (value Value, err error) { - u, err := url.Parse(c.STSEndpoint) +// RetrieveWithCredContext with Retrieve optionally cred context +func (c *CustomTokenIdentity) RetrieveWithCredContext(cc *CredContext) (value Value, err error) { + if cc == nil { + cc = defaultCredContext + } + + stsEndpoint := c.STSEndpoint + if stsEndpoint == "" { + stsEndpoint = cc.Endpoint + } + if stsEndpoint == "" { + return Value{}, errors.New("STS endpoint unknown") + } + + u, err := url.Parse(stsEndpoint) if err != nil { return value, err } @@ -92,7 +106,15 @@ func (c *CustomTokenIdentity) Retrieve() (value Value, err error) { return value, err } - resp, err := c.Client.Do(req) + client := c.Client + if client == nil { + client = cc.Client + } + if client == nil { + client = defaultCredContext.Client + } + + resp, err := client.Do(req) if err != nil { return value, err } @@ -118,11 +140,15 @@ func (c *CustomTokenIdentity) Retrieve() (value Value, err error) { }, nil } +// Retrieve - to satisfy Provider interface; fetches credentials from MinIO. +func (c *CustomTokenIdentity) Retrieve() (value Value, err error) { + return c.RetrieveWithCredContext(nil) +} + // NewCustomTokenCredentials - returns credentials using the // AssumeRoleWithCustomToken STS API. func NewCustomTokenCredentials(stsEndpoint, token, roleArn string, optFuncs ...CustomTokenOpt) (*Credentials, error) { c := CustomTokenIdentity{ - Client: &http.Client{Transport: http.DefaultTransport}, STSEndpoint: stsEndpoint, Token: token, RoleArn: roleArn, diff --git a/vendor/github.com/minio/minio-go/v7/pkg/credentials/sts_ldap_identity.go b/vendor/github.com/minio/minio-go/v7/pkg/credentials/sts_ldap_identity.go index b8df289f..e63997e6 100644 --- a/vendor/github.com/minio/minio-go/v7/pkg/credentials/sts_ldap_identity.go +++ b/vendor/github.com/minio/minio-go/v7/pkg/credentials/sts_ldap_identity.go @@ -20,6 +20,7 @@ package credentials import ( "bytes" "encoding/xml" + "errors" "fmt" "io" "net/http" @@ -55,7 +56,8 @@ type LDAPIdentityResult struct { type LDAPIdentity struct { Expiry - // Required http Client to use when connecting to MinIO STS service. + // Optional http Client to use when connecting to MinIO STS service. + // (overrides default client in CredContext) Client *http.Client // Exported STS endpoint to fetch STS credentials. @@ -77,7 +79,6 @@ type LDAPIdentity struct { // Identity. func NewLDAPIdentity(stsEndpoint, ldapUsername, ldapPassword string, optFuncs ...LDAPIdentityOpt) (*Credentials, error) { l := LDAPIdentity{ - Client: &http.Client{Transport: http.DefaultTransport}, STSEndpoint: stsEndpoint, LDAPUsername: ldapUsername, LDAPPassword: ldapPassword, @@ -113,7 +114,6 @@ func LDAPIdentityExpiryOpt(d time.Duration) LDAPIdentityOpt { // Deprecated: Use the `LDAPIdentityPolicyOpt` with `NewLDAPIdentity` instead. func NewLDAPIdentityWithSessionPolicy(stsEndpoint, ldapUsername, ldapPassword, policy string) (*Credentials, error) { return New(&LDAPIdentity{ - Client: &http.Client{Transport: http.DefaultTransport}, STSEndpoint: stsEndpoint, LDAPUsername: ldapUsername, LDAPPassword: ldapPassword, @@ -121,10 +121,22 @@ func NewLDAPIdentityWithSessionPolicy(stsEndpoint, ldapUsername, ldapPassword, p }), nil } -// Retrieve gets the credential by calling the MinIO STS API for +// RetrieveWithCredContext gets the credential by calling the MinIO STS API for // LDAP on the configured stsEndpoint. -func (k *LDAPIdentity) Retrieve() (value Value, err error) { - u, err := url.Parse(k.STSEndpoint) +func (k *LDAPIdentity) RetrieveWithCredContext(cc *CredContext) (value Value, err error) { + if cc == nil { + cc = defaultCredContext + } + + stsEndpoint := k.STSEndpoint + if stsEndpoint == "" { + stsEndpoint = cc.Endpoint + } + if stsEndpoint == "" { + return Value{}, errors.New("STS endpoint unknown") + } + + u, err := url.Parse(stsEndpoint) if err != nil { return value, err } @@ -148,7 +160,15 @@ func (k *LDAPIdentity) Retrieve() (value Value, err error) { req.Header.Set("Content-Type", "application/x-www-form-urlencoded") - resp, err := k.Client.Do(req) + client := k.Client + if client == nil { + client = cc.Client + } + if client == nil { + client = defaultCredContext.Client + } + + resp, err := client.Do(req) if err != nil { return value, err } @@ -188,3 +208,9 @@ func (k *LDAPIdentity) Retrieve() (value Value, err error) { SignerType: SignatureV4, }, nil } + +// Retrieve gets the credential by calling the MinIO STS API for +// LDAP on the configured stsEndpoint. +func (k *LDAPIdentity) Retrieve() (value Value, err error) { + return k.RetrieveWithCredContext(defaultCredContext) +} diff --git a/vendor/github.com/minio/minio-go/v7/pkg/credentials/sts_tls_identity.go b/vendor/github.com/minio/minio-go/v7/pkg/credentials/sts_tls_identity.go index 10083502..c904bbea 100644 --- a/vendor/github.com/minio/minio-go/v7/pkg/credentials/sts_tls_identity.go +++ b/vendor/github.com/minio/minio-go/v7/pkg/credentials/sts_tls_identity.go @@ -20,8 +20,8 @@ import ( "crypto/tls" "encoding/xml" "errors" + "fmt" "io" - "net" "net/http" "net/url" "strconv" @@ -36,7 +36,12 @@ type CertificateIdentityOption func(*STSCertificateIdentity) // CertificateIdentityWithTransport returns a CertificateIdentityOption that // customizes the STSCertificateIdentity with the given http.RoundTripper. func CertificateIdentityWithTransport(t http.RoundTripper) CertificateIdentityOption { - return CertificateIdentityOption(func(i *STSCertificateIdentity) { i.Client.Transport = t }) + return CertificateIdentityOption(func(i *STSCertificateIdentity) { + if i.Client == nil { + i.Client = &http.Client{} + } + i.Client.Transport = t + }) } // CertificateIdentityWithExpiry returns a CertificateIdentityOption that @@ -53,6 +58,10 @@ func CertificateIdentityWithExpiry(livetime time.Duration) CertificateIdentityOp type STSCertificateIdentity struct { Expiry + // Optional http Client to use when connecting to MinIO STS service. + // (overrides default client in CredContext) + Client *http.Client + // STSEndpoint is the base URL endpoint of the STS API. // For example, https://minio.local:9000 STSEndpoint string @@ -68,50 +77,18 @@ type STSCertificateIdentity struct { // The default livetime is one hour. S3CredentialLivetime time.Duration - // Client is the HTTP client used to authenticate and fetch - // S3 credentials. - // - // A custom TLS client configuration can be specified by - // using a custom http.Transport: - // Client: http.Client { - // Transport: &http.Transport{ - // TLSClientConfig: &tls.Config{}, - // }, - // } - Client http.Client + // Certificate is the client certificate that is used for + // STS authentication. + Certificate tls.Certificate } -var _ Provider = (*STSWebIdentity)(nil) // compiler check - // NewSTSCertificateIdentity returns a STSCertificateIdentity that authenticates // to the given STS endpoint with the given TLS certificate and retrieves and // rotates S3 credentials. func NewSTSCertificateIdentity(endpoint string, certificate tls.Certificate, options ...CertificateIdentityOption) (*Credentials, error) { - if endpoint == "" { - return nil, errors.New("STS endpoint cannot be empty") - } - if _, err := url.Parse(endpoint); err != nil { - return nil, err - } identity := &STSCertificateIdentity{ STSEndpoint: endpoint, - Client: http.Client{ - Transport: &http.Transport{ - Proxy: http.ProxyFromEnvironment, - DialContext: (&net.Dialer{ - Timeout: 30 * time.Second, - KeepAlive: 30 * time.Second, - }).DialContext, - ForceAttemptHTTP2: true, - MaxIdleConns: 100, - IdleConnTimeout: 90 * time.Second, - TLSHandshakeTimeout: 10 * time.Second, - ExpectContinueTimeout: 5 * time.Second, - TLSClientConfig: &tls.Config{ - Certificates: []tls.Certificate{certificate}, - }, - }, - }, + Certificate: certificate, } for _, option := range options { option(identity) @@ -119,10 +96,21 @@ func NewSTSCertificateIdentity(endpoint string, certificate tls.Certificate, opt return New(identity), nil } -// Retrieve fetches a new set of S3 credentials from the configured -// STS API endpoint. -func (i *STSCertificateIdentity) Retrieve() (Value, error) { - endpointURL, err := url.Parse(i.STSEndpoint) +// RetrieveWithCredContext is Retrieve with cred context +func (i *STSCertificateIdentity) RetrieveWithCredContext(cc *CredContext) (Value, error) { + if cc == nil { + cc = defaultCredContext + } + + stsEndpoint := i.STSEndpoint + if stsEndpoint == "" { + stsEndpoint = cc.Endpoint + } + if stsEndpoint == "" { + return Value{}, errors.New("STS endpoint unknown") + } + + endpointURL, err := url.Parse(stsEndpoint) if err != nil { return Value{}, err } @@ -145,7 +133,28 @@ func (i *STSCertificateIdentity) Retrieve() (Value, error) { } req.Form.Add("DurationSeconds", strconv.FormatUint(uint64(livetime.Seconds()), 10)) - resp, err := i.Client.Do(req) + client := i.Client + if client == nil { + client = cc.Client + } + if client == nil { + client = defaultCredContext.Client + } + + tr, ok := client.Transport.(*http.Transport) + if !ok { + return Value{}, fmt.Errorf("CredContext should contain an http.Transport value") + } + + // Clone the HTTP transport (patch the TLS client certificate) + trCopy := tr.Clone() + trCopy.TLSClientConfig.Certificates = []tls.Certificate{i.Certificate} + + // Clone the HTTP client (patch the HTTP transport) + clientCopy := *client + clientCopy.Transport = trCopy + + resp, err := clientCopy.Do(req) if err != nil { return Value{}, err } @@ -193,6 +202,11 @@ func (i *STSCertificateIdentity) Retrieve() (Value, error) { }, nil } +// Retrieve fetches a new set of S3 credentials from the configured STS API endpoint. +func (i *STSCertificateIdentity) Retrieve() (Value, error) { + return i.RetrieveWithCredContext(defaultCredContext) +} + // Expiration returns the expiration time of the current S3 credentials. func (i *STSCertificateIdentity) Expiration() time.Time { return i.expiration } diff --git a/vendor/github.com/minio/minio-go/v7/pkg/credentials/sts_web_identity.go b/vendor/github.com/minio/minio-go/v7/pkg/credentials/sts_web_identity.go index f1c76c78..23525889 100644 --- a/vendor/github.com/minio/minio-go/v7/pkg/credentials/sts_web_identity.go +++ b/vendor/github.com/minio/minio-go/v7/pkg/credentials/sts_web_identity.go @@ -58,9 +58,10 @@ type WebIdentityResult struct { // WebIdentityToken - web identity token with expiry. type WebIdentityToken struct { - Token string - AccessToken string - Expiry int + Token string + AccessToken string + RefreshToken string + Expiry int } // A STSWebIdentity retrieves credentials from MinIO service, and keeps track if @@ -68,7 +69,8 @@ type WebIdentityToken struct { type STSWebIdentity struct { Expiry - // Required http Client to use when connecting to MinIO STS service. + // Optional http Client to use when connecting to MinIO STS service. + // (overrides default client in CredContext) Client *http.Client // Exported STS endpoint to fetch STS credentials. @@ -96,16 +98,10 @@ type STSWebIdentity struct { // NewSTSWebIdentity returns a pointer to a new // Credentials object wrapping the STSWebIdentity. func NewSTSWebIdentity(stsEndpoint string, getWebIDTokenExpiry func() (*WebIdentityToken, error), opts ...func(*STSWebIdentity)) (*Credentials, error) { - if stsEndpoint == "" { - return nil, errors.New("STS endpoint cannot be empty") - } if getWebIDTokenExpiry == nil { return nil, errors.New("Web ID token and expiry retrieval function should be defined") } i := &STSWebIdentity{ - Client: &http.Client{ - Transport: http.DefaultTransport, - }, STSEndpoint: stsEndpoint, GetWebIDTokenExpiry: getWebIDTokenExpiry, } @@ -161,6 +157,10 @@ func getWebIdentityCredentials(clnt *http.Client, endpoint, roleARN, roleSession // Usually set when server is using extended userInfo endpoint. v.Set("WebIdentityAccessToken", idToken.AccessToken) } + if idToken.RefreshToken != "" { + // Usually set when server is using extended userInfo endpoint. + v.Set("WebIdentityRefreshToken", idToken.RefreshToken) + } if idToken.Expiry > 0 { v.Set("DurationSeconds", fmt.Sprintf("%d", idToken.Expiry)) } @@ -214,10 +214,29 @@ func getWebIdentityCredentials(clnt *http.Client, endpoint, roleARN, roleSession return a, nil } -// Retrieve retrieves credentials from the MinIO service. -// Error will be returned if the request fails. -func (m *STSWebIdentity) Retrieve() (Value, error) { - a, err := getWebIdentityCredentials(m.Client, m.STSEndpoint, m.RoleARN, m.roleSessionName, m.Policy, m.GetWebIDTokenExpiry) +// RetrieveWithCredContext is like Retrieve with optional cred context. +func (m *STSWebIdentity) RetrieveWithCredContext(cc *CredContext) (Value, error) { + if cc == nil { + cc = defaultCredContext + } + + client := m.Client + if client == nil { + client = cc.Client + } + if client == nil { + client = defaultCredContext.Client + } + + stsEndpoint := m.STSEndpoint + if stsEndpoint == "" { + stsEndpoint = cc.Endpoint + } + if stsEndpoint == "" { + return Value{}, errors.New("STS endpoint unknown") + } + + a, err := getWebIdentityCredentials(client, stsEndpoint, m.RoleARN, m.roleSessionName, m.Policy, m.GetWebIDTokenExpiry) if err != nil { return Value{}, err } @@ -234,6 +253,12 @@ func (m *STSWebIdentity) Retrieve() (Value, error) { }, nil } +// Retrieve retrieves credentials from the MinIO service. +// Error will be returned if the request fails. +func (m *STSWebIdentity) Retrieve() (Value, error) { + return m.RetrieveWithCredContext(nil) +} + // Expiration returns the expiration time of the credentials func (m *STSWebIdentity) Expiration() time.Time { return m.expiration diff --git a/vendor/github.com/minio/minio-go/v7/pkg/s3utils/utils.go b/vendor/github.com/minio/minio-go/v7/pkg/s3utils/utils.go index 0e63ce2f..80fd029d 100644 --- a/vendor/github.com/minio/minio-go/v7/pkg/s3utils/utils.go +++ b/vendor/github.com/minio/minio-go/v7/pkg/s3utils/utils.go @@ -118,53 +118,53 @@ func GetRegionFromURL(endpointURL url.URL) string { if endpointURL == sentinelURL { return "" } - if endpointURL.Host == "s3-external-1.amazonaws.com" { + if endpointURL.Hostname() == "s3-external-1.amazonaws.com" { return "" } // if elb's are used we cannot calculate which region it may be, just return empty. - if elbAmazonRegex.MatchString(endpointURL.Host) || elbAmazonCnRegex.MatchString(endpointURL.Host) { + if elbAmazonRegex.MatchString(endpointURL.Hostname()) || elbAmazonCnRegex.MatchString(endpointURL.Hostname()) { return "" } // We check for FIPS dualstack matching first to avoid the non-greedy // regex for FIPS non-dualstack matching a dualstack URL - parts := amazonS3HostFIPSDualStack.FindStringSubmatch(endpointURL.Host) + parts := amazonS3HostFIPSDualStack.FindStringSubmatch(endpointURL.Hostname()) if len(parts) > 1 { return parts[1] } - parts = amazonS3HostFIPS.FindStringSubmatch(endpointURL.Host) + parts = amazonS3HostFIPS.FindStringSubmatch(endpointURL.Hostname()) if len(parts) > 1 { return parts[1] } - parts = amazonS3HostDualStack.FindStringSubmatch(endpointURL.Host) + parts = amazonS3HostDualStack.FindStringSubmatch(endpointURL.Hostname()) if len(parts) > 1 { return parts[1] } - parts = amazonS3HostHyphen.FindStringSubmatch(endpointURL.Host) + parts = amazonS3HostHyphen.FindStringSubmatch(endpointURL.Hostname()) if len(parts) > 1 { return parts[1] } - parts = amazonS3ChinaHost.FindStringSubmatch(endpointURL.Host) + parts = amazonS3ChinaHost.FindStringSubmatch(endpointURL.Hostname()) if len(parts) > 1 { return parts[1] } - parts = amazonS3ChinaHostDualStack.FindStringSubmatch(endpointURL.Host) + parts = amazonS3ChinaHostDualStack.FindStringSubmatch(endpointURL.Hostname()) if len(parts) > 1 { return parts[1] } - parts = amazonS3HostDot.FindStringSubmatch(endpointURL.Host) + parts = amazonS3HostDot.FindStringSubmatch(endpointURL.Hostname()) if len(parts) > 1 { return parts[1] } - parts = amazonS3HostPrivateLink.FindStringSubmatch(endpointURL.Host) + parts = amazonS3HostPrivateLink.FindStringSubmatch(endpointURL.Hostname()) if len(parts) > 1 { return parts[1] } diff --git a/vendor/github.com/minio/minio-go/v7/post-policy.go b/vendor/github.com/minio/minio-go/v7/post-policy.go index 19687e02..26bf441b 100644 --- a/vendor/github.com/minio/minio-go/v7/post-policy.go +++ b/vendor/github.com/minio/minio-go/v7/post-policy.go @@ -85,7 +85,7 @@ func (p *PostPolicy) SetExpires(t time.Time) error { // SetKey - Sets an object name for the policy based upload. func (p *PostPolicy) SetKey(key string) error { - if strings.TrimSpace(key) == "" || key == "" { + if strings.TrimSpace(key) == "" { return errInvalidArgument("Object name is empty.") } policyCond := policyCondition{ @@ -118,7 +118,7 @@ func (p *PostPolicy) SetKeyStartsWith(keyStartsWith string) error { // SetBucket - Sets bucket at which objects will be uploaded to. func (p *PostPolicy) SetBucket(bucketName string) error { - if strings.TrimSpace(bucketName) == "" || bucketName == "" { + if strings.TrimSpace(bucketName) == "" { return errInvalidArgument("Bucket name is empty.") } policyCond := policyCondition{ @@ -135,7 +135,7 @@ func (p *PostPolicy) SetBucket(bucketName string) error { // SetCondition - Sets condition for credentials, date and algorithm func (p *PostPolicy) SetCondition(matchType, condition, value string) error { - if strings.TrimSpace(value) == "" || value == "" { + if strings.TrimSpace(value) == "" { return errInvalidArgument("No value specified for condition") } @@ -156,7 +156,7 @@ func (p *PostPolicy) SetCondition(matchType, condition, value string) error { // SetTagging - Sets tagging for the object for this policy based upload. func (p *PostPolicy) SetTagging(tagging string) error { - if strings.TrimSpace(tagging) == "" || tagging == "" { + if strings.TrimSpace(tagging) == "" { return errInvalidArgument("No tagging specified.") } _, err := tags.ParseObjectXML(strings.NewReader(tagging)) @@ -178,7 +178,7 @@ func (p *PostPolicy) SetTagging(tagging string) error { // SetContentType - Sets content-type of the object for this policy // based upload. func (p *PostPolicy) SetContentType(contentType string) error { - if strings.TrimSpace(contentType) == "" || contentType == "" { + if strings.TrimSpace(contentType) == "" { return errInvalidArgument("No content type specified.") } policyCond := policyCondition{ @@ -211,7 +211,7 @@ func (p *PostPolicy) SetContentTypeStartsWith(contentTypeStartsWith string) erro // SetContentDisposition - Sets content-disposition of the object for this policy func (p *PostPolicy) SetContentDisposition(contentDisposition string) error { - if strings.TrimSpace(contentDisposition) == "" || contentDisposition == "" { + if strings.TrimSpace(contentDisposition) == "" { return errInvalidArgument("No content disposition specified.") } policyCond := policyCondition{ @@ -226,27 +226,44 @@ func (p *PostPolicy) SetContentDisposition(contentDisposition string) error { return nil } +// SetContentEncoding - Sets content-encoding of the object for this policy +func (p *PostPolicy) SetContentEncoding(contentEncoding string) error { + if strings.TrimSpace(contentEncoding) == "" { + return errInvalidArgument("No content encoding specified.") + } + policyCond := policyCondition{ + matchType: "eq", + condition: "$Content-Encoding", + value: contentEncoding, + } + if err := p.addNewPolicy(policyCond); err != nil { + return err + } + p.formData["Content-Encoding"] = contentEncoding + return nil +} + // SetContentLengthRange - Set new min and max content length // condition for all incoming uploads. -func (p *PostPolicy) SetContentLengthRange(min, max int64) error { - if min > max { +func (p *PostPolicy) SetContentLengthRange(minLen, maxLen int64) error { + if minLen > maxLen { return errInvalidArgument("Minimum limit is larger than maximum limit.") } - if min < 0 { + if minLen < 0 { return errInvalidArgument("Minimum limit cannot be negative.") } - if max <= 0 { + if maxLen <= 0 { return errInvalidArgument("Maximum limit cannot be non-positive.") } - p.contentLengthRange.min = min - p.contentLengthRange.max = max + p.contentLengthRange.min = minLen + p.contentLengthRange.max = maxLen return nil } // SetSuccessActionRedirect - Sets the redirect success url of the object for this policy // based upload. func (p *PostPolicy) SetSuccessActionRedirect(redirect string) error { - if strings.TrimSpace(redirect) == "" || redirect == "" { + if strings.TrimSpace(redirect) == "" { return errInvalidArgument("Redirect is empty") } policyCond := policyCondition{ @@ -264,7 +281,7 @@ func (p *PostPolicy) SetSuccessActionRedirect(redirect string) error { // SetSuccessStatusAction - Sets the status success code of the object for this policy // based upload. func (p *PostPolicy) SetSuccessStatusAction(status string) error { - if strings.TrimSpace(status) == "" || status == "" { + if strings.TrimSpace(status) == "" { return errInvalidArgument("Status is empty") } policyCond := policyCondition{ @@ -282,10 +299,10 @@ func (p *PostPolicy) SetSuccessStatusAction(status string) error { // SetUserMetadata - Set user metadata as a key/value couple. // Can be retrieved through a HEAD request or an event. func (p *PostPolicy) SetUserMetadata(key, value string) error { - if strings.TrimSpace(key) == "" || key == "" { + if strings.TrimSpace(key) == "" { return errInvalidArgument("Key is empty") } - if strings.TrimSpace(value) == "" || value == "" { + if strings.TrimSpace(value) == "" { return errInvalidArgument("Value is empty") } headerName := fmt.Sprintf("x-amz-meta-%s", key) @@ -304,7 +321,7 @@ func (p *PostPolicy) SetUserMetadata(key, value string) error { // SetUserMetadataStartsWith - Set how an user metadata should starts with. // Can be retrieved through a HEAD request or an event. func (p *PostPolicy) SetUserMetadataStartsWith(key, value string) error { - if strings.TrimSpace(key) == "" || key == "" { + if strings.TrimSpace(key) == "" { return errInvalidArgument("Key is empty") } headerName := fmt.Sprintf("x-amz-meta-%s", key) @@ -321,11 +338,29 @@ func (p *PostPolicy) SetUserMetadataStartsWith(key, value string) error { } // SetChecksum sets the checksum of the request. -func (p *PostPolicy) SetChecksum(c Checksum) { +func (p *PostPolicy) SetChecksum(c Checksum) error { if c.IsSet() { p.formData[amzChecksumAlgo] = c.Type.String() p.formData[c.Type.Key()] = c.Encoded() + + policyCond := policyCondition{ + matchType: "eq", + condition: fmt.Sprintf("$%s", amzChecksumAlgo), + value: c.Type.String(), + } + if err := p.addNewPolicy(policyCond); err != nil { + return err + } + policyCond = policyCondition{ + matchType: "eq", + condition: fmt.Sprintf("$%s", c.Type.Key()), + value: c.Encoded(), + } + if err := p.addNewPolicy(policyCond); err != nil { + return err + } } + return nil } // SetEncryption - sets encryption headers for POST API diff --git a/vendor/github.com/minio/minio-go/v7/retry-continous.go b/vendor/github.com/minio/minio-go/v7/retry-continous.go index bfeea95f..81fcf16f 100644 --- a/vendor/github.com/minio/minio-go/v7/retry-continous.go +++ b/vendor/github.com/minio/minio-go/v7/retry-continous.go @@ -20,7 +20,7 @@ package minio import "time" // newRetryTimerContinous creates a timer with exponentially increasing delays forever. -func (c *Client) newRetryTimerContinous(unit, cap time.Duration, jitter float64, doneCh chan struct{}) <-chan int { +func (c *Client) newRetryTimerContinous(baseSleep, maxSleep time.Duration, jitter float64, doneCh chan struct{}) <-chan int { attemptCh := make(chan int) // normalize jitter to the range [0, 1.0] @@ -39,10 +39,10 @@ func (c *Client) newRetryTimerContinous(unit, cap time.Duration, jitter float64, if attempt > maxAttempt { attempt = maxAttempt } - // sleep = random_between(0, min(cap, base * 2 ** attempt)) - sleep := unit * time.Duration(1< cap { - sleep = cap + // sleep = random_between(0, min(maxSleep, base * 2 ** attempt)) + sleep := baseSleep * time.Duration(1< maxSleep { + sleep = maxSleep } if jitter != NoJitter { sleep -= time.Duration(c.random.Float64() * float64(sleep) * jitter) diff --git a/vendor/github.com/minio/minio-go/v7/retry.go b/vendor/github.com/minio/minio-go/v7/retry.go index d15eb590..ed954017 100644 --- a/vendor/github.com/minio/minio-go/v7/retry.go +++ b/vendor/github.com/minio/minio-go/v7/retry.go @@ -45,7 +45,7 @@ var DefaultRetryCap = time.Second // newRetryTimer creates a timer with exponentially increasing // delays until the maximum retry attempts are reached. -func (c *Client) newRetryTimer(ctx context.Context, maxRetry int, unit, cap time.Duration, jitter float64) <-chan int { +func (c *Client) newRetryTimer(ctx context.Context, maxRetry int, baseSleep, maxSleep time.Duration, jitter float64) <-chan int { attemptCh := make(chan int) // computes the exponential backoff duration according to @@ -59,10 +59,10 @@ func (c *Client) newRetryTimer(ctx context.Context, maxRetry int, unit, cap time jitter = MaxJitter } - // sleep = random_between(0, min(cap, base * 2 ** attempt)) - sleep := unit * time.Duration(1< cap { - sleep = cap + // sleep = random_between(0, min(maxSleep, base * 2 ** attempt)) + sleep := baseSleep * time.Duration(1< maxSleep { + sleep = maxSleep } if jitter != NoJitter { sleep -= time.Duration(c.random.Float64() * float64(sleep) * jitter) @@ -112,6 +112,7 @@ func isS3CodeRetryable(s3Code string) (ok bool) { // List of HTTP status codes which are retryable. var retryableHTTPStatusCodes = map[int]struct{}{ + http.StatusRequestTimeout: {}, 429: {}, // http.StatusTooManyRequests is not part of the Go 1.5 library, yet 499: {}, // client closed request, retry. A non-standard status code introduced by nginx. http.StatusInternalServerError: {}, diff --git a/vendor/github.com/minio/minio-go/v7/utils.go b/vendor/github.com/minio/minio-go/v7/utils.go index a5beb371..cd7d2c27 100644 --- a/vendor/github.com/minio/minio-go/v7/utils.go +++ b/vendor/github.com/minio/minio-go/v7/utils.go @@ -378,10 +378,11 @@ func ToObjectInfo(bucketName, objectName string, h http.Header) (ObjectInfo, err Restore: restore, // Checksum values - ChecksumCRC32: h.Get("x-amz-checksum-crc32"), - ChecksumCRC32C: h.Get("x-amz-checksum-crc32c"), - ChecksumSHA1: h.Get("x-amz-checksum-sha1"), - ChecksumSHA256: h.Get("x-amz-checksum-sha256"), + ChecksumCRC32: h.Get(ChecksumCRC32.Key()), + ChecksumCRC32C: h.Get(ChecksumCRC32C.Key()), + ChecksumSHA1: h.Get(ChecksumSHA1.Key()), + ChecksumSHA256: h.Get(ChecksumSHA256.Key()), + ChecksumCRC64NVME: h.Get(ChecksumCRC64NVME.Key()), }, nil } @@ -698,3 +699,146 @@ func (h *hashReaderWrapper) Read(p []byte) (n int, err error) { } return n, err } + +// Following is ported from C to Go in 2016 by Justin Ruggles, with minimal alteration. +// Used uint for unsigned long. Used uint32 for input arguments in order to match +// the Go hash/crc32 package. zlib CRC32 combine (https://github.com/madler/zlib) +// Modified for hash/crc64 by Klaus Post, 2024. +func gf2MatrixTimes(mat []uint64, vec uint64) uint64 { + var sum uint64 + + for vec != 0 { + if vec&1 != 0 { + sum ^= mat[0] + } + vec >>= 1 + mat = mat[1:] + } + return sum +} + +func gf2MatrixSquare(square, mat []uint64) { + if len(square) != len(mat) { + panic("square matrix size mismatch") + } + for n := range mat { + square[n] = gf2MatrixTimes(mat, mat[n]) + } +} + +// crc32Combine returns the combined CRC-32 hash value of the two passed CRC-32 +// hash values crc1 and crc2. poly represents the generator polynomial +// and len2 specifies the byte length that the crc2 hash covers. +func crc32Combine(poly uint32, crc1, crc2 uint32, len2 int64) uint32 { + // degenerate case (also disallow negative lengths) + if len2 <= 0 { + return crc1 + } + + even := make([]uint64, 32) // even-power-of-two zeros operator + odd := make([]uint64, 32) // odd-power-of-two zeros operator + + // put operator for one zero bit in odd + odd[0] = uint64(poly) // CRC-32 polynomial + row := uint64(1) + for n := 1; n < 32; n++ { + odd[n] = row + row <<= 1 + } + + // put operator for two zero bits in even + gf2MatrixSquare(even, odd) + + // put operator for four zero bits in odd + gf2MatrixSquare(odd, even) + + // apply len2 zeros to crc1 (first square will put the operator for one + // zero byte, eight zero bits, in even) + crc1n := uint64(crc1) + for { + // apply zeros operator for this bit of len2 + gf2MatrixSquare(even, odd) + if len2&1 != 0 { + crc1n = gf2MatrixTimes(even, crc1n) + } + len2 >>= 1 + + // if no more bits set, then done + if len2 == 0 { + break + } + + // another iteration of the loop with odd and even swapped + gf2MatrixSquare(odd, even) + if len2&1 != 0 { + crc1n = gf2MatrixTimes(odd, crc1n) + } + len2 >>= 1 + + // if no more bits set, then done + if len2 == 0 { + break + } + } + + // return combined crc + crc1n ^= uint64(crc2) + return uint32(crc1n) +} + +func crc64Combine(poly uint64, crc1, crc2 uint64, len2 int64) uint64 { + // degenerate case (also disallow negative lengths) + if len2 <= 0 { + return crc1 + } + + even := make([]uint64, 64) // even-power-of-two zeros operator + odd := make([]uint64, 64) // odd-power-of-two zeros operator + + // put operator for one zero bit in odd + odd[0] = poly // CRC-64 polynomial + row := uint64(1) + for n := 1; n < 64; n++ { + odd[n] = row + row <<= 1 + } + + // put operator for two zero bits in even + gf2MatrixSquare(even, odd) + + // put operator for four zero bits in odd + gf2MatrixSquare(odd, even) + + // apply len2 zeros to crc1 (first square will put the operator for one + // zero byte, eight zero bits, in even) + crc1n := crc1 + for { + // apply zeros operator for this bit of len2 + gf2MatrixSquare(even, odd) + if len2&1 != 0 { + crc1n = gf2MatrixTimes(even, crc1n) + } + len2 >>= 1 + + // if no more bits set, then done + if len2 == 0 { + break + } + + // another iteration of the loop with odd and even swapped + gf2MatrixSquare(odd, even) + if len2&1 != 0 { + crc1n = gf2MatrixTimes(odd, crc1n) + } + len2 >>= 1 + + // if no more bits set, then done + if len2 == 0 { + break + } + } + + // return combined crc + crc1n ^= crc2 + return crc1n +} diff --git a/vendor/github.com/mitchellh/mapstructure/README.md b/vendor/github.com/mitchellh/mapstructure/README.md deleted file mode 100644 index 0018dc7d..00000000 --- a/vendor/github.com/mitchellh/mapstructure/README.md +++ /dev/null @@ -1,46 +0,0 @@ -# mapstructure [![Godoc](https://godoc.org/github.com/mitchellh/mapstructure?status.svg)](https://godoc.org/github.com/mitchellh/mapstructure) - -mapstructure is a Go library for decoding generic map values to structures -and vice versa, while providing helpful error handling. - -This library is most useful when decoding values from some data stream (JSON, -Gob, etc.) where you don't _quite_ know the structure of the underlying data -until you read a part of it. You can therefore read a `map[string]interface{}` -and use this library to decode it into the proper underlying native Go -structure. - -## Installation - -Standard `go get`: - -``` -$ go get github.com/mitchellh/mapstructure -``` - -## Usage & Example - -For usage and examples see the [Godoc](http://godoc.org/github.com/mitchellh/mapstructure). - -The `Decode` function has examples associated with it there. - -## But Why?! - -Go offers fantastic standard libraries for decoding formats such as JSON. -The standard method is to have a struct pre-created, and populate that struct -from the bytes of the encoded format. This is great, but the problem is if -you have configuration or an encoding that changes slightly depending on -specific fields. For example, consider this JSON: - -```json -{ - "type": "person", - "name": "Mitchell" -} -``` - -Perhaps we can't populate a specific structure without first reading -the "type" field from the JSON. We could always do two passes over the -decoding of the JSON (reading the "type" first, and the rest later). -However, it is much simpler to just decode this into a `map[string]interface{}` -structure, read the "type" key, then use something like this library -to decode it into the proper structure. diff --git a/vendor/github.com/mitchellh/mapstructure/decode_hooks.go b/vendor/github.com/mitchellh/mapstructure/decode_hooks.go deleted file mode 100644 index 3a754ca7..00000000 --- a/vendor/github.com/mitchellh/mapstructure/decode_hooks.go +++ /dev/null @@ -1,279 +0,0 @@ -package mapstructure - -import ( - "encoding" - "errors" - "fmt" - "net" - "reflect" - "strconv" - "strings" - "time" -) - -// typedDecodeHook takes a raw DecodeHookFunc (an interface{}) and turns -// it into the proper DecodeHookFunc type, such as DecodeHookFuncType. -func typedDecodeHook(h DecodeHookFunc) DecodeHookFunc { - // Create variables here so we can reference them with the reflect pkg - var f1 DecodeHookFuncType - var f2 DecodeHookFuncKind - var f3 DecodeHookFuncValue - - // Fill in the variables into this interface and the rest is done - // automatically using the reflect package. - potential := []interface{}{f1, f2, f3} - - v := reflect.ValueOf(h) - vt := v.Type() - for _, raw := range potential { - pt := reflect.ValueOf(raw).Type() - if vt.ConvertibleTo(pt) { - return v.Convert(pt).Interface() - } - } - - return nil -} - -// DecodeHookExec executes the given decode hook. This should be used -// since it'll naturally degrade to the older backwards compatible DecodeHookFunc -// that took reflect.Kind instead of reflect.Type. -func DecodeHookExec( - raw DecodeHookFunc, - from reflect.Value, to reflect.Value) (interface{}, error) { - - switch f := typedDecodeHook(raw).(type) { - case DecodeHookFuncType: - return f(from.Type(), to.Type(), from.Interface()) - case DecodeHookFuncKind: - return f(from.Kind(), to.Kind(), from.Interface()) - case DecodeHookFuncValue: - return f(from, to) - default: - return nil, errors.New("invalid decode hook signature") - } -} - -// ComposeDecodeHookFunc creates a single DecodeHookFunc that -// automatically composes multiple DecodeHookFuncs. -// -// The composed funcs are called in order, with the result of the -// previous transformation. -func ComposeDecodeHookFunc(fs ...DecodeHookFunc) DecodeHookFunc { - return func(f reflect.Value, t reflect.Value) (interface{}, error) { - var err error - data := f.Interface() - - newFrom := f - for _, f1 := range fs { - data, err = DecodeHookExec(f1, newFrom, t) - if err != nil { - return nil, err - } - newFrom = reflect.ValueOf(data) - } - - return data, nil - } -} - -// OrComposeDecodeHookFunc executes all input hook functions until one of them returns no error. In that case its value is returned. -// If all hooks return an error, OrComposeDecodeHookFunc returns an error concatenating all error messages. -func OrComposeDecodeHookFunc(ff ...DecodeHookFunc) DecodeHookFunc { - return func(a, b reflect.Value) (interface{}, error) { - var allErrs string - var out interface{} - var err error - - for _, f := range ff { - out, err = DecodeHookExec(f, a, b) - if err != nil { - allErrs += err.Error() + "\n" - continue - } - - return out, nil - } - - return nil, errors.New(allErrs) - } -} - -// StringToSliceHookFunc returns a DecodeHookFunc that converts -// string to []string by splitting on the given sep. -func StringToSliceHookFunc(sep string) DecodeHookFunc { - return func( - f reflect.Kind, - t reflect.Kind, - data interface{}) (interface{}, error) { - if f != reflect.String || t != reflect.Slice { - return data, nil - } - - raw := data.(string) - if raw == "" { - return []string{}, nil - } - - return strings.Split(raw, sep), nil - } -} - -// StringToTimeDurationHookFunc returns a DecodeHookFunc that converts -// strings to time.Duration. -func StringToTimeDurationHookFunc() DecodeHookFunc { - return func( - f reflect.Type, - t reflect.Type, - data interface{}) (interface{}, error) { - if f.Kind() != reflect.String { - return data, nil - } - if t != reflect.TypeOf(time.Duration(5)) { - return data, nil - } - - // Convert it by parsing - return time.ParseDuration(data.(string)) - } -} - -// StringToIPHookFunc returns a DecodeHookFunc that converts -// strings to net.IP -func StringToIPHookFunc() DecodeHookFunc { - return func( - f reflect.Type, - t reflect.Type, - data interface{}) (interface{}, error) { - if f.Kind() != reflect.String { - return data, nil - } - if t != reflect.TypeOf(net.IP{}) { - return data, nil - } - - // Convert it by parsing - ip := net.ParseIP(data.(string)) - if ip == nil { - return net.IP{}, fmt.Errorf("failed parsing ip %v", data) - } - - return ip, nil - } -} - -// StringToIPNetHookFunc returns a DecodeHookFunc that converts -// strings to net.IPNet -func StringToIPNetHookFunc() DecodeHookFunc { - return func( - f reflect.Type, - t reflect.Type, - data interface{}) (interface{}, error) { - if f.Kind() != reflect.String { - return data, nil - } - if t != reflect.TypeOf(net.IPNet{}) { - return data, nil - } - - // Convert it by parsing - _, net, err := net.ParseCIDR(data.(string)) - return net, err - } -} - -// StringToTimeHookFunc returns a DecodeHookFunc that converts -// strings to time.Time. -func StringToTimeHookFunc(layout string) DecodeHookFunc { - return func( - f reflect.Type, - t reflect.Type, - data interface{}) (interface{}, error) { - if f.Kind() != reflect.String { - return data, nil - } - if t != reflect.TypeOf(time.Time{}) { - return data, nil - } - - // Convert it by parsing - return time.Parse(layout, data.(string)) - } -} - -// WeaklyTypedHook is a DecodeHookFunc which adds support for weak typing to -// the decoder. -// -// Note that this is significantly different from the WeaklyTypedInput option -// of the DecoderConfig. -func WeaklyTypedHook( - f reflect.Kind, - t reflect.Kind, - data interface{}) (interface{}, error) { - dataVal := reflect.ValueOf(data) - switch t { - case reflect.String: - switch f { - case reflect.Bool: - if dataVal.Bool() { - return "1", nil - } - return "0", nil - case reflect.Float32: - return strconv.FormatFloat(dataVal.Float(), 'f', -1, 64), nil - case reflect.Int: - return strconv.FormatInt(dataVal.Int(), 10), nil - case reflect.Slice: - dataType := dataVal.Type() - elemKind := dataType.Elem().Kind() - if elemKind == reflect.Uint8 { - return string(dataVal.Interface().([]uint8)), nil - } - case reflect.Uint: - return strconv.FormatUint(dataVal.Uint(), 10), nil - } - } - - return data, nil -} - -func RecursiveStructToMapHookFunc() DecodeHookFunc { - return func(f reflect.Value, t reflect.Value) (interface{}, error) { - if f.Kind() != reflect.Struct { - return f.Interface(), nil - } - - var i interface{} = struct{}{} - if t.Type() != reflect.TypeOf(&i).Elem() { - return f.Interface(), nil - } - - m := make(map[string]interface{}) - t.Set(reflect.ValueOf(m)) - - return f.Interface(), nil - } -} - -// TextUnmarshallerHookFunc returns a DecodeHookFunc that applies -// strings to the UnmarshalText function, when the target type -// implements the encoding.TextUnmarshaler interface -func TextUnmarshallerHookFunc() DecodeHookFuncType { - return func( - f reflect.Type, - t reflect.Type, - data interface{}) (interface{}, error) { - if f.Kind() != reflect.String { - return data, nil - } - result := reflect.New(t).Interface() - unmarshaller, ok := result.(encoding.TextUnmarshaler) - if !ok { - return data, nil - } - if err := unmarshaller.UnmarshalText([]byte(data.(string))); err != nil { - return nil, err - } - return result, nil - } -} diff --git a/vendor/github.com/mitchellh/mapstructure/error.go b/vendor/github.com/mitchellh/mapstructure/error.go deleted file mode 100644 index 47a99e5a..00000000 --- a/vendor/github.com/mitchellh/mapstructure/error.go +++ /dev/null @@ -1,50 +0,0 @@ -package mapstructure - -import ( - "errors" - "fmt" - "sort" - "strings" -) - -// Error implements the error interface and can represents multiple -// errors that occur in the course of a single decode. -type Error struct { - Errors []string -} - -func (e *Error) Error() string { - points := make([]string, len(e.Errors)) - for i, err := range e.Errors { - points[i] = fmt.Sprintf("* %s", err) - } - - sort.Strings(points) - return fmt.Sprintf( - "%d error(s) decoding:\n\n%s", - len(e.Errors), strings.Join(points, "\n")) -} - -// WrappedErrors implements the errwrap.Wrapper interface to make this -// return value more useful with the errwrap and go-multierror libraries. -func (e *Error) WrappedErrors() []error { - if e == nil { - return nil - } - - result := make([]error, len(e.Errors)) - for i, e := range e.Errors { - result[i] = errors.New(e) - } - - return result -} - -func appendErrors(errors []string, err error) []string { - switch e := err.(type) { - case *Error: - return append(errors, e.Errors...) - default: - return append(errors, e.Error()) - } -} diff --git a/vendor/github.com/prometheus/common/expfmt/encode.go b/vendor/github.com/prometheus/common/expfmt/encode.go index cf0c150c..d7f3d76f 100644 --- a/vendor/github.com/prometheus/common/expfmt/encode.go +++ b/vendor/github.com/prometheus/common/expfmt/encode.go @@ -68,7 +68,7 @@ func Negotiate(h http.Header) Format { if escapeParam := ac.Params[model.EscapingKey]; escapeParam != "" { switch Format(escapeParam) { case model.AllowUTF8, model.EscapeUnderscores, model.EscapeDots, model.EscapeValues: - escapingScheme = Format(fmt.Sprintf("; escaping=%s", escapeParam)) + escapingScheme = Format("; escaping=" + escapeParam) default: // If the escaping parameter is unknown, ignore it. } @@ -101,7 +101,7 @@ func NegotiateIncludingOpenMetrics(h http.Header) Format { if escapeParam := ac.Params[model.EscapingKey]; escapeParam != "" { switch Format(escapeParam) { case model.AllowUTF8, model.EscapeUnderscores, model.EscapeDots, model.EscapeValues: - escapingScheme = Format(fmt.Sprintf("; escaping=%s", escapeParam)) + escapingScheme = Format("; escaping=" + escapeParam) default: // If the escaping parameter is unknown, ignore it. } diff --git a/vendor/github.com/prometheus/common/expfmt/expfmt.go b/vendor/github.com/prometheus/common/expfmt/expfmt.go index d942af8e..b2688656 100644 --- a/vendor/github.com/prometheus/common/expfmt/expfmt.go +++ b/vendor/github.com/prometheus/common/expfmt/expfmt.go @@ -15,7 +15,7 @@ package expfmt import ( - "fmt" + "errors" "strings" "github.com/prometheus/common/model" @@ -109,7 +109,7 @@ func NewOpenMetricsFormat(version string) (Format, error) { if version == OpenMetricsVersion_1_0_0 { return FmtOpenMetrics_1_0_0, nil } - return FmtUnknown, fmt.Errorf("unknown open metrics version string") + return FmtUnknown, errors.New("unknown open metrics version string") } // WithEscapingScheme returns a copy of Format with the specified escaping diff --git a/vendor/github.com/prometheus/common/expfmt/openmetrics_create.go b/vendor/github.com/prometheus/common/expfmt/openmetrics_create.go index 11c8ff4b..a21ed4ec 100644 --- a/vendor/github.com/prometheus/common/expfmt/openmetrics_create.go +++ b/vendor/github.com/prometheus/common/expfmt/openmetrics_create.go @@ -38,7 +38,7 @@ type EncoderOption func(*encoderOption) // WithCreatedLines is an EncoderOption that configures the OpenMetrics encoder // to include _created lines (See -// https://github.com/OpenObservability/OpenMetrics/blob/main/specification/OpenMetrics.md#counter-1). +// https://github.com/prometheus/OpenMetrics/blob/v1.0.0/specification/OpenMetrics.md#counter-1). // Created timestamps can improve the accuracy of series reset detection, but // come with a bandwidth cost. // @@ -102,7 +102,7 @@ func WithUnit() EncoderOption { // // - According to the OM specs, the `# UNIT` line is optional, but if populated, // the unit has to be present in the metric name as its suffix: -// (see https://github.com/OpenObservability/OpenMetrics/blob/main/specification/OpenMetrics.md#unit). +// (see https://github.com/prometheus/OpenMetrics/blob/v1.0.0/specification/OpenMetrics.md#unit). // However, in order to accommodate any potential scenario where such a change in the // metric name is not desirable, the users are here given the choice of either explicitly // opt in, in case they wish for the unit to be included in the output AND in the metric name @@ -152,8 +152,8 @@ func MetricFamilyToOpenMetrics(out io.Writer, in *dto.MetricFamily, options ...E if metricType == dto.MetricType_COUNTER && strings.HasSuffix(compliantName, "_total") { compliantName = name[:len(name)-6] } - if toOM.withUnit && in.Unit != nil && !strings.HasSuffix(compliantName, fmt.Sprintf("_%s", *in.Unit)) { - compliantName = compliantName + fmt.Sprintf("_%s", *in.Unit) + if toOM.withUnit && in.Unit != nil && !strings.HasSuffix(compliantName, "_"+*in.Unit) { + compliantName = compliantName + "_" + *in.Unit } // Comments, first HELP, then TYPE. diff --git a/vendor/github.com/prometheus/common/expfmt/text_parse.go b/vendor/github.com/prometheus/common/expfmt/text_parse.go index f085a923..b4607fe4 100644 --- a/vendor/github.com/prometheus/common/expfmt/text_parse.go +++ b/vendor/github.com/prometheus/common/expfmt/text_parse.go @@ -895,7 +895,7 @@ func histogramMetricName(name string) string { func parseFloat(s string) (float64, error) { if strings.ContainsAny(s, "pP_") { - return 0, fmt.Errorf("unsupported character in float") + return 0, errors.New("unsupported character in float") } return strconv.ParseFloat(s, 64) } diff --git a/vendor/github.com/prometheus/common/model/alert.go b/vendor/github.com/prometheus/common/model/alert.go index 80d1fe94..bd3a39e3 100644 --- a/vendor/github.com/prometheus/common/model/alert.go +++ b/vendor/github.com/prometheus/common/model/alert.go @@ -14,6 +14,7 @@ package model import ( + "errors" "fmt" "time" ) @@ -89,16 +90,16 @@ func (a *Alert) StatusAt(ts time.Time) AlertStatus { // Validate checks whether the alert data is inconsistent. func (a *Alert) Validate() error { if a.StartsAt.IsZero() { - return fmt.Errorf("start time missing") + return errors.New("start time missing") } if !a.EndsAt.IsZero() && a.EndsAt.Before(a.StartsAt) { - return fmt.Errorf("start time must be before end time") + return errors.New("start time must be before end time") } if err := a.Labels.Validate(); err != nil { return fmt.Errorf("invalid label set: %w", err) } if len(a.Labels) == 0 { - return fmt.Errorf("at least one label pair required") + return errors.New("at least one label pair required") } if err := a.Annotations.Validate(); err != nil { return fmt.Errorf("invalid annotations: %w", err) diff --git a/vendor/github.com/prometheus/common/model/metric.go b/vendor/github.com/prometheus/common/model/metric.go index f50966bc..5766107c 100644 --- a/vendor/github.com/prometheus/common/model/metric.go +++ b/vendor/github.com/prometheus/common/model/metric.go @@ -14,9 +14,11 @@ package model import ( + "errors" "fmt" "regexp" "sort" + "strconv" "strings" "unicode/utf8" @@ -26,13 +28,13 @@ import ( var ( // NameValidationScheme determines the method of name validation to be used by - // all calls to IsValidMetricName() and LabelName IsValid(). Setting UTF-8 mode - // in isolation from other components that don't support UTF-8 may result in - // bugs or other undefined behavior. This value is intended to be set by - // UTF-8-aware binaries as part of their startup. To avoid need for locking, - // this value should be set once, ideally in an init(), before multiple - // goroutines are started. - NameValidationScheme = LegacyValidation + // all calls to IsValidMetricName() and LabelName IsValid(). Setting UTF-8 + // mode in isolation from other components that don't support UTF-8 may result + // in bugs or other undefined behavior. This value can be set to + // LegacyValidation during startup if a binary is not UTF-8-aware binaries. To + // avoid need for locking, this value should be set once, ideally in an + // init(), before multiple goroutines are started. + NameValidationScheme = UTF8Validation // NameEscapingScheme defines the default way that names will be escaped when // presented to systems that do not support UTF-8 names. If the Content-Type @@ -269,10 +271,6 @@ func metricNeedsEscaping(m *dto.Metric) bool { return false } -const ( - lowerhex = "0123456789abcdef" -) - // EscapeName escapes the incoming name according to the provided escaping // scheme. Depending on the rules of escaping, this may cause no change in the // string that is returned. (Especially NoEscaping, which by definition is a @@ -307,7 +305,7 @@ func EscapeName(name string, scheme EscapingScheme) string { } else if isValidLegacyRune(b, i) { escaped.WriteRune(b) } else { - escaped.WriteRune('_') + escaped.WriteString("__") } } return escaped.String() @@ -317,21 +315,15 @@ func EscapeName(name string, scheme EscapingScheme) string { } escaped.WriteString("U__") for i, b := range name { - if isValidLegacyRune(b, i) { + if b == '_' { + escaped.WriteString("__") + } else if isValidLegacyRune(b, i) { escaped.WriteRune(b) } else if !utf8.ValidRune(b) { escaped.WriteString("_FFFD_") - } else if b < 0x100 { + } else { escaped.WriteRune('_') - for s := 4; s >= 0; s -= 4 { - escaped.WriteByte(lowerhex[b>>uint(s)&0xF]) - } - escaped.WriteRune('_') - } else if b < 0x10000 { - escaped.WriteRune('_') - for s := 12; s >= 0; s -= 4 { - escaped.WriteByte(lowerhex[b>>uint(s)&0xF]) - } + escaped.WriteString(strconv.FormatInt(int64(b), 16)) escaped.WriteRune('_') } } @@ -389,8 +381,9 @@ func UnescapeName(name string, scheme EscapingScheme) string { // We think we are in a UTF-8 code, process it. var utf8Val uint for j := 0; i < len(escapedName); j++ { - // This is too many characters for a utf8 value. - if j > 4 { + // This is too many characters for a utf8 value based on the MaxRune + // value of '\U0010FFFF'. + if j >= 6 { return name } // Found a closing underscore, convert to a rune, check validity, and append. @@ -443,7 +436,7 @@ func (e EscapingScheme) String() string { func ToEscapingScheme(s string) (EscapingScheme, error) { if s == "" { - return NoEscaping, fmt.Errorf("got empty string instead of escaping scheme") + return NoEscaping, errors.New("got empty string instead of escaping scheme") } switch s { case AllowUTF8: diff --git a/vendor/github.com/prometheus/common/model/silence.go b/vendor/github.com/prometheus/common/model/silence.go index 910b0b71..8f91a970 100644 --- a/vendor/github.com/prometheus/common/model/silence.go +++ b/vendor/github.com/prometheus/common/model/silence.go @@ -15,6 +15,7 @@ package model import ( "encoding/json" + "errors" "fmt" "regexp" "time" @@ -34,7 +35,7 @@ func (m *Matcher) UnmarshalJSON(b []byte) error { } if len(m.Name) == 0 { - return fmt.Errorf("label name in matcher must not be empty") + return errors.New("label name in matcher must not be empty") } if m.IsRegex { if _, err := regexp.Compile(m.Value); err != nil { @@ -77,7 +78,7 @@ type Silence struct { // Validate returns true iff all fields of the silence have valid values. func (s *Silence) Validate() error { if len(s.Matchers) == 0 { - return fmt.Errorf("at least one matcher required") + return errors.New("at least one matcher required") } for _, m := range s.Matchers { if err := m.Validate(); err != nil { @@ -85,22 +86,22 @@ func (s *Silence) Validate() error { } } if s.StartsAt.IsZero() { - return fmt.Errorf("start time missing") + return errors.New("start time missing") } if s.EndsAt.IsZero() { - return fmt.Errorf("end time missing") + return errors.New("end time missing") } if s.EndsAt.Before(s.StartsAt) { - return fmt.Errorf("start time must be before end time") + return errors.New("start time must be before end time") } if s.CreatedBy == "" { - return fmt.Errorf("creator information missing") + return errors.New("creator information missing") } if s.Comment == "" { - return fmt.Errorf("comment missing") + return errors.New("comment missing") } if s.CreatedAt.IsZero() { - return fmt.Errorf("creation timestamp missing") + return errors.New("creation timestamp missing") } return nil } diff --git a/vendor/github.com/prometheus/common/model/value_float.go b/vendor/github.com/prometheus/common/model/value_float.go index ae35cc2a..6bfc757d 100644 --- a/vendor/github.com/prometheus/common/model/value_float.go +++ b/vendor/github.com/prometheus/common/model/value_float.go @@ -15,6 +15,7 @@ package model import ( "encoding/json" + "errors" "fmt" "math" "strconv" @@ -39,7 +40,7 @@ func (v SampleValue) MarshalJSON() ([]byte, error) { // UnmarshalJSON implements json.Unmarshaler. func (v *SampleValue) UnmarshalJSON(b []byte) error { if len(b) < 2 || b[0] != '"' || b[len(b)-1] != '"' { - return fmt.Errorf("sample value must be a quoted string") + return errors.New("sample value must be a quoted string") } f, err := strconv.ParseFloat(string(b[1:len(b)-1]), 64) if err != nil { diff --git a/vendor/github.com/prometheus/common/model/value_histogram.go b/vendor/github.com/prometheus/common/model/value_histogram.go index 54bb038c..895e6a3e 100644 --- a/vendor/github.com/prometheus/common/model/value_histogram.go +++ b/vendor/github.com/prometheus/common/model/value_histogram.go @@ -15,6 +15,7 @@ package model import ( "encoding/json" + "errors" "fmt" "strconv" "strings" @@ -32,7 +33,7 @@ func (v FloatString) MarshalJSON() ([]byte, error) { func (v *FloatString) UnmarshalJSON(b []byte) error { if len(b) < 2 || b[0] != '"' || b[len(b)-1] != '"' { - return fmt.Errorf("float value must be a quoted string") + return errors.New("float value must be a quoted string") } f, err := strconv.ParseFloat(string(b[1:len(b)-1]), 64) if err != nil { @@ -141,7 +142,7 @@ type SampleHistogramPair struct { func (s SampleHistogramPair) MarshalJSON() ([]byte, error) { if s.Histogram == nil { - return nil, fmt.Errorf("histogram is nil") + return nil, errors.New("histogram is nil") } t, err := json.Marshal(s.Timestamp) if err != nil { @@ -164,7 +165,7 @@ func (s *SampleHistogramPair) UnmarshalJSON(buf []byte) error { return fmt.Errorf("wrong number of fields: %d != %d", gotLen, wantLen) } if s.Histogram == nil { - return fmt.Errorf("histogram is null") + return errors.New("histogram is null") } return nil } diff --git a/vendor/github.com/puzpuzpuz/xsync/v3/README.md b/vendor/github.com/puzpuzpuz/xsync/v3/README.md index 6fe04976..dac831b1 100644 --- a/vendor/github.com/puzpuzpuz/xsync/v3/README.md +++ b/vendor/github.com/puzpuzpuz/xsync/v3/README.md @@ -80,7 +80,14 @@ m.Store(Point{42, 42}, 42) v, ok := m.Load(point{42, 42}) ``` -Both maps use the built-in Golang's hash function which has DDOS protection. This means that each map instance gets its own seed number and the hash function uses that seed for hash code calculation. However, for smaller keys this hash function has some overhead. So, if you don't need DDOS protection, you may provide a custom hash function when creating a `MapOf`. For instance, Murmur3 finalizer does a decent job when it comes to integers: +Apart from `Range` method available for map iteration, there are also `ToPlainMap`/`ToPlainMapOf` utility functions to convert a `Map`/`MapOf` to a built-in Go's `map`: +```go +m := xsync.NewMapOf[int, int]() +m.Store(42, 42) +pm := xsync.ToPlainMapOf(m) +``` + +Both `Map` and `MapOf` use the built-in Golang's hash function which has DDOS protection. This means that each map instance gets its own seed number and the hash function uses that seed for hash code calculation. However, for smaller keys this hash function has some overhead. So, if you don't need DDOS protection, you may provide a custom hash function when creating a `MapOf`. For instance, Murmur3 finalizer does a decent job when it comes to integers: ```go m := NewMapOfWithHasher[int, int](func(i int, _ uint64) uint64 { diff --git a/vendor/github.com/puzpuzpuz/xsync/v3/map.go b/vendor/github.com/puzpuzpuz/xsync/v3/map.go index 6c5b6ebd..092aa0b9 100644 --- a/vendor/github.com/puzpuzpuz/xsync/v3/map.go +++ b/vendor/github.com/puzpuzpuz/xsync/v3/map.go @@ -200,6 +200,21 @@ func newMapTable(minTableLen int) *mapTable { return t } +// ToPlainMap returns a native map with a copy of xsync Map's +// contents. The copied xsync Map should not be modified while +// this call is made. If the copied Map is modified, the copying +// behavior is the same as in the Range method. +func ToPlainMap(m *Map) map[string]interface{} { + pm := make(map[string]interface{}) + if m != nil { + m.Range(func(key string, value interface{}) bool { + pm[key] = value + return true + }) + } + return pm +} + // Load returns the value stored in the map for a key, or nil if no // value is present. // The ok result indicates whether value was found in the map. diff --git a/vendor/github.com/puzpuzpuz/xsync/v3/mapof.go b/vendor/github.com/puzpuzpuz/xsync/v3/mapof.go index 4c4ad086..9d8105e2 100644 --- a/vendor/github.com/puzpuzpuz/xsync/v3/mapof.go +++ b/vendor/github.com/puzpuzpuz/xsync/v3/mapof.go @@ -149,6 +149,21 @@ func newMapOfTable[K comparable, V any](minTableLen int) *mapOfTable[K, V] { return t } +// ToPlainMapOf returns a native map with a copy of xsync Map's +// contents. The copied xsync Map should not be modified while +// this call is made. If the copied Map is modified, the copying +// behavior is the same as in the Range method. +func ToPlainMapOf[K comparable, V any](m *MapOf[K, V]) map[K]V { + pm := make(map[K]V) + if m != nil { + m.Range(func(key K, value V) bool { + pm[key] = value + return true + }) + } + return pm +} + // Load returns the value stored in the map for a key, or zero value // of type V if no value is present. // The ok result indicates whether value was found in the map. diff --git a/vendor/github.com/stretchr/testify/assert/assertion_compare.go b/vendor/github.com/stretchr/testify/assert/assertion_compare.go index 4d4b4aad..7e19eba0 100644 --- a/vendor/github.com/stretchr/testify/assert/assertion_compare.go +++ b/vendor/github.com/stretchr/testify/assert/assertion_compare.go @@ -7,10 +7,13 @@ import ( "time" ) -type CompareType int +// Deprecated: CompareType has only ever been for internal use and has accidentally been published since v1.6.0. Do not use it. +type CompareType = compareResult + +type compareResult int const ( - compareLess CompareType = iota - 1 + compareLess compareResult = iota - 1 compareEqual compareGreater ) @@ -39,7 +42,7 @@ var ( bytesType = reflect.TypeOf([]byte{}) ) -func compare(obj1, obj2 interface{}, kind reflect.Kind) (CompareType, bool) { +func compare(obj1, obj2 interface{}, kind reflect.Kind) (compareResult, bool) { obj1Value := reflect.ValueOf(obj1) obj2Value := reflect.ValueOf(obj2) @@ -325,7 +328,13 @@ func compare(obj1, obj2 interface{}, kind reflect.Kind) (CompareType, bool) { timeObj2 = obj2Value.Convert(timeType).Interface().(time.Time) } - return compare(timeObj1.UnixNano(), timeObj2.UnixNano(), reflect.Int64) + if timeObj1.Before(timeObj2) { + return compareLess, true + } + if timeObj1.Equal(timeObj2) { + return compareEqual, true + } + return compareGreater, true } case reflect.Slice: { @@ -345,7 +354,7 @@ func compare(obj1, obj2 interface{}, kind reflect.Kind) (CompareType, bool) { bytesObj2 = obj2Value.Convert(bytesType).Interface().([]byte) } - return CompareType(bytes.Compare(bytesObj1, bytesObj2)), true + return compareResult(bytes.Compare(bytesObj1, bytesObj2)), true } case reflect.Uintptr: { @@ -381,7 +390,7 @@ func Greater(t TestingT, e1 interface{}, e2 interface{}, msgAndArgs ...interface if h, ok := t.(tHelper); ok { h.Helper() } - return compareTwoValues(t, e1, e2, []CompareType{compareGreater}, "\"%v\" is not greater than \"%v\"", msgAndArgs...) + return compareTwoValues(t, e1, e2, []compareResult{compareGreater}, "\"%v\" is not greater than \"%v\"", msgAndArgs...) } // GreaterOrEqual asserts that the first element is greater than or equal to the second @@ -394,7 +403,7 @@ func GreaterOrEqual(t TestingT, e1 interface{}, e2 interface{}, msgAndArgs ...in if h, ok := t.(tHelper); ok { h.Helper() } - return compareTwoValues(t, e1, e2, []CompareType{compareGreater, compareEqual}, "\"%v\" is not greater than or equal to \"%v\"", msgAndArgs...) + return compareTwoValues(t, e1, e2, []compareResult{compareGreater, compareEqual}, "\"%v\" is not greater than or equal to \"%v\"", msgAndArgs...) } // Less asserts that the first element is less than the second @@ -406,7 +415,7 @@ func Less(t TestingT, e1 interface{}, e2 interface{}, msgAndArgs ...interface{}) if h, ok := t.(tHelper); ok { h.Helper() } - return compareTwoValues(t, e1, e2, []CompareType{compareLess}, "\"%v\" is not less than \"%v\"", msgAndArgs...) + return compareTwoValues(t, e1, e2, []compareResult{compareLess}, "\"%v\" is not less than \"%v\"", msgAndArgs...) } // LessOrEqual asserts that the first element is less than or equal to the second @@ -419,7 +428,7 @@ func LessOrEqual(t TestingT, e1 interface{}, e2 interface{}, msgAndArgs ...inter if h, ok := t.(tHelper); ok { h.Helper() } - return compareTwoValues(t, e1, e2, []CompareType{compareLess, compareEqual}, "\"%v\" is not less than or equal to \"%v\"", msgAndArgs...) + return compareTwoValues(t, e1, e2, []compareResult{compareLess, compareEqual}, "\"%v\" is not less than or equal to \"%v\"", msgAndArgs...) } // Positive asserts that the specified element is positive @@ -431,7 +440,7 @@ func Positive(t TestingT, e interface{}, msgAndArgs ...interface{}) bool { h.Helper() } zero := reflect.Zero(reflect.TypeOf(e)) - return compareTwoValues(t, e, zero.Interface(), []CompareType{compareGreater}, "\"%v\" is not positive", msgAndArgs...) + return compareTwoValues(t, e, zero.Interface(), []compareResult{compareGreater}, "\"%v\" is not positive", msgAndArgs...) } // Negative asserts that the specified element is negative @@ -443,10 +452,10 @@ func Negative(t TestingT, e interface{}, msgAndArgs ...interface{}) bool { h.Helper() } zero := reflect.Zero(reflect.TypeOf(e)) - return compareTwoValues(t, e, zero.Interface(), []CompareType{compareLess}, "\"%v\" is not negative", msgAndArgs...) + return compareTwoValues(t, e, zero.Interface(), []compareResult{compareLess}, "\"%v\" is not negative", msgAndArgs...) } -func compareTwoValues(t TestingT, e1 interface{}, e2 interface{}, allowedComparesResults []CompareType, failMessage string, msgAndArgs ...interface{}) bool { +func compareTwoValues(t TestingT, e1 interface{}, e2 interface{}, allowedComparesResults []compareResult, failMessage string, msgAndArgs ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() } @@ -469,7 +478,7 @@ func compareTwoValues(t TestingT, e1 interface{}, e2 interface{}, allowedCompare return true } -func containsValue(values []CompareType, value CompareType) bool { +func containsValue(values []compareResult, value compareResult) bool { for _, v := range values { if v == value { return true diff --git a/vendor/github.com/stretchr/testify/assert/assertion_format.go b/vendor/github.com/stretchr/testify/assert/assertion_format.go index 3ddab109..19063416 100644 --- a/vendor/github.com/stretchr/testify/assert/assertion_format.go +++ b/vendor/github.com/stretchr/testify/assert/assertion_format.go @@ -104,8 +104,8 @@ func EqualExportedValuesf(t TestingT, expected interface{}, actual interface{}, return EqualExportedValues(t, expected, actual, append([]interface{}{msg}, args...)...) } -// EqualValuesf asserts that two objects are equal or convertible to the same types -// and equal. +// EqualValuesf asserts that two objects are equal or convertible to the larger +// type and equal. // // assert.EqualValuesf(t, uint32(123), int32(123), "error message %s", "formatted") func EqualValuesf(t TestingT, expected interface{}, actual interface{}, msg string, args ...interface{}) bool { @@ -186,7 +186,7 @@ func Eventuallyf(t TestingT, condition func() bool, waitFor time.Duration, tick // assert.EventuallyWithTf(t, func(c *assert.CollectT, "error message %s", "formatted") { // // add assertions as needed; any assertion failure will fail the current tick // assert.True(c, externalValue, "expected 'externalValue' to be true") -// }, 1*time.Second, 10*time.Second, "external state has not changed to 'true'; still false") +// }, 10*time.Second, 1*time.Second, "external state has not changed to 'true'; still false") func EventuallyWithTf(t TestingT, condition func(collect *CollectT), waitFor time.Duration, tick time.Duration, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() @@ -568,6 +568,23 @@ func NotContainsf(t TestingT, s interface{}, contains interface{}, msg string, a return NotContains(t, s, contains, append([]interface{}{msg}, args...)...) } +// NotElementsMatchf asserts that the specified listA(array, slice...) is NOT equal to specified +// listB(array, slice...) ignoring the order of the elements. If there are duplicate elements, +// the number of appearances of each of them in both lists should not match. +// This is an inverse of ElementsMatch. +// +// assert.NotElementsMatchf(t, [1, 1, 2, 3], [1, 1, 2, 3], "error message %s", "formatted") -> false +// +// assert.NotElementsMatchf(t, [1, 1, 2, 3], [1, 2, 3], "error message %s", "formatted") -> true +// +// assert.NotElementsMatchf(t, [1, 2, 3], [1, 2, 4], "error message %s", "formatted") -> true +func NotElementsMatchf(t TestingT, listA interface{}, listB interface{}, msg string, args ...interface{}) bool { + if h, ok := t.(tHelper); ok { + h.Helper() + } + return NotElementsMatch(t, listA, listB, append([]interface{}{msg}, args...)...) +} + // NotEmptyf asserts that the specified object is NOT empty. I.e. not nil, "", false, 0 or either // a slice or a channel with len == 0. // @@ -604,7 +621,16 @@ func NotEqualValuesf(t TestingT, expected interface{}, actual interface{}, msg s return NotEqualValues(t, expected, actual, append([]interface{}{msg}, args...)...) } -// NotErrorIsf asserts that at none of the errors in err's chain matches target. +// NotErrorAsf asserts that none of the errors in err's chain matches target, +// but if so, sets target to that error value. +func NotErrorAsf(t TestingT, err error, target interface{}, msg string, args ...interface{}) bool { + if h, ok := t.(tHelper); ok { + h.Helper() + } + return NotErrorAs(t, err, target, append([]interface{}{msg}, args...)...) +} + +// NotErrorIsf asserts that none of the errors in err's chain matches target. // This is a wrapper for errors.Is. func NotErrorIsf(t TestingT, err error, target error, msg string, args ...interface{}) bool { if h, ok := t.(tHelper); ok { diff --git a/vendor/github.com/stretchr/testify/assert/assertion_forward.go b/vendor/github.com/stretchr/testify/assert/assertion_forward.go index a84e09bd..21629087 100644 --- a/vendor/github.com/stretchr/testify/assert/assertion_forward.go +++ b/vendor/github.com/stretchr/testify/assert/assertion_forward.go @@ -186,8 +186,8 @@ func (a *Assertions) EqualExportedValuesf(expected interface{}, actual interface return EqualExportedValuesf(a.t, expected, actual, msg, args...) } -// EqualValues asserts that two objects are equal or convertible to the same types -// and equal. +// EqualValues asserts that two objects are equal or convertible to the larger +// type and equal. // // a.EqualValues(uint32(123), int32(123)) func (a *Assertions) EqualValues(expected interface{}, actual interface{}, msgAndArgs ...interface{}) bool { @@ -197,8 +197,8 @@ func (a *Assertions) EqualValues(expected interface{}, actual interface{}, msgAn return EqualValues(a.t, expected, actual, msgAndArgs...) } -// EqualValuesf asserts that two objects are equal or convertible to the same types -// and equal. +// EqualValuesf asserts that two objects are equal or convertible to the larger +// type and equal. // // a.EqualValuesf(uint32(123), int32(123), "error message %s", "formatted") func (a *Assertions) EqualValuesf(expected interface{}, actual interface{}, msg string, args ...interface{}) bool { @@ -336,7 +336,7 @@ func (a *Assertions) Eventually(condition func() bool, waitFor time.Duration, ti // a.EventuallyWithT(func(c *assert.CollectT) { // // add assertions as needed; any assertion failure will fail the current tick // assert.True(c, externalValue, "expected 'externalValue' to be true") -// }, 1*time.Second, 10*time.Second, "external state has not changed to 'true'; still false") +// }, 10*time.Second, 1*time.Second, "external state has not changed to 'true'; still false") func (a *Assertions) EventuallyWithT(condition func(collect *CollectT), waitFor time.Duration, tick time.Duration, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -361,7 +361,7 @@ func (a *Assertions) EventuallyWithT(condition func(collect *CollectT), waitFor // a.EventuallyWithTf(func(c *assert.CollectT, "error message %s", "formatted") { // // add assertions as needed; any assertion failure will fail the current tick // assert.True(c, externalValue, "expected 'externalValue' to be true") -// }, 1*time.Second, 10*time.Second, "external state has not changed to 'true'; still false") +// }, 10*time.Second, 1*time.Second, "external state has not changed to 'true'; still false") func (a *Assertions) EventuallyWithTf(condition func(collect *CollectT), waitFor time.Duration, tick time.Duration, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1128,6 +1128,40 @@ func (a *Assertions) NotContainsf(s interface{}, contains interface{}, msg strin return NotContainsf(a.t, s, contains, msg, args...) } +// NotElementsMatch asserts that the specified listA(array, slice...) is NOT equal to specified +// listB(array, slice...) ignoring the order of the elements. If there are duplicate elements, +// the number of appearances of each of them in both lists should not match. +// This is an inverse of ElementsMatch. +// +// a.NotElementsMatch([1, 1, 2, 3], [1, 1, 2, 3]) -> false +// +// a.NotElementsMatch([1, 1, 2, 3], [1, 2, 3]) -> true +// +// a.NotElementsMatch([1, 2, 3], [1, 2, 4]) -> true +func (a *Assertions) NotElementsMatch(listA interface{}, listB interface{}, msgAndArgs ...interface{}) bool { + if h, ok := a.t.(tHelper); ok { + h.Helper() + } + return NotElementsMatch(a.t, listA, listB, msgAndArgs...) +} + +// NotElementsMatchf asserts that the specified listA(array, slice...) is NOT equal to specified +// listB(array, slice...) ignoring the order of the elements. If there are duplicate elements, +// the number of appearances of each of them in both lists should not match. +// This is an inverse of ElementsMatch. +// +// a.NotElementsMatchf([1, 1, 2, 3], [1, 1, 2, 3], "error message %s", "formatted") -> false +// +// a.NotElementsMatchf([1, 1, 2, 3], [1, 2, 3], "error message %s", "formatted") -> true +// +// a.NotElementsMatchf([1, 2, 3], [1, 2, 4], "error message %s", "formatted") -> true +func (a *Assertions) NotElementsMatchf(listA interface{}, listB interface{}, msg string, args ...interface{}) bool { + if h, ok := a.t.(tHelper); ok { + h.Helper() + } + return NotElementsMatchf(a.t, listA, listB, msg, args...) +} + // NotEmpty asserts that the specified object is NOT empty. I.e. not nil, "", false, 0 or either // a slice or a channel with len == 0. // @@ -1200,7 +1234,25 @@ func (a *Assertions) NotEqualf(expected interface{}, actual interface{}, msg str return NotEqualf(a.t, expected, actual, msg, args...) } -// NotErrorIs asserts that at none of the errors in err's chain matches target. +// NotErrorAs asserts that none of the errors in err's chain matches target, +// but if so, sets target to that error value. +func (a *Assertions) NotErrorAs(err error, target interface{}, msgAndArgs ...interface{}) bool { + if h, ok := a.t.(tHelper); ok { + h.Helper() + } + return NotErrorAs(a.t, err, target, msgAndArgs...) +} + +// NotErrorAsf asserts that none of the errors in err's chain matches target, +// but if so, sets target to that error value. +func (a *Assertions) NotErrorAsf(err error, target interface{}, msg string, args ...interface{}) bool { + if h, ok := a.t.(tHelper); ok { + h.Helper() + } + return NotErrorAsf(a.t, err, target, msg, args...) +} + +// NotErrorIs asserts that none of the errors in err's chain matches target. // This is a wrapper for errors.Is. func (a *Assertions) NotErrorIs(err error, target error, msgAndArgs ...interface{}) bool { if h, ok := a.t.(tHelper); ok { @@ -1209,7 +1261,7 @@ func (a *Assertions) NotErrorIs(err error, target error, msgAndArgs ...interface return NotErrorIs(a.t, err, target, msgAndArgs...) } -// NotErrorIsf asserts that at none of the errors in err's chain matches target. +// NotErrorIsf asserts that none of the errors in err's chain matches target. // This is a wrapper for errors.Is. func (a *Assertions) NotErrorIsf(err error, target error, msg string, args ...interface{}) bool { if h, ok := a.t.(tHelper); ok { diff --git a/vendor/github.com/stretchr/testify/assert/assertion_order.go b/vendor/github.com/stretchr/testify/assert/assertion_order.go index 00df62a0..1d2f7182 100644 --- a/vendor/github.com/stretchr/testify/assert/assertion_order.go +++ b/vendor/github.com/stretchr/testify/assert/assertion_order.go @@ -6,7 +6,7 @@ import ( ) // isOrdered checks that collection contains orderable elements. -func isOrdered(t TestingT, object interface{}, allowedComparesResults []CompareType, failMessage string, msgAndArgs ...interface{}) bool { +func isOrdered(t TestingT, object interface{}, allowedComparesResults []compareResult, failMessage string, msgAndArgs ...interface{}) bool { objKind := reflect.TypeOf(object).Kind() if objKind != reflect.Slice && objKind != reflect.Array { return false @@ -50,7 +50,7 @@ func isOrdered(t TestingT, object interface{}, allowedComparesResults []CompareT // assert.IsIncreasing(t, []float{1, 2}) // assert.IsIncreasing(t, []string{"a", "b"}) func IsIncreasing(t TestingT, object interface{}, msgAndArgs ...interface{}) bool { - return isOrdered(t, object, []CompareType{compareLess}, "\"%v\" is not less than \"%v\"", msgAndArgs...) + return isOrdered(t, object, []compareResult{compareLess}, "\"%v\" is not less than \"%v\"", msgAndArgs...) } // IsNonIncreasing asserts that the collection is not increasing @@ -59,7 +59,7 @@ func IsIncreasing(t TestingT, object interface{}, msgAndArgs ...interface{}) boo // assert.IsNonIncreasing(t, []float{2, 1}) // assert.IsNonIncreasing(t, []string{"b", "a"}) func IsNonIncreasing(t TestingT, object interface{}, msgAndArgs ...interface{}) bool { - return isOrdered(t, object, []CompareType{compareEqual, compareGreater}, "\"%v\" is not greater than or equal to \"%v\"", msgAndArgs...) + return isOrdered(t, object, []compareResult{compareEqual, compareGreater}, "\"%v\" is not greater than or equal to \"%v\"", msgAndArgs...) } // IsDecreasing asserts that the collection is decreasing @@ -68,7 +68,7 @@ func IsNonIncreasing(t TestingT, object interface{}, msgAndArgs ...interface{}) // assert.IsDecreasing(t, []float{2, 1}) // assert.IsDecreasing(t, []string{"b", "a"}) func IsDecreasing(t TestingT, object interface{}, msgAndArgs ...interface{}) bool { - return isOrdered(t, object, []CompareType{compareGreater}, "\"%v\" is not greater than \"%v\"", msgAndArgs...) + return isOrdered(t, object, []compareResult{compareGreater}, "\"%v\" is not greater than \"%v\"", msgAndArgs...) } // IsNonDecreasing asserts that the collection is not decreasing @@ -77,5 +77,5 @@ func IsDecreasing(t TestingT, object interface{}, msgAndArgs ...interface{}) boo // assert.IsNonDecreasing(t, []float{1, 2}) // assert.IsNonDecreasing(t, []string{"a", "b"}) func IsNonDecreasing(t TestingT, object interface{}, msgAndArgs ...interface{}) bool { - return isOrdered(t, object, []CompareType{compareLess, compareEqual}, "\"%v\" is not less than or equal to \"%v\"", msgAndArgs...) + return isOrdered(t, object, []compareResult{compareLess, compareEqual}, "\"%v\" is not less than or equal to \"%v\"", msgAndArgs...) } diff --git a/vendor/github.com/stretchr/testify/assert/assertions.go b/vendor/github.com/stretchr/testify/assert/assertions.go index 0b7570f2..4e91332b 100644 --- a/vendor/github.com/stretchr/testify/assert/assertions.go +++ b/vendor/github.com/stretchr/testify/assert/assertions.go @@ -19,7 +19,9 @@ import ( "github.com/davecgh/go-spew/spew" "github.com/pmezard/go-difflib/difflib" - "gopkg.in/yaml.v3" + + // Wrapper around gopkg.in/yaml.v3 + "github.com/stretchr/testify/assert/yaml" ) //go:generate sh -c "cd ../_codegen && go build && cd - && ../_codegen/_codegen -output-package=assert -template=assertion_format.go.tmpl" @@ -45,6 +47,10 @@ type BoolAssertionFunc func(TestingT, bool, ...interface{}) bool // for table driven tests. type ErrorAssertionFunc func(TestingT, error, ...interface{}) bool +// PanicAssertionFunc is a common function prototype when validating a panic value. Can be useful +// for table driven tests. +type PanicAssertionFunc = func(t TestingT, f PanicTestFunc, msgAndArgs ...interface{}) bool + // Comparison is a custom function that returns true on success and false on failure type Comparison func() (success bool) @@ -496,7 +502,13 @@ func Same(t TestingT, expected, actual interface{}, msgAndArgs ...interface{}) b h.Helper() } - if !samePointers(expected, actual) { + same, ok := samePointers(expected, actual) + if !ok { + return Fail(t, "Both arguments must be pointers", msgAndArgs...) + } + + if !same { + // both are pointers but not the same type & pointing to the same address return Fail(t, fmt.Sprintf("Not same: \n"+ "expected: %p %#v\n"+ "actual : %p %#v", expected, expected, actual, actual), msgAndArgs...) @@ -516,7 +528,13 @@ func NotSame(t TestingT, expected, actual interface{}, msgAndArgs ...interface{} h.Helper() } - if samePointers(expected, actual) { + same, ok := samePointers(expected, actual) + if !ok { + //fails when the arguments are not pointers + return !(Fail(t, "Both arguments must be pointers", msgAndArgs...)) + } + + if same { return Fail(t, fmt.Sprintf( "Expected and actual point to the same object: %p %#v", expected, expected), msgAndArgs...) @@ -524,21 +542,23 @@ func NotSame(t TestingT, expected, actual interface{}, msgAndArgs ...interface{} return true } -// samePointers compares two generic interface objects and returns whether -// they point to the same object -func samePointers(first, second interface{}) bool { +// samePointers checks if two generic interface objects are pointers of the same +// type pointing to the same object. It returns two values: same indicating if +// they are the same type and point to the same object, and ok indicating that +// both inputs are pointers. +func samePointers(first, second interface{}) (same bool, ok bool) { firstPtr, secondPtr := reflect.ValueOf(first), reflect.ValueOf(second) if firstPtr.Kind() != reflect.Ptr || secondPtr.Kind() != reflect.Ptr { - return false + return false, false //not both are pointers } firstType, secondType := reflect.TypeOf(first), reflect.TypeOf(second) if firstType != secondType { - return false + return false, true // both are pointers, but of different types } // compare pointer addresses - return first == second + return first == second, true } // formatUnequalValues takes two values of arbitrary types and returns string @@ -572,8 +592,8 @@ func truncatingFormat(data interface{}) string { return value } -// EqualValues asserts that two objects are equal or convertible to the same types -// and equal. +// EqualValues asserts that two objects are equal or convertible to the larger +// type and equal. // // assert.EqualValues(t, uint32(123), int32(123)) func EqualValues(t TestingT, expected, actual interface{}, msgAndArgs ...interface{}) bool { @@ -615,21 +635,6 @@ func EqualExportedValues(t TestingT, expected, actual interface{}, msgAndArgs .. return Fail(t, fmt.Sprintf("Types expected to match exactly\n\t%v != %v", aType, bType), msgAndArgs...) } - if aType.Kind() == reflect.Ptr { - aType = aType.Elem() - } - if bType.Kind() == reflect.Ptr { - bType = bType.Elem() - } - - if aType.Kind() != reflect.Struct { - return Fail(t, fmt.Sprintf("Types expected to both be struct or pointer to struct \n\t%v != %v", aType.Kind(), reflect.Struct), msgAndArgs...) - } - - if bType.Kind() != reflect.Struct { - return Fail(t, fmt.Sprintf("Types expected to both be struct or pointer to struct \n\t%v != %v", bType.Kind(), reflect.Struct), msgAndArgs...) - } - expected = copyExportedFields(expected) actual = copyExportedFields(actual) @@ -1170,6 +1175,39 @@ func formatListDiff(listA, listB interface{}, extraA, extraB []interface{}) stri return msg.String() } +// NotElementsMatch asserts that the specified listA(array, slice...) is NOT equal to specified +// listB(array, slice...) ignoring the order of the elements. If there are duplicate elements, +// the number of appearances of each of them in both lists should not match. +// This is an inverse of ElementsMatch. +// +// assert.NotElementsMatch(t, [1, 1, 2, 3], [1, 1, 2, 3]) -> false +// +// assert.NotElementsMatch(t, [1, 1, 2, 3], [1, 2, 3]) -> true +// +// assert.NotElementsMatch(t, [1, 2, 3], [1, 2, 4]) -> true +func NotElementsMatch(t TestingT, listA, listB interface{}, msgAndArgs ...interface{}) (ok bool) { + if h, ok := t.(tHelper); ok { + h.Helper() + } + if isEmpty(listA) && isEmpty(listB) { + return Fail(t, "listA and listB contain the same elements", msgAndArgs) + } + + if !isList(t, listA, msgAndArgs...) { + return Fail(t, "listA is not a list type", msgAndArgs...) + } + if !isList(t, listB, msgAndArgs...) { + return Fail(t, "listB is not a list type", msgAndArgs...) + } + + extraA, extraB := diffLists(listA, listB) + if len(extraA) == 0 && len(extraB) == 0 { + return Fail(t, "listA and listB contain the same elements", msgAndArgs) + } + + return true +} + // Condition uses a Comparison to assert a complex condition. func Condition(t TestingT, comp Comparison, msgAndArgs ...interface{}) bool { if h, ok := t.(tHelper); ok { @@ -1488,6 +1526,9 @@ func InEpsilon(t TestingT, expected, actual interface{}, epsilon float64, msgAnd if err != nil { return Fail(t, err.Error(), msgAndArgs...) } + if math.IsNaN(actualEpsilon) { + return Fail(t, "relative error is NaN", msgAndArgs...) + } if actualEpsilon > epsilon { return Fail(t, fmt.Sprintf("Relative error is too high: %#v (expected)\n"+ " < %#v (actual)", epsilon, actualEpsilon), msgAndArgs...) @@ -1611,7 +1652,6 @@ func ErrorContains(t TestingT, theError error, contains string, msgAndArgs ...in // matchRegexp return true if a specified regexp matches a string. func matchRegexp(rx interface{}, str interface{}) bool { - var r *regexp.Regexp if rr, ok := rx.(*regexp.Regexp); ok { r = rr @@ -1619,7 +1659,14 @@ func matchRegexp(rx interface{}, str interface{}) bool { r = regexp.MustCompile(fmt.Sprint(rx)) } - return (r.FindStringIndex(fmt.Sprint(str)) != nil) + switch v := str.(type) { + case []byte: + return r.Match(v) + case string: + return r.MatchString(v) + default: + return r.MatchString(fmt.Sprint(v)) + } } @@ -1872,7 +1919,7 @@ var spewConfigStringerEnabled = spew.ConfigState{ MaxDepth: 10, } -type tHelper interface { +type tHelper = interface { Helper() } @@ -1911,6 +1958,9 @@ func Eventually(t TestingT, condition func() bool, waitFor time.Duration, tick t // CollectT implements the TestingT interface and collects all errors. type CollectT struct { + // A slice of errors. Non-nil slice denotes a failure. + // If it's non-nil but len(c.errors) == 0, this is also a failure + // obtained by direct c.FailNow() call. errors []error } @@ -1919,9 +1969,10 @@ func (c *CollectT) Errorf(format string, args ...interface{}) { c.errors = append(c.errors, fmt.Errorf(format, args...)) } -// FailNow panics. -func (*CollectT) FailNow() { - panic("Assertion failed") +// FailNow stops execution by calling runtime.Goexit. +func (c *CollectT) FailNow() { + c.fail() + runtime.Goexit() } // Deprecated: That was a method for internal usage that should not have been published. Now just panics. @@ -1934,6 +1985,16 @@ func (*CollectT) Copy(TestingT) { panic("Copy() is deprecated") } +func (c *CollectT) fail() { + if !c.failed() { + c.errors = []error{} // Make it non-nil to mark a failure. + } +} + +func (c *CollectT) failed() bool { + return c.errors != nil +} + // EventuallyWithT asserts that given condition will be met in waitFor time, // periodically checking target function each tick. In contrast to Eventually, // it supplies a CollectT to the condition function, so that the condition @@ -1951,14 +2012,14 @@ func (*CollectT) Copy(TestingT) { // assert.EventuallyWithT(t, func(c *assert.CollectT) { // // add assertions as needed; any assertion failure will fail the current tick // assert.True(c, externalValue, "expected 'externalValue' to be true") -// }, 1*time.Second, 10*time.Second, "external state has not changed to 'true'; still false") +// }, 10*time.Second, 1*time.Second, "external state has not changed to 'true'; still false") func EventuallyWithT(t TestingT, condition func(collect *CollectT), waitFor time.Duration, tick time.Duration, msgAndArgs ...interface{}) bool { if h, ok := t.(tHelper); ok { h.Helper() } var lastFinishedTickErrs []error - ch := make(chan []error, 1) + ch := make(chan *CollectT, 1) timer := time.NewTimer(waitFor) defer timer.Stop() @@ -1978,16 +2039,16 @@ func EventuallyWithT(t TestingT, condition func(collect *CollectT), waitFor time go func() { collect := new(CollectT) defer func() { - ch <- collect.errors + ch <- collect }() condition(collect) }() - case errs := <-ch: - if len(errs) == 0 { + case collect := <-ch: + if !collect.failed() { return true } // Keep the errors from the last ended condition, so that they can be copied to t if timeout is reached. - lastFinishedTickErrs = errs + lastFinishedTickErrs = collect.errors tick = ticker.C } } @@ -2049,7 +2110,7 @@ func ErrorIs(t TestingT, err, target error, msgAndArgs ...interface{}) bool { ), msgAndArgs...) } -// NotErrorIs asserts that at none of the errors in err's chain matches target. +// NotErrorIs asserts that none of the errors in err's chain matches target. // This is a wrapper for errors.Is. func NotErrorIs(t TestingT, err, target error, msgAndArgs ...interface{}) bool { if h, ok := t.(tHelper); ok { @@ -2090,6 +2151,24 @@ func ErrorAs(t TestingT, err error, target interface{}, msgAndArgs ...interface{ ), msgAndArgs...) } +// NotErrorAs asserts that none of the errors in err's chain matches target, +// but if so, sets target to that error value. +func NotErrorAs(t TestingT, err error, target interface{}, msgAndArgs ...interface{}) bool { + if h, ok := t.(tHelper); ok { + h.Helper() + } + if !errors.As(err, target) { + return true + } + + chain := buildErrorChainString(err) + + return Fail(t, fmt.Sprintf("Target error should not be in err chain:\n"+ + "found: %q\n"+ + "in chain: %s", target, chain, + ), msgAndArgs...) +} + func buildErrorChainString(err error) string { if err == nil { return "" diff --git a/vendor/github.com/stretchr/testify/assert/yaml/yaml_custom.go b/vendor/github.com/stretchr/testify/assert/yaml/yaml_custom.go new file mode 100644 index 00000000..baa0cc7d --- /dev/null +++ b/vendor/github.com/stretchr/testify/assert/yaml/yaml_custom.go @@ -0,0 +1,25 @@ +//go:build testify_yaml_custom && !testify_yaml_fail && !testify_yaml_default +// +build testify_yaml_custom,!testify_yaml_fail,!testify_yaml_default + +// Package yaml is an implementation of YAML functions that calls a pluggable implementation. +// +// This implementation is selected with the testify_yaml_custom build tag. +// +// go test -tags testify_yaml_custom +// +// This implementation can be used at build time to replace the default implementation +// to avoid linking with [gopkg.in/yaml.v3]. +// +// In your test package: +// +// import assertYaml "github.com/stretchr/testify/assert/yaml" +// +// func init() { +// assertYaml.Unmarshal = func (in []byte, out interface{}) error { +// // ... +// return nil +// } +// } +package yaml + +var Unmarshal func(in []byte, out interface{}) error diff --git a/vendor/github.com/stretchr/testify/assert/yaml/yaml_default.go b/vendor/github.com/stretchr/testify/assert/yaml/yaml_default.go new file mode 100644 index 00000000..b83c6cf6 --- /dev/null +++ b/vendor/github.com/stretchr/testify/assert/yaml/yaml_default.go @@ -0,0 +1,37 @@ +//go:build !testify_yaml_fail && !testify_yaml_custom +// +build !testify_yaml_fail,!testify_yaml_custom + +// Package yaml is just an indirection to handle YAML deserialization. +// +// This package is just an indirection that allows the builder to override the +// indirection with an alternative implementation of this package that uses +// another implementation of YAML deserialization. This allows to not either not +// use YAML deserialization at all, or to use another implementation than +// [gopkg.in/yaml.v3] (for example for license compatibility reasons, see [PR #1120]). +// +// Alternative implementations are selected using build tags: +// +// - testify_yaml_fail: [Unmarshal] always fails with an error +// - testify_yaml_custom: [Unmarshal] is a variable. Caller must initialize it +// before calling any of [github.com/stretchr/testify/assert.YAMLEq] or +// [github.com/stretchr/testify/assert.YAMLEqf]. +// +// Usage: +// +// go test -tags testify_yaml_fail +// +// You can check with "go list" which implementation is linked: +// +// go list -f '{{.Imports}}' github.com/stretchr/testify/assert/yaml +// go list -tags testify_yaml_fail -f '{{.Imports}}' github.com/stretchr/testify/assert/yaml +// go list -tags testify_yaml_custom -f '{{.Imports}}' github.com/stretchr/testify/assert/yaml +// +// [PR #1120]: https://github.com/stretchr/testify/pull/1120 +package yaml + +import goyaml "gopkg.in/yaml.v3" + +// Unmarshal is just a wrapper of [gopkg.in/yaml.v3.Unmarshal]. +func Unmarshal(in []byte, out interface{}) error { + return goyaml.Unmarshal(in, out) +} diff --git a/vendor/github.com/stretchr/testify/assert/yaml/yaml_fail.go b/vendor/github.com/stretchr/testify/assert/yaml/yaml_fail.go new file mode 100644 index 00000000..e78f7dfe --- /dev/null +++ b/vendor/github.com/stretchr/testify/assert/yaml/yaml_fail.go @@ -0,0 +1,18 @@ +//go:build testify_yaml_fail && !testify_yaml_custom && !testify_yaml_default +// +build testify_yaml_fail,!testify_yaml_custom,!testify_yaml_default + +// Package yaml is an implementation of YAML functions that always fail. +// +// This implementation can be used at build time to replace the default implementation +// to avoid linking with [gopkg.in/yaml.v3]: +// +// go test -tags testify_yaml_fail +package yaml + +import "errors" + +var errNotImplemented = errors.New("YAML functions are not available (see https://pkg.go.dev/github.com/stretchr/testify/assert/yaml)") + +func Unmarshal([]byte, interface{}) error { + return errNotImplemented +} diff --git a/vendor/github.com/stretchr/testify/require/require.go b/vendor/github.com/stretchr/testify/require/require.go index 506a82f8..d8921950 100644 --- a/vendor/github.com/stretchr/testify/require/require.go +++ b/vendor/github.com/stretchr/testify/require/require.go @@ -34,9 +34,9 @@ func Conditionf(t TestingT, comp assert.Comparison, msg string, args ...interfac // Contains asserts that the specified string, list(array, slice...) or map contains the // specified substring or element. // -// assert.Contains(t, "Hello World", "World") -// assert.Contains(t, ["Hello", "World"], "World") -// assert.Contains(t, {"Hello": "World"}, "Hello") +// require.Contains(t, "Hello World", "World") +// require.Contains(t, ["Hello", "World"], "World") +// require.Contains(t, {"Hello": "World"}, "Hello") func Contains(t TestingT, s interface{}, contains interface{}, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -50,9 +50,9 @@ func Contains(t TestingT, s interface{}, contains interface{}, msgAndArgs ...int // Containsf asserts that the specified string, list(array, slice...) or map contains the // specified substring or element. // -// assert.Containsf(t, "Hello World", "World", "error message %s", "formatted") -// assert.Containsf(t, ["Hello", "World"], "World", "error message %s", "formatted") -// assert.Containsf(t, {"Hello": "World"}, "Hello", "error message %s", "formatted") +// require.Containsf(t, "Hello World", "World", "error message %s", "formatted") +// require.Containsf(t, ["Hello", "World"], "World", "error message %s", "formatted") +// require.Containsf(t, {"Hello": "World"}, "Hello", "error message %s", "formatted") func Containsf(t TestingT, s interface{}, contains interface{}, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -91,7 +91,7 @@ func DirExistsf(t TestingT, path string, msg string, args ...interface{}) { // listB(array, slice...) ignoring the order of the elements. If there are duplicate elements, // the number of appearances of each of them in both lists should match. // -// assert.ElementsMatch(t, [1, 3, 2, 3], [1, 3, 3, 2]) +// require.ElementsMatch(t, [1, 3, 2, 3], [1, 3, 3, 2]) func ElementsMatch(t TestingT, listA interface{}, listB interface{}, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -106,7 +106,7 @@ func ElementsMatch(t TestingT, listA interface{}, listB interface{}, msgAndArgs // listB(array, slice...) ignoring the order of the elements. If there are duplicate elements, // the number of appearances of each of them in both lists should match. // -// assert.ElementsMatchf(t, [1, 3, 2, 3], [1, 3, 3, 2], "error message %s", "formatted") +// require.ElementsMatchf(t, [1, 3, 2, 3], [1, 3, 3, 2], "error message %s", "formatted") func ElementsMatchf(t TestingT, listA interface{}, listB interface{}, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -120,7 +120,7 @@ func ElementsMatchf(t TestingT, listA interface{}, listB interface{}, msg string // Empty asserts that the specified object is empty. I.e. nil, "", false, 0 or either // a slice or a channel with len == 0. // -// assert.Empty(t, obj) +// require.Empty(t, obj) func Empty(t TestingT, object interface{}, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -134,7 +134,7 @@ func Empty(t TestingT, object interface{}, msgAndArgs ...interface{}) { // Emptyf asserts that the specified object is empty. I.e. nil, "", false, 0 or either // a slice or a channel with len == 0. // -// assert.Emptyf(t, obj, "error message %s", "formatted") +// require.Emptyf(t, obj, "error message %s", "formatted") func Emptyf(t TestingT, object interface{}, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -147,7 +147,7 @@ func Emptyf(t TestingT, object interface{}, msg string, args ...interface{}) { // Equal asserts that two objects are equal. // -// assert.Equal(t, 123, 123) +// require.Equal(t, 123, 123) // // Pointer variable equality is determined based on the equality of the // referenced values (as opposed to the memory addresses). Function equality @@ -166,7 +166,7 @@ func Equal(t TestingT, expected interface{}, actual interface{}, msgAndArgs ...i // and that it is equal to the provided error. // // actualObj, err := SomeFunction() -// assert.EqualError(t, err, expectedErrorString) +// require.EqualError(t, err, expectedErrorString) func EqualError(t TestingT, theError error, errString string, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -181,7 +181,7 @@ func EqualError(t TestingT, theError error, errString string, msgAndArgs ...inte // and that it is equal to the provided error. // // actualObj, err := SomeFunction() -// assert.EqualErrorf(t, err, expectedErrorString, "error message %s", "formatted") +// require.EqualErrorf(t, err, expectedErrorString, "error message %s", "formatted") func EqualErrorf(t TestingT, theError error, errString string, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -200,8 +200,8 @@ func EqualErrorf(t TestingT, theError error, errString string, msg string, args // Exported int // notExported int // } -// assert.EqualExportedValues(t, S{1, 2}, S{1, 3}) => true -// assert.EqualExportedValues(t, S{1, 2}, S{2, 3}) => false +// require.EqualExportedValues(t, S{1, 2}, S{1, 3}) => true +// require.EqualExportedValues(t, S{1, 2}, S{2, 3}) => false func EqualExportedValues(t TestingT, expected interface{}, actual interface{}, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -220,8 +220,8 @@ func EqualExportedValues(t TestingT, expected interface{}, actual interface{}, m // Exported int // notExported int // } -// assert.EqualExportedValuesf(t, S{1, 2}, S{1, 3}, "error message %s", "formatted") => true -// assert.EqualExportedValuesf(t, S{1, 2}, S{2, 3}, "error message %s", "formatted") => false +// require.EqualExportedValuesf(t, S{1, 2}, S{1, 3}, "error message %s", "formatted") => true +// require.EqualExportedValuesf(t, S{1, 2}, S{2, 3}, "error message %s", "formatted") => false func EqualExportedValuesf(t TestingT, expected interface{}, actual interface{}, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -232,10 +232,10 @@ func EqualExportedValuesf(t TestingT, expected interface{}, actual interface{}, t.FailNow() } -// EqualValues asserts that two objects are equal or convertible to the same types -// and equal. +// EqualValues asserts that two objects are equal or convertible to the larger +// type and equal. // -// assert.EqualValues(t, uint32(123), int32(123)) +// require.EqualValues(t, uint32(123), int32(123)) func EqualValues(t TestingT, expected interface{}, actual interface{}, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -246,10 +246,10 @@ func EqualValues(t TestingT, expected interface{}, actual interface{}, msgAndArg t.FailNow() } -// EqualValuesf asserts that two objects are equal or convertible to the same types -// and equal. +// EqualValuesf asserts that two objects are equal or convertible to the larger +// type and equal. // -// assert.EqualValuesf(t, uint32(123), int32(123), "error message %s", "formatted") +// require.EqualValuesf(t, uint32(123), int32(123), "error message %s", "formatted") func EqualValuesf(t TestingT, expected interface{}, actual interface{}, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -262,7 +262,7 @@ func EqualValuesf(t TestingT, expected interface{}, actual interface{}, msg stri // Equalf asserts that two objects are equal. // -// assert.Equalf(t, 123, 123, "error message %s", "formatted") +// require.Equalf(t, 123, 123, "error message %s", "formatted") // // Pointer variable equality is determined based on the equality of the // referenced values (as opposed to the memory addresses). Function equality @@ -280,8 +280,8 @@ func Equalf(t TestingT, expected interface{}, actual interface{}, msg string, ar // Error asserts that a function returned an error (i.e. not `nil`). // // actualObj, err := SomeFunction() -// if assert.Error(t, err) { -// assert.Equal(t, expectedError, err) +// if require.Error(t, err) { +// require.Equal(t, expectedError, err) // } func Error(t TestingT, err error, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { @@ -321,7 +321,7 @@ func ErrorAsf(t TestingT, err error, target interface{}, msg string, args ...int // and that the error contains the specified substring. // // actualObj, err := SomeFunction() -// assert.ErrorContains(t, err, expectedErrorSubString) +// require.ErrorContains(t, err, expectedErrorSubString) func ErrorContains(t TestingT, theError error, contains string, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -336,7 +336,7 @@ func ErrorContains(t TestingT, theError error, contains string, msgAndArgs ...in // and that the error contains the specified substring. // // actualObj, err := SomeFunction() -// assert.ErrorContainsf(t, err, expectedErrorSubString, "error message %s", "formatted") +// require.ErrorContainsf(t, err, expectedErrorSubString, "error message %s", "formatted") func ErrorContainsf(t TestingT, theError error, contains string, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -374,8 +374,8 @@ func ErrorIsf(t TestingT, err error, target error, msg string, args ...interface // Errorf asserts that a function returned an error (i.e. not `nil`). // // actualObj, err := SomeFunction() -// if assert.Errorf(t, err, "error message %s", "formatted") { -// assert.Equal(t, expectedErrorf, err) +// if require.Errorf(t, err, "error message %s", "formatted") { +// require.Equal(t, expectedErrorf, err) // } func Errorf(t TestingT, err error, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { @@ -390,7 +390,7 @@ func Errorf(t TestingT, err error, msg string, args ...interface{}) { // Eventually asserts that given condition will be met in waitFor time, // periodically checking target function each tick. // -// assert.Eventually(t, func() bool { return true; }, time.Second, 10*time.Millisecond) +// require.Eventually(t, func() bool { return true; }, time.Second, 10*time.Millisecond) func Eventually(t TestingT, condition func() bool, waitFor time.Duration, tick time.Duration, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -415,10 +415,10 @@ func Eventually(t TestingT, condition func() bool, waitFor time.Duration, tick t // time.Sleep(8*time.Second) // externalValue = true // }() -// assert.EventuallyWithT(t, func(c *assert.CollectT) { +// require.EventuallyWithT(t, func(c *require.CollectT) { // // add assertions as needed; any assertion failure will fail the current tick -// assert.True(c, externalValue, "expected 'externalValue' to be true") -// }, 1*time.Second, 10*time.Second, "external state has not changed to 'true'; still false") +// require.True(c, externalValue, "expected 'externalValue' to be true") +// }, 10*time.Second, 1*time.Second, "external state has not changed to 'true'; still false") func EventuallyWithT(t TestingT, condition func(collect *assert.CollectT), waitFor time.Duration, tick time.Duration, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -443,10 +443,10 @@ func EventuallyWithT(t TestingT, condition func(collect *assert.CollectT), waitF // time.Sleep(8*time.Second) // externalValue = true // }() -// assert.EventuallyWithTf(t, func(c *assert.CollectT, "error message %s", "formatted") { +// require.EventuallyWithTf(t, func(c *require.CollectT, "error message %s", "formatted") { // // add assertions as needed; any assertion failure will fail the current tick -// assert.True(c, externalValue, "expected 'externalValue' to be true") -// }, 1*time.Second, 10*time.Second, "external state has not changed to 'true'; still false") +// require.True(c, externalValue, "expected 'externalValue' to be true") +// }, 10*time.Second, 1*time.Second, "external state has not changed to 'true'; still false") func EventuallyWithTf(t TestingT, condition func(collect *assert.CollectT), waitFor time.Duration, tick time.Duration, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -460,7 +460,7 @@ func EventuallyWithTf(t TestingT, condition func(collect *assert.CollectT), wait // Eventuallyf asserts that given condition will be met in waitFor time, // periodically checking target function each tick. // -// assert.Eventuallyf(t, func() bool { return true; }, time.Second, 10*time.Millisecond, "error message %s", "formatted") +// require.Eventuallyf(t, func() bool { return true; }, time.Second, 10*time.Millisecond, "error message %s", "formatted") func Eventuallyf(t TestingT, condition func() bool, waitFor time.Duration, tick time.Duration, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -473,7 +473,7 @@ func Eventuallyf(t TestingT, condition func() bool, waitFor time.Duration, tick // Exactly asserts that two objects are equal in value and type. // -// assert.Exactly(t, int32(123), int64(123)) +// require.Exactly(t, int32(123), int64(123)) func Exactly(t TestingT, expected interface{}, actual interface{}, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -486,7 +486,7 @@ func Exactly(t TestingT, expected interface{}, actual interface{}, msgAndArgs .. // Exactlyf asserts that two objects are equal in value and type. // -// assert.Exactlyf(t, int32(123), int64(123), "error message %s", "formatted") +// require.Exactlyf(t, int32(123), int64(123), "error message %s", "formatted") func Exactlyf(t TestingT, expected interface{}, actual interface{}, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -543,7 +543,7 @@ func Failf(t TestingT, failureMessage string, msg string, args ...interface{}) { // False asserts that the specified value is false. // -// assert.False(t, myBool) +// require.False(t, myBool) func False(t TestingT, value bool, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -556,7 +556,7 @@ func False(t TestingT, value bool, msgAndArgs ...interface{}) { // Falsef asserts that the specified value is false. // -// assert.Falsef(t, myBool, "error message %s", "formatted") +// require.Falsef(t, myBool, "error message %s", "formatted") func Falsef(t TestingT, value bool, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -593,9 +593,9 @@ func FileExistsf(t TestingT, path string, msg string, args ...interface{}) { // Greater asserts that the first element is greater than the second // -// assert.Greater(t, 2, 1) -// assert.Greater(t, float64(2), float64(1)) -// assert.Greater(t, "b", "a") +// require.Greater(t, 2, 1) +// require.Greater(t, float64(2), float64(1)) +// require.Greater(t, "b", "a") func Greater(t TestingT, e1 interface{}, e2 interface{}, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -608,10 +608,10 @@ func Greater(t TestingT, e1 interface{}, e2 interface{}, msgAndArgs ...interface // GreaterOrEqual asserts that the first element is greater than or equal to the second // -// assert.GreaterOrEqual(t, 2, 1) -// assert.GreaterOrEqual(t, 2, 2) -// assert.GreaterOrEqual(t, "b", "a") -// assert.GreaterOrEqual(t, "b", "b") +// require.GreaterOrEqual(t, 2, 1) +// require.GreaterOrEqual(t, 2, 2) +// require.GreaterOrEqual(t, "b", "a") +// require.GreaterOrEqual(t, "b", "b") func GreaterOrEqual(t TestingT, e1 interface{}, e2 interface{}, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -624,10 +624,10 @@ func GreaterOrEqual(t TestingT, e1 interface{}, e2 interface{}, msgAndArgs ...in // GreaterOrEqualf asserts that the first element is greater than or equal to the second // -// assert.GreaterOrEqualf(t, 2, 1, "error message %s", "formatted") -// assert.GreaterOrEqualf(t, 2, 2, "error message %s", "formatted") -// assert.GreaterOrEqualf(t, "b", "a", "error message %s", "formatted") -// assert.GreaterOrEqualf(t, "b", "b", "error message %s", "formatted") +// require.GreaterOrEqualf(t, 2, 1, "error message %s", "formatted") +// require.GreaterOrEqualf(t, 2, 2, "error message %s", "formatted") +// require.GreaterOrEqualf(t, "b", "a", "error message %s", "formatted") +// require.GreaterOrEqualf(t, "b", "b", "error message %s", "formatted") func GreaterOrEqualf(t TestingT, e1 interface{}, e2 interface{}, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -640,9 +640,9 @@ func GreaterOrEqualf(t TestingT, e1 interface{}, e2 interface{}, msg string, arg // Greaterf asserts that the first element is greater than the second // -// assert.Greaterf(t, 2, 1, "error message %s", "formatted") -// assert.Greaterf(t, float64(2), float64(1), "error message %s", "formatted") -// assert.Greaterf(t, "b", "a", "error message %s", "formatted") +// require.Greaterf(t, 2, 1, "error message %s", "formatted") +// require.Greaterf(t, float64(2), float64(1), "error message %s", "formatted") +// require.Greaterf(t, "b", "a", "error message %s", "formatted") func Greaterf(t TestingT, e1 interface{}, e2 interface{}, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -656,7 +656,7 @@ func Greaterf(t TestingT, e1 interface{}, e2 interface{}, msg string, args ...in // HTTPBodyContains asserts that a specified handler returns a // body that contains a string. // -// assert.HTTPBodyContains(t, myHandler, "GET", "www.google.com", nil, "I'm Feeling Lucky") +// require.HTTPBodyContains(t, myHandler, "GET", "www.google.com", nil, "I'm Feeling Lucky") // // Returns whether the assertion was successful (true) or not (false). func HTTPBodyContains(t TestingT, handler http.HandlerFunc, method string, url string, values url.Values, str interface{}, msgAndArgs ...interface{}) { @@ -672,7 +672,7 @@ func HTTPBodyContains(t TestingT, handler http.HandlerFunc, method string, url s // HTTPBodyContainsf asserts that a specified handler returns a // body that contains a string. // -// assert.HTTPBodyContainsf(t, myHandler, "GET", "www.google.com", nil, "I'm Feeling Lucky", "error message %s", "formatted") +// require.HTTPBodyContainsf(t, myHandler, "GET", "www.google.com", nil, "I'm Feeling Lucky", "error message %s", "formatted") // // Returns whether the assertion was successful (true) or not (false). func HTTPBodyContainsf(t TestingT, handler http.HandlerFunc, method string, url string, values url.Values, str interface{}, msg string, args ...interface{}) { @@ -688,7 +688,7 @@ func HTTPBodyContainsf(t TestingT, handler http.HandlerFunc, method string, url // HTTPBodyNotContains asserts that a specified handler returns a // body that does not contain a string. // -// assert.HTTPBodyNotContains(t, myHandler, "GET", "www.google.com", nil, "I'm Feeling Lucky") +// require.HTTPBodyNotContains(t, myHandler, "GET", "www.google.com", nil, "I'm Feeling Lucky") // // Returns whether the assertion was successful (true) or not (false). func HTTPBodyNotContains(t TestingT, handler http.HandlerFunc, method string, url string, values url.Values, str interface{}, msgAndArgs ...interface{}) { @@ -704,7 +704,7 @@ func HTTPBodyNotContains(t TestingT, handler http.HandlerFunc, method string, ur // HTTPBodyNotContainsf asserts that a specified handler returns a // body that does not contain a string. // -// assert.HTTPBodyNotContainsf(t, myHandler, "GET", "www.google.com", nil, "I'm Feeling Lucky", "error message %s", "formatted") +// require.HTTPBodyNotContainsf(t, myHandler, "GET", "www.google.com", nil, "I'm Feeling Lucky", "error message %s", "formatted") // // Returns whether the assertion was successful (true) or not (false). func HTTPBodyNotContainsf(t TestingT, handler http.HandlerFunc, method string, url string, values url.Values, str interface{}, msg string, args ...interface{}) { @@ -719,7 +719,7 @@ func HTTPBodyNotContainsf(t TestingT, handler http.HandlerFunc, method string, u // HTTPError asserts that a specified handler returns an error status code. // -// assert.HTTPError(t, myHandler, "POST", "/a/b/c", url.Values{"a": []string{"b", "c"}} +// require.HTTPError(t, myHandler, "POST", "/a/b/c", url.Values{"a": []string{"b", "c"}} // // Returns whether the assertion was successful (true) or not (false). func HTTPError(t TestingT, handler http.HandlerFunc, method string, url string, values url.Values, msgAndArgs ...interface{}) { @@ -734,7 +734,7 @@ func HTTPError(t TestingT, handler http.HandlerFunc, method string, url string, // HTTPErrorf asserts that a specified handler returns an error status code. // -// assert.HTTPErrorf(t, myHandler, "POST", "/a/b/c", url.Values{"a": []string{"b", "c"}} +// require.HTTPErrorf(t, myHandler, "POST", "/a/b/c", url.Values{"a": []string{"b", "c"}} // // Returns whether the assertion was successful (true) or not (false). func HTTPErrorf(t TestingT, handler http.HandlerFunc, method string, url string, values url.Values, msg string, args ...interface{}) { @@ -749,7 +749,7 @@ func HTTPErrorf(t TestingT, handler http.HandlerFunc, method string, url string, // HTTPRedirect asserts that a specified handler returns a redirect status code. // -// assert.HTTPRedirect(t, myHandler, "GET", "/a/b/c", url.Values{"a": []string{"b", "c"}} +// require.HTTPRedirect(t, myHandler, "GET", "/a/b/c", url.Values{"a": []string{"b", "c"}} // // Returns whether the assertion was successful (true) or not (false). func HTTPRedirect(t TestingT, handler http.HandlerFunc, method string, url string, values url.Values, msgAndArgs ...interface{}) { @@ -764,7 +764,7 @@ func HTTPRedirect(t TestingT, handler http.HandlerFunc, method string, url strin // HTTPRedirectf asserts that a specified handler returns a redirect status code. // -// assert.HTTPRedirectf(t, myHandler, "GET", "/a/b/c", url.Values{"a": []string{"b", "c"}} +// require.HTTPRedirectf(t, myHandler, "GET", "/a/b/c", url.Values{"a": []string{"b", "c"}} // // Returns whether the assertion was successful (true) or not (false). func HTTPRedirectf(t TestingT, handler http.HandlerFunc, method string, url string, values url.Values, msg string, args ...interface{}) { @@ -779,7 +779,7 @@ func HTTPRedirectf(t TestingT, handler http.HandlerFunc, method string, url stri // HTTPStatusCode asserts that a specified handler returns a specified status code. // -// assert.HTTPStatusCode(t, myHandler, "GET", "/notImplemented", nil, 501) +// require.HTTPStatusCode(t, myHandler, "GET", "/notImplemented", nil, 501) // // Returns whether the assertion was successful (true) or not (false). func HTTPStatusCode(t TestingT, handler http.HandlerFunc, method string, url string, values url.Values, statuscode int, msgAndArgs ...interface{}) { @@ -794,7 +794,7 @@ func HTTPStatusCode(t TestingT, handler http.HandlerFunc, method string, url str // HTTPStatusCodef asserts that a specified handler returns a specified status code. // -// assert.HTTPStatusCodef(t, myHandler, "GET", "/notImplemented", nil, 501, "error message %s", "formatted") +// require.HTTPStatusCodef(t, myHandler, "GET", "/notImplemented", nil, 501, "error message %s", "formatted") // // Returns whether the assertion was successful (true) or not (false). func HTTPStatusCodef(t TestingT, handler http.HandlerFunc, method string, url string, values url.Values, statuscode int, msg string, args ...interface{}) { @@ -809,7 +809,7 @@ func HTTPStatusCodef(t TestingT, handler http.HandlerFunc, method string, url st // HTTPSuccess asserts that a specified handler returns a success status code. // -// assert.HTTPSuccess(t, myHandler, "POST", "http://www.google.com", nil) +// require.HTTPSuccess(t, myHandler, "POST", "http://www.google.com", nil) // // Returns whether the assertion was successful (true) or not (false). func HTTPSuccess(t TestingT, handler http.HandlerFunc, method string, url string, values url.Values, msgAndArgs ...interface{}) { @@ -824,7 +824,7 @@ func HTTPSuccess(t TestingT, handler http.HandlerFunc, method string, url string // HTTPSuccessf asserts that a specified handler returns a success status code. // -// assert.HTTPSuccessf(t, myHandler, "POST", "http://www.google.com", nil, "error message %s", "formatted") +// require.HTTPSuccessf(t, myHandler, "POST", "http://www.google.com", nil, "error message %s", "formatted") // // Returns whether the assertion was successful (true) or not (false). func HTTPSuccessf(t TestingT, handler http.HandlerFunc, method string, url string, values url.Values, msg string, args ...interface{}) { @@ -839,7 +839,7 @@ func HTTPSuccessf(t TestingT, handler http.HandlerFunc, method string, url strin // Implements asserts that an object is implemented by the specified interface. // -// assert.Implements(t, (*MyInterface)(nil), new(MyObject)) +// require.Implements(t, (*MyInterface)(nil), new(MyObject)) func Implements(t TestingT, interfaceObject interface{}, object interface{}, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -852,7 +852,7 @@ func Implements(t TestingT, interfaceObject interface{}, object interface{}, msg // Implementsf asserts that an object is implemented by the specified interface. // -// assert.Implementsf(t, (*MyInterface)(nil), new(MyObject), "error message %s", "formatted") +// require.Implementsf(t, (*MyInterface)(nil), new(MyObject), "error message %s", "formatted") func Implementsf(t TestingT, interfaceObject interface{}, object interface{}, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -865,7 +865,7 @@ func Implementsf(t TestingT, interfaceObject interface{}, object interface{}, ms // InDelta asserts that the two numerals are within delta of each other. // -// assert.InDelta(t, math.Pi, 22/7.0, 0.01) +// require.InDelta(t, math.Pi, 22/7.0, 0.01) func InDelta(t TestingT, expected interface{}, actual interface{}, delta float64, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -922,7 +922,7 @@ func InDeltaSlicef(t TestingT, expected interface{}, actual interface{}, delta f // InDeltaf asserts that the two numerals are within delta of each other. // -// assert.InDeltaf(t, math.Pi, 22/7.0, 0.01, "error message %s", "formatted") +// require.InDeltaf(t, math.Pi, 22/7.0, 0.01, "error message %s", "formatted") func InDeltaf(t TestingT, expected interface{}, actual interface{}, delta float64, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -979,9 +979,9 @@ func InEpsilonf(t TestingT, expected interface{}, actual interface{}, epsilon fl // IsDecreasing asserts that the collection is decreasing // -// assert.IsDecreasing(t, []int{2, 1, 0}) -// assert.IsDecreasing(t, []float{2, 1}) -// assert.IsDecreasing(t, []string{"b", "a"}) +// require.IsDecreasing(t, []int{2, 1, 0}) +// require.IsDecreasing(t, []float{2, 1}) +// require.IsDecreasing(t, []string{"b", "a"}) func IsDecreasing(t TestingT, object interface{}, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -994,9 +994,9 @@ func IsDecreasing(t TestingT, object interface{}, msgAndArgs ...interface{}) { // IsDecreasingf asserts that the collection is decreasing // -// assert.IsDecreasingf(t, []int{2, 1, 0}, "error message %s", "formatted") -// assert.IsDecreasingf(t, []float{2, 1}, "error message %s", "formatted") -// assert.IsDecreasingf(t, []string{"b", "a"}, "error message %s", "formatted") +// require.IsDecreasingf(t, []int{2, 1, 0}, "error message %s", "formatted") +// require.IsDecreasingf(t, []float{2, 1}, "error message %s", "formatted") +// require.IsDecreasingf(t, []string{"b", "a"}, "error message %s", "formatted") func IsDecreasingf(t TestingT, object interface{}, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1009,9 +1009,9 @@ func IsDecreasingf(t TestingT, object interface{}, msg string, args ...interface // IsIncreasing asserts that the collection is increasing // -// assert.IsIncreasing(t, []int{1, 2, 3}) -// assert.IsIncreasing(t, []float{1, 2}) -// assert.IsIncreasing(t, []string{"a", "b"}) +// require.IsIncreasing(t, []int{1, 2, 3}) +// require.IsIncreasing(t, []float{1, 2}) +// require.IsIncreasing(t, []string{"a", "b"}) func IsIncreasing(t TestingT, object interface{}, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1024,9 +1024,9 @@ func IsIncreasing(t TestingT, object interface{}, msgAndArgs ...interface{}) { // IsIncreasingf asserts that the collection is increasing // -// assert.IsIncreasingf(t, []int{1, 2, 3}, "error message %s", "formatted") -// assert.IsIncreasingf(t, []float{1, 2}, "error message %s", "formatted") -// assert.IsIncreasingf(t, []string{"a", "b"}, "error message %s", "formatted") +// require.IsIncreasingf(t, []int{1, 2, 3}, "error message %s", "formatted") +// require.IsIncreasingf(t, []float{1, 2}, "error message %s", "formatted") +// require.IsIncreasingf(t, []string{"a", "b"}, "error message %s", "formatted") func IsIncreasingf(t TestingT, object interface{}, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1039,9 +1039,9 @@ func IsIncreasingf(t TestingT, object interface{}, msg string, args ...interface // IsNonDecreasing asserts that the collection is not decreasing // -// assert.IsNonDecreasing(t, []int{1, 1, 2}) -// assert.IsNonDecreasing(t, []float{1, 2}) -// assert.IsNonDecreasing(t, []string{"a", "b"}) +// require.IsNonDecreasing(t, []int{1, 1, 2}) +// require.IsNonDecreasing(t, []float{1, 2}) +// require.IsNonDecreasing(t, []string{"a", "b"}) func IsNonDecreasing(t TestingT, object interface{}, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1054,9 +1054,9 @@ func IsNonDecreasing(t TestingT, object interface{}, msgAndArgs ...interface{}) // IsNonDecreasingf asserts that the collection is not decreasing // -// assert.IsNonDecreasingf(t, []int{1, 1, 2}, "error message %s", "formatted") -// assert.IsNonDecreasingf(t, []float{1, 2}, "error message %s", "formatted") -// assert.IsNonDecreasingf(t, []string{"a", "b"}, "error message %s", "formatted") +// require.IsNonDecreasingf(t, []int{1, 1, 2}, "error message %s", "formatted") +// require.IsNonDecreasingf(t, []float{1, 2}, "error message %s", "formatted") +// require.IsNonDecreasingf(t, []string{"a", "b"}, "error message %s", "formatted") func IsNonDecreasingf(t TestingT, object interface{}, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1069,9 +1069,9 @@ func IsNonDecreasingf(t TestingT, object interface{}, msg string, args ...interf // IsNonIncreasing asserts that the collection is not increasing // -// assert.IsNonIncreasing(t, []int{2, 1, 1}) -// assert.IsNonIncreasing(t, []float{2, 1}) -// assert.IsNonIncreasing(t, []string{"b", "a"}) +// require.IsNonIncreasing(t, []int{2, 1, 1}) +// require.IsNonIncreasing(t, []float{2, 1}) +// require.IsNonIncreasing(t, []string{"b", "a"}) func IsNonIncreasing(t TestingT, object interface{}, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1084,9 +1084,9 @@ func IsNonIncreasing(t TestingT, object interface{}, msgAndArgs ...interface{}) // IsNonIncreasingf asserts that the collection is not increasing // -// assert.IsNonIncreasingf(t, []int{2, 1, 1}, "error message %s", "formatted") -// assert.IsNonIncreasingf(t, []float{2, 1}, "error message %s", "formatted") -// assert.IsNonIncreasingf(t, []string{"b", "a"}, "error message %s", "formatted") +// require.IsNonIncreasingf(t, []int{2, 1, 1}, "error message %s", "formatted") +// require.IsNonIncreasingf(t, []float{2, 1}, "error message %s", "formatted") +// require.IsNonIncreasingf(t, []string{"b", "a"}, "error message %s", "formatted") func IsNonIncreasingf(t TestingT, object interface{}, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1121,7 +1121,7 @@ func IsTypef(t TestingT, expectedType interface{}, object interface{}, msg strin // JSONEq asserts that two JSON strings are equivalent. // -// assert.JSONEq(t, `{"hello": "world", "foo": "bar"}`, `{"foo": "bar", "hello": "world"}`) +// require.JSONEq(t, `{"hello": "world", "foo": "bar"}`, `{"foo": "bar", "hello": "world"}`) func JSONEq(t TestingT, expected string, actual string, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1134,7 +1134,7 @@ func JSONEq(t TestingT, expected string, actual string, msgAndArgs ...interface{ // JSONEqf asserts that two JSON strings are equivalent. // -// assert.JSONEqf(t, `{"hello": "world", "foo": "bar"}`, `{"foo": "bar", "hello": "world"}`, "error message %s", "formatted") +// require.JSONEqf(t, `{"hello": "world", "foo": "bar"}`, `{"foo": "bar", "hello": "world"}`, "error message %s", "formatted") func JSONEqf(t TestingT, expected string, actual string, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1148,7 +1148,7 @@ func JSONEqf(t TestingT, expected string, actual string, msg string, args ...int // Len asserts that the specified object has specific length. // Len also fails if the object has a type that len() not accept. // -// assert.Len(t, mySlice, 3) +// require.Len(t, mySlice, 3) func Len(t TestingT, object interface{}, length int, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1162,7 +1162,7 @@ func Len(t TestingT, object interface{}, length int, msgAndArgs ...interface{}) // Lenf asserts that the specified object has specific length. // Lenf also fails if the object has a type that len() not accept. // -// assert.Lenf(t, mySlice, 3, "error message %s", "formatted") +// require.Lenf(t, mySlice, 3, "error message %s", "formatted") func Lenf(t TestingT, object interface{}, length int, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1175,9 +1175,9 @@ func Lenf(t TestingT, object interface{}, length int, msg string, args ...interf // Less asserts that the first element is less than the second // -// assert.Less(t, 1, 2) -// assert.Less(t, float64(1), float64(2)) -// assert.Less(t, "a", "b") +// require.Less(t, 1, 2) +// require.Less(t, float64(1), float64(2)) +// require.Less(t, "a", "b") func Less(t TestingT, e1 interface{}, e2 interface{}, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1190,10 +1190,10 @@ func Less(t TestingT, e1 interface{}, e2 interface{}, msgAndArgs ...interface{}) // LessOrEqual asserts that the first element is less than or equal to the second // -// assert.LessOrEqual(t, 1, 2) -// assert.LessOrEqual(t, 2, 2) -// assert.LessOrEqual(t, "a", "b") -// assert.LessOrEqual(t, "b", "b") +// require.LessOrEqual(t, 1, 2) +// require.LessOrEqual(t, 2, 2) +// require.LessOrEqual(t, "a", "b") +// require.LessOrEqual(t, "b", "b") func LessOrEqual(t TestingT, e1 interface{}, e2 interface{}, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1206,10 +1206,10 @@ func LessOrEqual(t TestingT, e1 interface{}, e2 interface{}, msgAndArgs ...inter // LessOrEqualf asserts that the first element is less than or equal to the second // -// assert.LessOrEqualf(t, 1, 2, "error message %s", "formatted") -// assert.LessOrEqualf(t, 2, 2, "error message %s", "formatted") -// assert.LessOrEqualf(t, "a", "b", "error message %s", "formatted") -// assert.LessOrEqualf(t, "b", "b", "error message %s", "formatted") +// require.LessOrEqualf(t, 1, 2, "error message %s", "formatted") +// require.LessOrEqualf(t, 2, 2, "error message %s", "formatted") +// require.LessOrEqualf(t, "a", "b", "error message %s", "formatted") +// require.LessOrEqualf(t, "b", "b", "error message %s", "formatted") func LessOrEqualf(t TestingT, e1 interface{}, e2 interface{}, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1222,9 +1222,9 @@ func LessOrEqualf(t TestingT, e1 interface{}, e2 interface{}, msg string, args . // Lessf asserts that the first element is less than the second // -// assert.Lessf(t, 1, 2, "error message %s", "formatted") -// assert.Lessf(t, float64(1), float64(2), "error message %s", "formatted") -// assert.Lessf(t, "a", "b", "error message %s", "formatted") +// require.Lessf(t, 1, 2, "error message %s", "formatted") +// require.Lessf(t, float64(1), float64(2), "error message %s", "formatted") +// require.Lessf(t, "a", "b", "error message %s", "formatted") func Lessf(t TestingT, e1 interface{}, e2 interface{}, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1237,8 +1237,8 @@ func Lessf(t TestingT, e1 interface{}, e2 interface{}, msg string, args ...inter // Negative asserts that the specified element is negative // -// assert.Negative(t, -1) -// assert.Negative(t, -1.23) +// require.Negative(t, -1) +// require.Negative(t, -1.23) func Negative(t TestingT, e interface{}, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1251,8 +1251,8 @@ func Negative(t TestingT, e interface{}, msgAndArgs ...interface{}) { // Negativef asserts that the specified element is negative // -// assert.Negativef(t, -1, "error message %s", "formatted") -// assert.Negativef(t, -1.23, "error message %s", "formatted") +// require.Negativef(t, -1, "error message %s", "formatted") +// require.Negativef(t, -1.23, "error message %s", "formatted") func Negativef(t TestingT, e interface{}, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1266,7 +1266,7 @@ func Negativef(t TestingT, e interface{}, msg string, args ...interface{}) { // Never asserts that the given condition doesn't satisfy in waitFor time, // periodically checking the target function each tick. // -// assert.Never(t, func() bool { return false; }, time.Second, 10*time.Millisecond) +// require.Never(t, func() bool { return false; }, time.Second, 10*time.Millisecond) func Never(t TestingT, condition func() bool, waitFor time.Duration, tick time.Duration, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1280,7 +1280,7 @@ func Never(t TestingT, condition func() bool, waitFor time.Duration, tick time.D // Neverf asserts that the given condition doesn't satisfy in waitFor time, // periodically checking the target function each tick. // -// assert.Neverf(t, func() bool { return false; }, time.Second, 10*time.Millisecond, "error message %s", "formatted") +// require.Neverf(t, func() bool { return false; }, time.Second, 10*time.Millisecond, "error message %s", "formatted") func Neverf(t TestingT, condition func() bool, waitFor time.Duration, tick time.Duration, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1293,7 +1293,7 @@ func Neverf(t TestingT, condition func() bool, waitFor time.Duration, tick time. // Nil asserts that the specified object is nil. // -// assert.Nil(t, err) +// require.Nil(t, err) func Nil(t TestingT, object interface{}, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1306,7 +1306,7 @@ func Nil(t TestingT, object interface{}, msgAndArgs ...interface{}) { // Nilf asserts that the specified object is nil. // -// assert.Nilf(t, err, "error message %s", "formatted") +// require.Nilf(t, err, "error message %s", "formatted") func Nilf(t TestingT, object interface{}, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1344,8 +1344,8 @@ func NoDirExistsf(t TestingT, path string, msg string, args ...interface{}) { // NoError asserts that a function returned no error (i.e. `nil`). // // actualObj, err := SomeFunction() -// if assert.NoError(t, err) { -// assert.Equal(t, expectedObj, actualObj) +// if require.NoError(t, err) { +// require.Equal(t, expectedObj, actualObj) // } func NoError(t TestingT, err error, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { @@ -1360,8 +1360,8 @@ func NoError(t TestingT, err error, msgAndArgs ...interface{}) { // NoErrorf asserts that a function returned no error (i.e. `nil`). // // actualObj, err := SomeFunction() -// if assert.NoErrorf(t, err, "error message %s", "formatted") { -// assert.Equal(t, expectedObj, actualObj) +// if require.NoErrorf(t, err, "error message %s", "formatted") { +// require.Equal(t, expectedObj, actualObj) // } func NoErrorf(t TestingT, err error, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { @@ -1400,9 +1400,9 @@ func NoFileExistsf(t TestingT, path string, msg string, args ...interface{}) { // NotContains asserts that the specified string, list(array, slice...) or map does NOT contain the // specified substring or element. // -// assert.NotContains(t, "Hello World", "Earth") -// assert.NotContains(t, ["Hello", "World"], "Earth") -// assert.NotContains(t, {"Hello": "World"}, "Earth") +// require.NotContains(t, "Hello World", "Earth") +// require.NotContains(t, ["Hello", "World"], "Earth") +// require.NotContains(t, {"Hello": "World"}, "Earth") func NotContains(t TestingT, s interface{}, contains interface{}, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1416,9 +1416,9 @@ func NotContains(t TestingT, s interface{}, contains interface{}, msgAndArgs ... // NotContainsf asserts that the specified string, list(array, slice...) or map does NOT contain the // specified substring or element. // -// assert.NotContainsf(t, "Hello World", "Earth", "error message %s", "formatted") -// assert.NotContainsf(t, ["Hello", "World"], "Earth", "error message %s", "formatted") -// assert.NotContainsf(t, {"Hello": "World"}, "Earth", "error message %s", "formatted") +// require.NotContainsf(t, "Hello World", "Earth", "error message %s", "formatted") +// require.NotContainsf(t, ["Hello", "World"], "Earth", "error message %s", "formatted") +// require.NotContainsf(t, {"Hello": "World"}, "Earth", "error message %s", "formatted") func NotContainsf(t TestingT, s interface{}, contains interface{}, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1429,11 +1429,51 @@ func NotContainsf(t TestingT, s interface{}, contains interface{}, msg string, a t.FailNow() } +// NotElementsMatch asserts that the specified listA(array, slice...) is NOT equal to specified +// listB(array, slice...) ignoring the order of the elements. If there are duplicate elements, +// the number of appearances of each of them in both lists should not match. +// This is an inverse of ElementsMatch. +// +// require.NotElementsMatch(t, [1, 1, 2, 3], [1, 1, 2, 3]) -> false +// +// require.NotElementsMatch(t, [1, 1, 2, 3], [1, 2, 3]) -> true +// +// require.NotElementsMatch(t, [1, 2, 3], [1, 2, 4]) -> true +func NotElementsMatch(t TestingT, listA interface{}, listB interface{}, msgAndArgs ...interface{}) { + if h, ok := t.(tHelper); ok { + h.Helper() + } + if assert.NotElementsMatch(t, listA, listB, msgAndArgs...) { + return + } + t.FailNow() +} + +// NotElementsMatchf asserts that the specified listA(array, slice...) is NOT equal to specified +// listB(array, slice...) ignoring the order of the elements. If there are duplicate elements, +// the number of appearances of each of them in both lists should not match. +// This is an inverse of ElementsMatch. +// +// require.NotElementsMatchf(t, [1, 1, 2, 3], [1, 1, 2, 3], "error message %s", "formatted") -> false +// +// require.NotElementsMatchf(t, [1, 1, 2, 3], [1, 2, 3], "error message %s", "formatted") -> true +// +// require.NotElementsMatchf(t, [1, 2, 3], [1, 2, 4], "error message %s", "formatted") -> true +func NotElementsMatchf(t TestingT, listA interface{}, listB interface{}, msg string, args ...interface{}) { + if h, ok := t.(tHelper); ok { + h.Helper() + } + if assert.NotElementsMatchf(t, listA, listB, msg, args...) { + return + } + t.FailNow() +} + // NotEmpty asserts that the specified object is NOT empty. I.e. not nil, "", false, 0 or either // a slice or a channel with len == 0. // -// if assert.NotEmpty(t, obj) { -// assert.Equal(t, "two", obj[1]) +// if require.NotEmpty(t, obj) { +// require.Equal(t, "two", obj[1]) // } func NotEmpty(t TestingT, object interface{}, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { @@ -1448,8 +1488,8 @@ func NotEmpty(t TestingT, object interface{}, msgAndArgs ...interface{}) { // NotEmptyf asserts that the specified object is NOT empty. I.e. not nil, "", false, 0 or either // a slice or a channel with len == 0. // -// if assert.NotEmptyf(t, obj, "error message %s", "formatted") { -// assert.Equal(t, "two", obj[1]) +// if require.NotEmptyf(t, obj, "error message %s", "formatted") { +// require.Equal(t, "two", obj[1]) // } func NotEmptyf(t TestingT, object interface{}, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { @@ -1463,7 +1503,7 @@ func NotEmptyf(t TestingT, object interface{}, msg string, args ...interface{}) // NotEqual asserts that the specified values are NOT equal. // -// assert.NotEqual(t, obj1, obj2) +// require.NotEqual(t, obj1, obj2) // // Pointer variable equality is determined based on the equality of the // referenced values (as opposed to the memory addresses). @@ -1479,7 +1519,7 @@ func NotEqual(t TestingT, expected interface{}, actual interface{}, msgAndArgs . // NotEqualValues asserts that two objects are not equal even when converted to the same type // -// assert.NotEqualValues(t, obj1, obj2) +// require.NotEqualValues(t, obj1, obj2) func NotEqualValues(t TestingT, expected interface{}, actual interface{}, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1492,7 +1532,7 @@ func NotEqualValues(t TestingT, expected interface{}, actual interface{}, msgAnd // NotEqualValuesf asserts that two objects are not equal even when converted to the same type // -// assert.NotEqualValuesf(t, obj1, obj2, "error message %s", "formatted") +// require.NotEqualValuesf(t, obj1, obj2, "error message %s", "formatted") func NotEqualValuesf(t TestingT, expected interface{}, actual interface{}, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1505,7 +1545,7 @@ func NotEqualValuesf(t TestingT, expected interface{}, actual interface{}, msg s // NotEqualf asserts that the specified values are NOT equal. // -// assert.NotEqualf(t, obj1, obj2, "error message %s", "formatted") +// require.NotEqualf(t, obj1, obj2, "error message %s", "formatted") // // Pointer variable equality is determined based on the equality of the // referenced values (as opposed to the memory addresses). @@ -1519,7 +1559,31 @@ func NotEqualf(t TestingT, expected interface{}, actual interface{}, msg string, t.FailNow() } -// NotErrorIs asserts that at none of the errors in err's chain matches target. +// NotErrorAs asserts that none of the errors in err's chain matches target, +// but if so, sets target to that error value. +func NotErrorAs(t TestingT, err error, target interface{}, msgAndArgs ...interface{}) { + if h, ok := t.(tHelper); ok { + h.Helper() + } + if assert.NotErrorAs(t, err, target, msgAndArgs...) { + return + } + t.FailNow() +} + +// NotErrorAsf asserts that none of the errors in err's chain matches target, +// but if so, sets target to that error value. +func NotErrorAsf(t TestingT, err error, target interface{}, msg string, args ...interface{}) { + if h, ok := t.(tHelper); ok { + h.Helper() + } + if assert.NotErrorAsf(t, err, target, msg, args...) { + return + } + t.FailNow() +} + +// NotErrorIs asserts that none of the errors in err's chain matches target. // This is a wrapper for errors.Is. func NotErrorIs(t TestingT, err error, target error, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { @@ -1531,7 +1595,7 @@ func NotErrorIs(t TestingT, err error, target error, msgAndArgs ...interface{}) t.FailNow() } -// NotErrorIsf asserts that at none of the errors in err's chain matches target. +// NotErrorIsf asserts that none of the errors in err's chain matches target. // This is a wrapper for errors.Is. func NotErrorIsf(t TestingT, err error, target error, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { @@ -1545,7 +1609,7 @@ func NotErrorIsf(t TestingT, err error, target error, msg string, args ...interf // NotImplements asserts that an object does not implement the specified interface. // -// assert.NotImplements(t, (*MyInterface)(nil), new(MyObject)) +// require.NotImplements(t, (*MyInterface)(nil), new(MyObject)) func NotImplements(t TestingT, interfaceObject interface{}, object interface{}, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1558,7 +1622,7 @@ func NotImplements(t TestingT, interfaceObject interface{}, object interface{}, // NotImplementsf asserts that an object does not implement the specified interface. // -// assert.NotImplementsf(t, (*MyInterface)(nil), new(MyObject), "error message %s", "formatted") +// require.NotImplementsf(t, (*MyInterface)(nil), new(MyObject), "error message %s", "formatted") func NotImplementsf(t TestingT, interfaceObject interface{}, object interface{}, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1571,7 +1635,7 @@ func NotImplementsf(t TestingT, interfaceObject interface{}, object interface{}, // NotNil asserts that the specified object is not nil. // -// assert.NotNil(t, err) +// require.NotNil(t, err) func NotNil(t TestingT, object interface{}, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1584,7 +1648,7 @@ func NotNil(t TestingT, object interface{}, msgAndArgs ...interface{}) { // NotNilf asserts that the specified object is not nil. // -// assert.NotNilf(t, err, "error message %s", "formatted") +// require.NotNilf(t, err, "error message %s", "formatted") func NotNilf(t TestingT, object interface{}, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1597,7 +1661,7 @@ func NotNilf(t TestingT, object interface{}, msg string, args ...interface{}) { // NotPanics asserts that the code inside the specified PanicTestFunc does NOT panic. // -// assert.NotPanics(t, func(){ RemainCalm() }) +// require.NotPanics(t, func(){ RemainCalm() }) func NotPanics(t TestingT, f assert.PanicTestFunc, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1610,7 +1674,7 @@ func NotPanics(t TestingT, f assert.PanicTestFunc, msgAndArgs ...interface{}) { // NotPanicsf asserts that the code inside the specified PanicTestFunc does NOT panic. // -// assert.NotPanicsf(t, func(){ RemainCalm() }, "error message %s", "formatted") +// require.NotPanicsf(t, func(){ RemainCalm() }, "error message %s", "formatted") func NotPanicsf(t TestingT, f assert.PanicTestFunc, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1623,8 +1687,8 @@ func NotPanicsf(t TestingT, f assert.PanicTestFunc, msg string, args ...interfac // NotRegexp asserts that a specified regexp does not match a string. // -// assert.NotRegexp(t, regexp.MustCompile("starts"), "it's starting") -// assert.NotRegexp(t, "^start", "it's not starting") +// require.NotRegexp(t, regexp.MustCompile("starts"), "it's starting") +// require.NotRegexp(t, "^start", "it's not starting") func NotRegexp(t TestingT, rx interface{}, str interface{}, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1637,8 +1701,8 @@ func NotRegexp(t TestingT, rx interface{}, str interface{}, msgAndArgs ...interf // NotRegexpf asserts that a specified regexp does not match a string. // -// assert.NotRegexpf(t, regexp.MustCompile("starts"), "it's starting", "error message %s", "formatted") -// assert.NotRegexpf(t, "^start", "it's not starting", "error message %s", "formatted") +// require.NotRegexpf(t, regexp.MustCompile("starts"), "it's starting", "error message %s", "formatted") +// require.NotRegexpf(t, "^start", "it's not starting", "error message %s", "formatted") func NotRegexpf(t TestingT, rx interface{}, str interface{}, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1651,7 +1715,7 @@ func NotRegexpf(t TestingT, rx interface{}, str interface{}, msg string, args .. // NotSame asserts that two pointers do not reference the same object. // -// assert.NotSame(t, ptr1, ptr2) +// require.NotSame(t, ptr1, ptr2) // // Both arguments must be pointer variables. Pointer variable sameness is // determined based on the equality of both type and value. @@ -1667,7 +1731,7 @@ func NotSame(t TestingT, expected interface{}, actual interface{}, msgAndArgs .. // NotSamef asserts that two pointers do not reference the same object. // -// assert.NotSamef(t, ptr1, ptr2, "error message %s", "formatted") +// require.NotSamef(t, ptr1, ptr2, "error message %s", "formatted") // // Both arguments must be pointer variables. Pointer variable sameness is // determined based on the equality of both type and value. @@ -1685,8 +1749,8 @@ func NotSamef(t TestingT, expected interface{}, actual interface{}, msg string, // contain all elements given in the specified subset list(array, slice...) or // map. // -// assert.NotSubset(t, [1, 3, 4], [1, 2]) -// assert.NotSubset(t, {"x": 1, "y": 2}, {"z": 3}) +// require.NotSubset(t, [1, 3, 4], [1, 2]) +// require.NotSubset(t, {"x": 1, "y": 2}, {"z": 3}) func NotSubset(t TestingT, list interface{}, subset interface{}, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1701,8 +1765,8 @@ func NotSubset(t TestingT, list interface{}, subset interface{}, msgAndArgs ...i // contain all elements given in the specified subset list(array, slice...) or // map. // -// assert.NotSubsetf(t, [1, 3, 4], [1, 2], "error message %s", "formatted") -// assert.NotSubsetf(t, {"x": 1, "y": 2}, {"z": 3}, "error message %s", "formatted") +// require.NotSubsetf(t, [1, 3, 4], [1, 2], "error message %s", "formatted") +// require.NotSubsetf(t, {"x": 1, "y": 2}, {"z": 3}, "error message %s", "formatted") func NotSubsetf(t TestingT, list interface{}, subset interface{}, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1737,7 +1801,7 @@ func NotZerof(t TestingT, i interface{}, msg string, args ...interface{}) { // Panics asserts that the code inside the specified PanicTestFunc panics. // -// assert.Panics(t, func(){ GoCrazy() }) +// require.Panics(t, func(){ GoCrazy() }) func Panics(t TestingT, f assert.PanicTestFunc, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1752,7 +1816,7 @@ func Panics(t TestingT, f assert.PanicTestFunc, msgAndArgs ...interface{}) { // panics, and that the recovered panic value is an error that satisfies the // EqualError comparison. // -// assert.PanicsWithError(t, "crazy error", func(){ GoCrazy() }) +// require.PanicsWithError(t, "crazy error", func(){ GoCrazy() }) func PanicsWithError(t TestingT, errString string, f assert.PanicTestFunc, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1767,7 +1831,7 @@ func PanicsWithError(t TestingT, errString string, f assert.PanicTestFunc, msgAn // panics, and that the recovered panic value is an error that satisfies the // EqualError comparison. // -// assert.PanicsWithErrorf(t, "crazy error", func(){ GoCrazy() }, "error message %s", "formatted") +// require.PanicsWithErrorf(t, "crazy error", func(){ GoCrazy() }, "error message %s", "formatted") func PanicsWithErrorf(t TestingT, errString string, f assert.PanicTestFunc, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1781,7 +1845,7 @@ func PanicsWithErrorf(t TestingT, errString string, f assert.PanicTestFunc, msg // PanicsWithValue asserts that the code inside the specified PanicTestFunc panics, and that // the recovered panic value equals the expected panic value. // -// assert.PanicsWithValue(t, "crazy error", func(){ GoCrazy() }) +// require.PanicsWithValue(t, "crazy error", func(){ GoCrazy() }) func PanicsWithValue(t TestingT, expected interface{}, f assert.PanicTestFunc, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1795,7 +1859,7 @@ func PanicsWithValue(t TestingT, expected interface{}, f assert.PanicTestFunc, m // PanicsWithValuef asserts that the code inside the specified PanicTestFunc panics, and that // the recovered panic value equals the expected panic value. // -// assert.PanicsWithValuef(t, "crazy error", func(){ GoCrazy() }, "error message %s", "formatted") +// require.PanicsWithValuef(t, "crazy error", func(){ GoCrazy() }, "error message %s", "formatted") func PanicsWithValuef(t TestingT, expected interface{}, f assert.PanicTestFunc, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1808,7 +1872,7 @@ func PanicsWithValuef(t TestingT, expected interface{}, f assert.PanicTestFunc, // Panicsf asserts that the code inside the specified PanicTestFunc panics. // -// assert.Panicsf(t, func(){ GoCrazy() }, "error message %s", "formatted") +// require.Panicsf(t, func(){ GoCrazy() }, "error message %s", "formatted") func Panicsf(t TestingT, f assert.PanicTestFunc, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1821,8 +1885,8 @@ func Panicsf(t TestingT, f assert.PanicTestFunc, msg string, args ...interface{} // Positive asserts that the specified element is positive // -// assert.Positive(t, 1) -// assert.Positive(t, 1.23) +// require.Positive(t, 1) +// require.Positive(t, 1.23) func Positive(t TestingT, e interface{}, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1835,8 +1899,8 @@ func Positive(t TestingT, e interface{}, msgAndArgs ...interface{}) { // Positivef asserts that the specified element is positive // -// assert.Positivef(t, 1, "error message %s", "formatted") -// assert.Positivef(t, 1.23, "error message %s", "formatted") +// require.Positivef(t, 1, "error message %s", "formatted") +// require.Positivef(t, 1.23, "error message %s", "formatted") func Positivef(t TestingT, e interface{}, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1849,8 +1913,8 @@ func Positivef(t TestingT, e interface{}, msg string, args ...interface{}) { // Regexp asserts that a specified regexp matches a string. // -// assert.Regexp(t, regexp.MustCompile("start"), "it's starting") -// assert.Regexp(t, "start...$", "it's not starting") +// require.Regexp(t, regexp.MustCompile("start"), "it's starting") +// require.Regexp(t, "start...$", "it's not starting") func Regexp(t TestingT, rx interface{}, str interface{}, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1863,8 +1927,8 @@ func Regexp(t TestingT, rx interface{}, str interface{}, msgAndArgs ...interface // Regexpf asserts that a specified regexp matches a string. // -// assert.Regexpf(t, regexp.MustCompile("start"), "it's starting", "error message %s", "formatted") -// assert.Regexpf(t, "start...$", "it's not starting", "error message %s", "formatted") +// require.Regexpf(t, regexp.MustCompile("start"), "it's starting", "error message %s", "formatted") +// require.Regexpf(t, "start...$", "it's not starting", "error message %s", "formatted") func Regexpf(t TestingT, rx interface{}, str interface{}, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1877,7 +1941,7 @@ func Regexpf(t TestingT, rx interface{}, str interface{}, msg string, args ...in // Same asserts that two pointers reference the same object. // -// assert.Same(t, ptr1, ptr2) +// require.Same(t, ptr1, ptr2) // // Both arguments must be pointer variables. Pointer variable sameness is // determined based on the equality of both type and value. @@ -1893,7 +1957,7 @@ func Same(t TestingT, expected interface{}, actual interface{}, msgAndArgs ...in // Samef asserts that two pointers reference the same object. // -// assert.Samef(t, ptr1, ptr2, "error message %s", "formatted") +// require.Samef(t, ptr1, ptr2, "error message %s", "formatted") // // Both arguments must be pointer variables. Pointer variable sameness is // determined based on the equality of both type and value. @@ -1910,8 +1974,8 @@ func Samef(t TestingT, expected interface{}, actual interface{}, msg string, arg // Subset asserts that the specified list(array, slice...) or map contains all // elements given in the specified subset list(array, slice...) or map. // -// assert.Subset(t, [1, 2, 3], [1, 2]) -// assert.Subset(t, {"x": 1, "y": 2}, {"x": 1}) +// require.Subset(t, [1, 2, 3], [1, 2]) +// require.Subset(t, {"x": 1, "y": 2}, {"x": 1}) func Subset(t TestingT, list interface{}, subset interface{}, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1925,8 +1989,8 @@ func Subset(t TestingT, list interface{}, subset interface{}, msgAndArgs ...inte // Subsetf asserts that the specified list(array, slice...) or map contains all // elements given in the specified subset list(array, slice...) or map. // -// assert.Subsetf(t, [1, 2, 3], [1, 2], "error message %s", "formatted") -// assert.Subsetf(t, {"x": 1, "y": 2}, {"x": 1}, "error message %s", "formatted") +// require.Subsetf(t, [1, 2, 3], [1, 2], "error message %s", "formatted") +// require.Subsetf(t, {"x": 1, "y": 2}, {"x": 1}, "error message %s", "formatted") func Subsetf(t TestingT, list interface{}, subset interface{}, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1939,7 +2003,7 @@ func Subsetf(t TestingT, list interface{}, subset interface{}, msg string, args // True asserts that the specified value is true. // -// assert.True(t, myBool) +// require.True(t, myBool) func True(t TestingT, value bool, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1952,7 +2016,7 @@ func True(t TestingT, value bool, msgAndArgs ...interface{}) { // Truef asserts that the specified value is true. // -// assert.Truef(t, myBool, "error message %s", "formatted") +// require.Truef(t, myBool, "error message %s", "formatted") func Truef(t TestingT, value bool, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1965,7 +2029,7 @@ func Truef(t TestingT, value bool, msg string, args ...interface{}) { // WithinDuration asserts that the two times are within duration delta of each other. // -// assert.WithinDuration(t, time.Now(), time.Now(), 10*time.Second) +// require.WithinDuration(t, time.Now(), time.Now(), 10*time.Second) func WithinDuration(t TestingT, expected time.Time, actual time.Time, delta time.Duration, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1978,7 +2042,7 @@ func WithinDuration(t TestingT, expected time.Time, actual time.Time, delta time // WithinDurationf asserts that the two times are within duration delta of each other. // -// assert.WithinDurationf(t, time.Now(), time.Now(), 10*time.Second, "error message %s", "formatted") +// require.WithinDurationf(t, time.Now(), time.Now(), 10*time.Second, "error message %s", "formatted") func WithinDurationf(t TestingT, expected time.Time, actual time.Time, delta time.Duration, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -1991,7 +2055,7 @@ func WithinDurationf(t TestingT, expected time.Time, actual time.Time, delta tim // WithinRange asserts that a time is within a time range (inclusive). // -// assert.WithinRange(t, time.Now(), time.Now().Add(-time.Second), time.Now().Add(time.Second)) +// require.WithinRange(t, time.Now(), time.Now().Add(-time.Second), time.Now().Add(time.Second)) func WithinRange(t TestingT, actual time.Time, start time.Time, end time.Time, msgAndArgs ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() @@ -2004,7 +2068,7 @@ func WithinRange(t TestingT, actual time.Time, start time.Time, end time.Time, m // WithinRangef asserts that a time is within a time range (inclusive). // -// assert.WithinRangef(t, time.Now(), time.Now().Add(-time.Second), time.Now().Add(time.Second), "error message %s", "formatted") +// require.WithinRangef(t, time.Now(), time.Now().Add(-time.Second), time.Now().Add(time.Second), "error message %s", "formatted") func WithinRangef(t TestingT, actual time.Time, start time.Time, end time.Time, msg string, args ...interface{}) { if h, ok := t.(tHelper); ok { h.Helper() diff --git a/vendor/github.com/stretchr/testify/require/require.go.tmpl b/vendor/github.com/stretchr/testify/require/require.go.tmpl index 55e42dde..8b328368 100644 --- a/vendor/github.com/stretchr/testify/require/require.go.tmpl +++ b/vendor/github.com/stretchr/testify/require/require.go.tmpl @@ -1,4 +1,4 @@ -{{.Comment}} +{{ replace .Comment "assert." "require."}} func {{.DocInfo.Name}}(t TestingT, {{.Params}}) { if h, ok := t.(tHelper); ok { h.Helper() } if assert.{{.DocInfo.Name}}(t, {{.ForwardedParams}}) { return } diff --git a/vendor/github.com/stretchr/testify/require/require_forward.go b/vendor/github.com/stretchr/testify/require/require_forward.go index eee8310a..1bd87304 100644 --- a/vendor/github.com/stretchr/testify/require/require_forward.go +++ b/vendor/github.com/stretchr/testify/require/require_forward.go @@ -187,8 +187,8 @@ func (a *Assertions) EqualExportedValuesf(expected interface{}, actual interface EqualExportedValuesf(a.t, expected, actual, msg, args...) } -// EqualValues asserts that two objects are equal or convertible to the same types -// and equal. +// EqualValues asserts that two objects are equal or convertible to the larger +// type and equal. // // a.EqualValues(uint32(123), int32(123)) func (a *Assertions) EqualValues(expected interface{}, actual interface{}, msgAndArgs ...interface{}) { @@ -198,8 +198,8 @@ func (a *Assertions) EqualValues(expected interface{}, actual interface{}, msgAn EqualValues(a.t, expected, actual, msgAndArgs...) } -// EqualValuesf asserts that two objects are equal or convertible to the same types -// and equal. +// EqualValuesf asserts that two objects are equal or convertible to the larger +// type and equal. // // a.EqualValuesf(uint32(123), int32(123), "error message %s", "formatted") func (a *Assertions) EqualValuesf(expected interface{}, actual interface{}, msg string, args ...interface{}) { @@ -337,7 +337,7 @@ func (a *Assertions) Eventually(condition func() bool, waitFor time.Duration, ti // a.EventuallyWithT(func(c *assert.CollectT) { // // add assertions as needed; any assertion failure will fail the current tick // assert.True(c, externalValue, "expected 'externalValue' to be true") -// }, 1*time.Second, 10*time.Second, "external state has not changed to 'true'; still false") +// }, 10*time.Second, 1*time.Second, "external state has not changed to 'true'; still false") func (a *Assertions) EventuallyWithT(condition func(collect *assert.CollectT), waitFor time.Duration, tick time.Duration, msgAndArgs ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -362,7 +362,7 @@ func (a *Assertions) EventuallyWithT(condition func(collect *assert.CollectT), w // a.EventuallyWithTf(func(c *assert.CollectT, "error message %s", "formatted") { // // add assertions as needed; any assertion failure will fail the current tick // assert.True(c, externalValue, "expected 'externalValue' to be true") -// }, 1*time.Second, 10*time.Second, "external state has not changed to 'true'; still false") +// }, 10*time.Second, 1*time.Second, "external state has not changed to 'true'; still false") func (a *Assertions) EventuallyWithTf(condition func(collect *assert.CollectT), waitFor time.Duration, tick time.Duration, msg string, args ...interface{}) { if h, ok := a.t.(tHelper); ok { h.Helper() @@ -1129,6 +1129,40 @@ func (a *Assertions) NotContainsf(s interface{}, contains interface{}, msg strin NotContainsf(a.t, s, contains, msg, args...) } +// NotElementsMatch asserts that the specified listA(array, slice...) is NOT equal to specified +// listB(array, slice...) ignoring the order of the elements. If there are duplicate elements, +// the number of appearances of each of them in both lists should not match. +// This is an inverse of ElementsMatch. +// +// a.NotElementsMatch([1, 1, 2, 3], [1, 1, 2, 3]) -> false +// +// a.NotElementsMatch([1, 1, 2, 3], [1, 2, 3]) -> true +// +// a.NotElementsMatch([1, 2, 3], [1, 2, 4]) -> true +func (a *Assertions) NotElementsMatch(listA interface{}, listB interface{}, msgAndArgs ...interface{}) { + if h, ok := a.t.(tHelper); ok { + h.Helper() + } + NotElementsMatch(a.t, listA, listB, msgAndArgs...) +} + +// NotElementsMatchf asserts that the specified listA(array, slice...) is NOT equal to specified +// listB(array, slice...) ignoring the order of the elements. If there are duplicate elements, +// the number of appearances of each of them in both lists should not match. +// This is an inverse of ElementsMatch. +// +// a.NotElementsMatchf([1, 1, 2, 3], [1, 1, 2, 3], "error message %s", "formatted") -> false +// +// a.NotElementsMatchf([1, 1, 2, 3], [1, 2, 3], "error message %s", "formatted") -> true +// +// a.NotElementsMatchf([1, 2, 3], [1, 2, 4], "error message %s", "formatted") -> true +func (a *Assertions) NotElementsMatchf(listA interface{}, listB interface{}, msg string, args ...interface{}) { + if h, ok := a.t.(tHelper); ok { + h.Helper() + } + NotElementsMatchf(a.t, listA, listB, msg, args...) +} + // NotEmpty asserts that the specified object is NOT empty. I.e. not nil, "", false, 0 or either // a slice or a channel with len == 0. // @@ -1201,7 +1235,25 @@ func (a *Assertions) NotEqualf(expected interface{}, actual interface{}, msg str NotEqualf(a.t, expected, actual, msg, args...) } -// NotErrorIs asserts that at none of the errors in err's chain matches target. +// NotErrorAs asserts that none of the errors in err's chain matches target, +// but if so, sets target to that error value. +func (a *Assertions) NotErrorAs(err error, target interface{}, msgAndArgs ...interface{}) { + if h, ok := a.t.(tHelper); ok { + h.Helper() + } + NotErrorAs(a.t, err, target, msgAndArgs...) +} + +// NotErrorAsf asserts that none of the errors in err's chain matches target, +// but if so, sets target to that error value. +func (a *Assertions) NotErrorAsf(err error, target interface{}, msg string, args ...interface{}) { + if h, ok := a.t.(tHelper); ok { + h.Helper() + } + NotErrorAsf(a.t, err, target, msg, args...) +} + +// NotErrorIs asserts that none of the errors in err's chain matches target. // This is a wrapper for errors.Is. func (a *Assertions) NotErrorIs(err error, target error, msgAndArgs ...interface{}) { if h, ok := a.t.(tHelper); ok { @@ -1210,7 +1262,7 @@ func (a *Assertions) NotErrorIs(err error, target error, msgAndArgs ...interface NotErrorIs(a.t, err, target, msgAndArgs...) } -// NotErrorIsf asserts that at none of the errors in err's chain matches target. +// NotErrorIsf asserts that none of the errors in err's chain matches target. // This is a wrapper for errors.Is. func (a *Assertions) NotErrorIsf(err error, target error, msg string, args ...interface{}) { if h, ok := a.t.(tHelper); ok { diff --git a/vendor/github.com/stretchr/testify/require/requirements.go b/vendor/github.com/stretchr/testify/require/requirements.go index 91772dfe..6b7ce929 100644 --- a/vendor/github.com/stretchr/testify/require/requirements.go +++ b/vendor/github.com/stretchr/testify/require/requirements.go @@ -6,7 +6,7 @@ type TestingT interface { FailNow() } -type tHelper interface { +type tHelper = interface { Helper() } diff --git a/vendor/github.com/swaggo/files/v2/Makefile b/vendor/github.com/swaggo/files/v2/Makefile index 9ee79423..05ee7fe2 100644 --- a/vendor/github.com/swaggo/files/v2/Makefile +++ b/vendor/github.com/swaggo/files/v2/Makefile @@ -4,7 +4,21 @@ all: build init: git submodule update --init --recursive -.PHONY: build -build: +.PHONY: update-submodule +update-submodule: init + # Fetch the latest tags + cd swagger-ui && git fetch --tags + # Get the latest tag + $(eval LATEST_TAG := $(shell cd swagger-ui && git describe --tags `git rev-list --tags --max-count=1`)) + @echo "Latest tag for swagger-ui: $(LATEST_TAG)" + # Checkout the latest tag + cd swagger-ui && git checkout $(LATEST_TAG) + @echo "Updated submodule swagger-ui to latest tag: ${LATEST_TAG}" + +.PHONY: clean +clean: rm -rf dist/* + +.PHONY: build +build: clean cp -r swagger-ui/dist/* dist/ \ No newline at end of file diff --git a/vendor/github.com/swaggo/files/v2/README.md b/vendor/github.com/swaggo/files/v2/README.md index 7732bdba..6b54b472 100644 --- a/vendor/github.com/swaggo/files/v2/README.md +++ b/vendor/github.com/swaggo/files/v2/README.md @@ -3,7 +3,14 @@ [![Build Status](https://github.com/swaggo/files/actions/workflows/ci.yml/badge.svg?branch=master)](https://github.com/features/actions) [![Go Report Card](https://goreportcard.com/badge/github.com/swaggo/files)](https://goreportcard.com/report/github.com/swaggo/files) -Generate swagger ui embedded files by using: +## How to update submodule and create a new bundle: + +```console +# Update submodule to latest tagged release of swagger-ui +make update-submodule + +# Create new dist bundle +make build ``` - make -``` \ No newline at end of file + +You can now create a commit and push changes to GitHub \ No newline at end of file diff --git a/vendor/github.com/swaggo/files/v2/dist/swagger-ui-bundle.js b/vendor/github.com/swaggo/files/v2/dist/swagger-ui-bundle.js index ef539d2c..45262199 100644 --- a/vendor/github.com/swaggo/files/v2/dist/swagger-ui-bundle.js +++ b/vendor/github.com/swaggo/files/v2/dist/swagger-ui-bundle.js @@ -1,2 +1,2 @@ /*! For license information please see swagger-ui-bundle.js.LICENSE.txt */ -!function webpackUniversalModuleDefinition(s,i){"object"==typeof exports&&"object"==typeof module?module.exports=i():"function"==typeof define&&define.amd?define([],i):"object"==typeof exports?exports.SwaggerUIBundle=i():s.SwaggerUIBundle=i()}(this,(()=>(()=>{var s,i,u={69119:(s,i)=>{"use strict";Object.defineProperty(i,"__esModule",{value:!0}),i.BLANK_URL=i.relativeFirstCharacters=i.urlSchemeRegex=i.ctrlCharactersRegex=i.htmlCtrlEntityRegex=i.htmlEntitiesRegex=i.invalidProtocolRegex=void 0,i.invalidProtocolRegex=/^([^\w]*)(javascript|data|vbscript)/im,i.htmlEntitiesRegex=/&#(\w+)(^\w|;)?/g,i.htmlCtrlEntityRegex=/&(newline|tab);/gi,i.ctrlCharactersRegex=/[\u0000-\u001F\u007F-\u009F\u2000-\u200D\uFEFF]/gim,i.urlSchemeRegex=/^.+(:|:)/gim,i.relativeFirstCharacters=[".","/"],i.BLANK_URL="about:blank"},16750:(s,i,u)=>{"use strict";i.J=void 0;var _=u(69119);i.J=function sanitizeUrl(s){if(!s)return _.BLANK_URL;var i,u,w=s;do{i=(w=(u=w,u.replace(_.ctrlCharactersRegex,"").replace(_.htmlEntitiesRegex,(function(s,i){return String.fromCharCode(i)}))).replace(_.htmlCtrlEntityRegex,"").replace(_.ctrlCharactersRegex,"").trim()).match(_.ctrlCharactersRegex)||w.match(_.htmlEntitiesRegex)||w.match(_.htmlCtrlEntityRegex)}while(i&&i.length>0);var x=w;if(!x)return _.BLANK_URL;if(function isRelativeUrlWithoutProtocol(s){return _.relativeFirstCharacters.indexOf(s[0])>-1}(x))return x;var j=x.match(_.urlSchemeRegex);if(!j)return x;var L=j[0];return _.invalidProtocolRegex.test(L)?_.BLANK_URL:x}},67526:(s,i)=>{"use strict";i.byteLength=function byteLength(s){var i=getLens(s),u=i[0],_=i[1];return 3*(u+_)/4-_},i.toByteArray=function toByteArray(s){var i,u,x=getLens(s),j=x[0],L=x[1],B=new w(function _byteLength(s,i,u){return 3*(i+u)/4-u}(0,j,L)),$=0,U=L>0?j-4:j;for(u=0;u>16&255,B[$++]=i>>8&255,B[$++]=255&i;2===L&&(i=_[s.charCodeAt(u)]<<2|_[s.charCodeAt(u+1)]>>4,B[$++]=255&i);1===L&&(i=_[s.charCodeAt(u)]<<10|_[s.charCodeAt(u+1)]<<4|_[s.charCodeAt(u+2)]>>2,B[$++]=i>>8&255,B[$++]=255&i);return B},i.fromByteArray=function fromByteArray(s){for(var i,_=s.length,w=_%3,x=[],j=16383,L=0,B=_-w;LB?B:L+j));1===w?(i=s[_-1],x.push(u[i>>2]+u[i<<4&63]+"==")):2===w&&(i=(s[_-2]<<8)+s[_-1],x.push(u[i>>10]+u[i>>4&63]+u[i<<2&63]+"="));return x.join("")};for(var u=[],_=[],w="undefined"!=typeof Uint8Array?Uint8Array:Array,x="ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/",j=0;j<64;++j)u[j]=x[j],_[x.charCodeAt(j)]=j;function getLens(s){var i=s.length;if(i%4>0)throw new Error("Invalid string. Length must be a multiple of 4");var u=s.indexOf("=");return-1===u&&(u=i),[u,u===i?0:4-u%4]}function encodeChunk(s,i,_){for(var w,x,j=[],L=i;L<_;L+=3)w=(s[L]<<16&16711680)+(s[L+1]<<8&65280)+(255&s[L+2]),j.push(u[(x=w)>>18&63]+u[x>>12&63]+u[x>>6&63]+u[63&x]);return j.join("")}_["-".charCodeAt(0)]=62,_["_".charCodeAt(0)]=63},48287:(s,i,u)=>{"use strict";const _=u(67526),w=u(251),x="function"==typeof Symbol&&"function"==typeof Symbol.for?Symbol.for("nodejs.util.inspect.custom"):null;i.Buffer=Buffer,i.SlowBuffer=function SlowBuffer(s){+s!=s&&(s=0);return Buffer.alloc(+s)},i.INSPECT_MAX_BYTES=50;const j=2147483647;function createBuffer(s){if(s>j)throw new RangeError('The value "'+s+'" is invalid for option "size"');const i=new Uint8Array(s);return Object.setPrototypeOf(i,Buffer.prototype),i}function Buffer(s,i,u){if("number"==typeof s){if("string"==typeof i)throw new TypeError('The "string" argument must be of type string. Received type number');return allocUnsafe(s)}return from(s,i,u)}function from(s,i,u){if("string"==typeof s)return function fromString(s,i){"string"==typeof i&&""!==i||(i="utf8");if(!Buffer.isEncoding(i))throw new TypeError("Unknown encoding: "+i);const u=0|byteLength(s,i);let _=createBuffer(u);const w=_.write(s,i);w!==u&&(_=_.slice(0,w));return _}(s,i);if(ArrayBuffer.isView(s))return function fromArrayView(s){if(isInstance(s,Uint8Array)){const i=new Uint8Array(s);return fromArrayBuffer(i.buffer,i.byteOffset,i.byteLength)}return fromArrayLike(s)}(s);if(null==s)throw new TypeError("The first argument must be one of type string, Buffer, ArrayBuffer, Array, or Array-like Object. Received type "+typeof s);if(isInstance(s,ArrayBuffer)||s&&isInstance(s.buffer,ArrayBuffer))return fromArrayBuffer(s,i,u);if("undefined"!=typeof SharedArrayBuffer&&(isInstance(s,SharedArrayBuffer)||s&&isInstance(s.buffer,SharedArrayBuffer)))return fromArrayBuffer(s,i,u);if("number"==typeof s)throw new TypeError('The "value" argument must not be of type number. Received type number');const _=s.valueOf&&s.valueOf();if(null!=_&&_!==s)return Buffer.from(_,i,u);const w=function fromObject(s){if(Buffer.isBuffer(s)){const i=0|checked(s.length),u=createBuffer(i);return 0===u.length||s.copy(u,0,0,i),u}if(void 0!==s.length)return"number"!=typeof s.length||numberIsNaN(s.length)?createBuffer(0):fromArrayLike(s);if("Buffer"===s.type&&Array.isArray(s.data))return fromArrayLike(s.data)}(s);if(w)return w;if("undefined"!=typeof Symbol&&null!=Symbol.toPrimitive&&"function"==typeof s[Symbol.toPrimitive])return Buffer.from(s[Symbol.toPrimitive]("string"),i,u);throw new TypeError("The first argument must be one of type string, Buffer, ArrayBuffer, Array, or Array-like Object. Received type "+typeof s)}function assertSize(s){if("number"!=typeof s)throw new TypeError('"size" argument must be of type number');if(s<0)throw new RangeError('The value "'+s+'" is invalid for option "size"')}function allocUnsafe(s){return assertSize(s),createBuffer(s<0?0:0|checked(s))}function fromArrayLike(s){const i=s.length<0?0:0|checked(s.length),u=createBuffer(i);for(let _=0;_=j)throw new RangeError("Attempt to allocate Buffer larger than maximum size: 0x"+j.toString(16)+" bytes");return 0|s}function byteLength(s,i){if(Buffer.isBuffer(s))return s.length;if(ArrayBuffer.isView(s)||isInstance(s,ArrayBuffer))return s.byteLength;if("string"!=typeof s)throw new TypeError('The "string" argument must be one of type string, Buffer, or ArrayBuffer. Received type '+typeof s);const u=s.length,_=arguments.length>2&&!0===arguments[2];if(!_&&0===u)return 0;let w=!1;for(;;)switch(i){case"ascii":case"latin1":case"binary":return u;case"utf8":case"utf-8":return utf8ToBytes(s).length;case"ucs2":case"ucs-2":case"utf16le":case"utf-16le":return 2*u;case"hex":return u>>>1;case"base64":return base64ToBytes(s).length;default:if(w)return _?-1:utf8ToBytes(s).length;i=(""+i).toLowerCase(),w=!0}}function slowToString(s,i,u){let _=!1;if((void 0===i||i<0)&&(i=0),i>this.length)return"";if((void 0===u||u>this.length)&&(u=this.length),u<=0)return"";if((u>>>=0)<=(i>>>=0))return"";for(s||(s="utf8");;)switch(s){case"hex":return hexSlice(this,i,u);case"utf8":case"utf-8":return utf8Slice(this,i,u);case"ascii":return asciiSlice(this,i,u);case"latin1":case"binary":return latin1Slice(this,i,u);case"base64":return base64Slice(this,i,u);case"ucs2":case"ucs-2":case"utf16le":case"utf-16le":return utf16leSlice(this,i,u);default:if(_)throw new TypeError("Unknown encoding: "+s);s=(s+"").toLowerCase(),_=!0}}function swap(s,i,u){const _=s[i];s[i]=s[u],s[u]=_}function bidirectionalIndexOf(s,i,u,_,w){if(0===s.length)return-1;if("string"==typeof u?(_=u,u=0):u>2147483647?u=2147483647:u<-2147483648&&(u=-2147483648),numberIsNaN(u=+u)&&(u=w?0:s.length-1),u<0&&(u=s.length+u),u>=s.length){if(w)return-1;u=s.length-1}else if(u<0){if(!w)return-1;u=0}if("string"==typeof i&&(i=Buffer.from(i,_)),Buffer.isBuffer(i))return 0===i.length?-1:arrayIndexOf(s,i,u,_,w);if("number"==typeof i)return i&=255,"function"==typeof Uint8Array.prototype.indexOf?w?Uint8Array.prototype.indexOf.call(s,i,u):Uint8Array.prototype.lastIndexOf.call(s,i,u):arrayIndexOf(s,[i],u,_,w);throw new TypeError("val must be string, number or Buffer")}function arrayIndexOf(s,i,u,_,w){let x,j=1,L=s.length,B=i.length;if(void 0!==_&&("ucs2"===(_=String(_).toLowerCase())||"ucs-2"===_||"utf16le"===_||"utf-16le"===_)){if(s.length<2||i.length<2)return-1;j=2,L/=2,B/=2,u/=2}function read(s,i){return 1===j?s[i]:s.readUInt16BE(i*j)}if(w){let _=-1;for(x=u;xL&&(u=L-B),x=u;x>=0;x--){let u=!0;for(let _=0;_w&&(_=w):_=w;const x=i.length;let j;for(_>x/2&&(_=x/2),j=0;j<_;++j){const _=parseInt(i.substr(2*j,2),16);if(numberIsNaN(_))return j;s[u+j]=_}return j}function utf8Write(s,i,u,_){return blitBuffer(utf8ToBytes(i,s.length-u),s,u,_)}function asciiWrite(s,i,u,_){return blitBuffer(function asciiToBytes(s){const i=[];for(let u=0;u>8,w=u%256,x.push(w),x.push(_);return x}(i,s.length-u),s,u,_)}function base64Slice(s,i,u){return 0===i&&u===s.length?_.fromByteArray(s):_.fromByteArray(s.slice(i,u))}function utf8Slice(s,i,u){u=Math.min(s.length,u);const _=[];let w=i;for(;w239?4:i>223?3:i>191?2:1;if(w+j<=u){let u,_,L,B;switch(j){case 1:i<128&&(x=i);break;case 2:u=s[w+1],128==(192&u)&&(B=(31&i)<<6|63&u,B>127&&(x=B));break;case 3:u=s[w+1],_=s[w+2],128==(192&u)&&128==(192&_)&&(B=(15&i)<<12|(63&u)<<6|63&_,B>2047&&(B<55296||B>57343)&&(x=B));break;case 4:u=s[w+1],_=s[w+2],L=s[w+3],128==(192&u)&&128==(192&_)&&128==(192&L)&&(B=(15&i)<<18|(63&u)<<12|(63&_)<<6|63&L,B>65535&&B<1114112&&(x=B))}}null===x?(x=65533,j=1):x>65535&&(x-=65536,_.push(x>>>10&1023|55296),x=56320|1023&x),_.push(x),w+=j}return function decodeCodePointsArray(s){const i=s.length;if(i<=L)return String.fromCharCode.apply(String,s);let u="",_=0;for(;__.length?(Buffer.isBuffer(i)||(i=Buffer.from(i)),i.copy(_,w)):Uint8Array.prototype.set.call(_,i,w);else{if(!Buffer.isBuffer(i))throw new TypeError('"list" argument must be an Array of Buffers');i.copy(_,w)}w+=i.length}return _},Buffer.byteLength=byteLength,Buffer.prototype._isBuffer=!0,Buffer.prototype.swap16=function swap16(){const s=this.length;if(s%2!=0)throw new RangeError("Buffer size must be a multiple of 16-bits");for(let i=0;iu&&(s+=" ... "),""},x&&(Buffer.prototype[x]=Buffer.prototype.inspect),Buffer.prototype.compare=function compare(s,i,u,_,w){if(isInstance(s,Uint8Array)&&(s=Buffer.from(s,s.offset,s.byteLength)),!Buffer.isBuffer(s))throw new TypeError('The "target" argument must be one of type Buffer or Uint8Array. Received type '+typeof s);if(void 0===i&&(i=0),void 0===u&&(u=s?s.length:0),void 0===_&&(_=0),void 0===w&&(w=this.length),i<0||u>s.length||_<0||w>this.length)throw new RangeError("out of range index");if(_>=w&&i>=u)return 0;if(_>=w)return-1;if(i>=u)return 1;if(this===s)return 0;let x=(w>>>=0)-(_>>>=0),j=(u>>>=0)-(i>>>=0);const L=Math.min(x,j),B=this.slice(_,w),$=s.slice(i,u);for(let s=0;s>>=0,isFinite(u)?(u>>>=0,void 0===_&&(_="utf8")):(_=u,u=void 0)}const w=this.length-i;if((void 0===u||u>w)&&(u=w),s.length>0&&(u<0||i<0)||i>this.length)throw new RangeError("Attempt to write outside buffer bounds");_||(_="utf8");let x=!1;for(;;)switch(_){case"hex":return hexWrite(this,s,i,u);case"utf8":case"utf-8":return utf8Write(this,s,i,u);case"ascii":case"latin1":case"binary":return asciiWrite(this,s,i,u);case"base64":return base64Write(this,s,i,u);case"ucs2":case"ucs-2":case"utf16le":case"utf-16le":return ucs2Write(this,s,i,u);default:if(x)throw new TypeError("Unknown encoding: "+_);_=(""+_).toLowerCase(),x=!0}},Buffer.prototype.toJSON=function toJSON(){return{type:"Buffer",data:Array.prototype.slice.call(this._arr||this,0)}};const L=4096;function asciiSlice(s,i,u){let _="";u=Math.min(s.length,u);for(let w=i;w_)&&(u=_);let w="";for(let _=i;_u)throw new RangeError("Trying to access beyond buffer length")}function checkInt(s,i,u,_,w,x){if(!Buffer.isBuffer(s))throw new TypeError('"buffer" argument must be a Buffer instance');if(i>w||is.length)throw new RangeError("Index out of range")}function wrtBigUInt64LE(s,i,u,_,w){checkIntBI(i,_,w,s,u,7);let x=Number(i&BigInt(4294967295));s[u++]=x,x>>=8,s[u++]=x,x>>=8,s[u++]=x,x>>=8,s[u++]=x;let j=Number(i>>BigInt(32)&BigInt(4294967295));return s[u++]=j,j>>=8,s[u++]=j,j>>=8,s[u++]=j,j>>=8,s[u++]=j,u}function wrtBigUInt64BE(s,i,u,_,w){checkIntBI(i,_,w,s,u,7);let x=Number(i&BigInt(4294967295));s[u+7]=x,x>>=8,s[u+6]=x,x>>=8,s[u+5]=x,x>>=8,s[u+4]=x;let j=Number(i>>BigInt(32)&BigInt(4294967295));return s[u+3]=j,j>>=8,s[u+2]=j,j>>=8,s[u+1]=j,j>>=8,s[u]=j,u+8}function checkIEEE754(s,i,u,_,w,x){if(u+_>s.length)throw new RangeError("Index out of range");if(u<0)throw new RangeError("Index out of range")}function writeFloat(s,i,u,_,x){return i=+i,u>>>=0,x||checkIEEE754(s,0,u,4),w.write(s,i,u,_,23,4),u+4}function writeDouble(s,i,u,_,x){return i=+i,u>>>=0,x||checkIEEE754(s,0,u,8),w.write(s,i,u,_,52,8),u+8}Buffer.prototype.slice=function slice(s,i){const u=this.length;(s=~~s)<0?(s+=u)<0&&(s=0):s>u&&(s=u),(i=void 0===i?u:~~i)<0?(i+=u)<0&&(i=0):i>u&&(i=u),i>>=0,i>>>=0,u||checkOffset(s,i,this.length);let _=this[s],w=1,x=0;for(;++x>>=0,i>>>=0,u||checkOffset(s,i,this.length);let _=this[s+--i],w=1;for(;i>0&&(w*=256);)_+=this[s+--i]*w;return _},Buffer.prototype.readUint8=Buffer.prototype.readUInt8=function readUInt8(s,i){return s>>>=0,i||checkOffset(s,1,this.length),this[s]},Buffer.prototype.readUint16LE=Buffer.prototype.readUInt16LE=function readUInt16LE(s,i){return s>>>=0,i||checkOffset(s,2,this.length),this[s]|this[s+1]<<8},Buffer.prototype.readUint16BE=Buffer.prototype.readUInt16BE=function readUInt16BE(s,i){return s>>>=0,i||checkOffset(s,2,this.length),this[s]<<8|this[s+1]},Buffer.prototype.readUint32LE=Buffer.prototype.readUInt32LE=function readUInt32LE(s,i){return s>>>=0,i||checkOffset(s,4,this.length),(this[s]|this[s+1]<<8|this[s+2]<<16)+16777216*this[s+3]},Buffer.prototype.readUint32BE=Buffer.prototype.readUInt32BE=function readUInt32BE(s,i){return s>>>=0,i||checkOffset(s,4,this.length),16777216*this[s]+(this[s+1]<<16|this[s+2]<<8|this[s+3])},Buffer.prototype.readBigUInt64LE=defineBigIntMethod((function readBigUInt64LE(s){validateNumber(s>>>=0,"offset");const i=this[s],u=this[s+7];void 0!==i&&void 0!==u||boundsError(s,this.length-8);const _=i+256*this[++s]+65536*this[++s]+this[++s]*2**24,w=this[++s]+256*this[++s]+65536*this[++s]+u*2**24;return BigInt(_)+(BigInt(w)<>>=0,"offset");const i=this[s],u=this[s+7];void 0!==i&&void 0!==u||boundsError(s,this.length-8);const _=i*2**24+65536*this[++s]+256*this[++s]+this[++s],w=this[++s]*2**24+65536*this[++s]+256*this[++s]+u;return(BigInt(_)<>>=0,i>>>=0,u||checkOffset(s,i,this.length);let _=this[s],w=1,x=0;for(;++x=w&&(_-=Math.pow(2,8*i)),_},Buffer.prototype.readIntBE=function readIntBE(s,i,u){s>>>=0,i>>>=0,u||checkOffset(s,i,this.length);let _=i,w=1,x=this[s+--_];for(;_>0&&(w*=256);)x+=this[s+--_]*w;return w*=128,x>=w&&(x-=Math.pow(2,8*i)),x},Buffer.prototype.readInt8=function readInt8(s,i){return s>>>=0,i||checkOffset(s,1,this.length),128&this[s]?-1*(255-this[s]+1):this[s]},Buffer.prototype.readInt16LE=function readInt16LE(s,i){s>>>=0,i||checkOffset(s,2,this.length);const u=this[s]|this[s+1]<<8;return 32768&u?4294901760|u:u},Buffer.prototype.readInt16BE=function readInt16BE(s,i){s>>>=0,i||checkOffset(s,2,this.length);const u=this[s+1]|this[s]<<8;return 32768&u?4294901760|u:u},Buffer.prototype.readInt32LE=function readInt32LE(s,i){return s>>>=0,i||checkOffset(s,4,this.length),this[s]|this[s+1]<<8|this[s+2]<<16|this[s+3]<<24},Buffer.prototype.readInt32BE=function readInt32BE(s,i){return s>>>=0,i||checkOffset(s,4,this.length),this[s]<<24|this[s+1]<<16|this[s+2]<<8|this[s+3]},Buffer.prototype.readBigInt64LE=defineBigIntMethod((function readBigInt64LE(s){validateNumber(s>>>=0,"offset");const i=this[s],u=this[s+7];void 0!==i&&void 0!==u||boundsError(s,this.length-8);const _=this[s+4]+256*this[s+5]+65536*this[s+6]+(u<<24);return(BigInt(_)<>>=0,"offset");const i=this[s],u=this[s+7];void 0!==i&&void 0!==u||boundsError(s,this.length-8);const _=(i<<24)+65536*this[++s]+256*this[++s]+this[++s];return(BigInt(_)<>>=0,i||checkOffset(s,4,this.length),w.read(this,s,!0,23,4)},Buffer.prototype.readFloatBE=function readFloatBE(s,i){return s>>>=0,i||checkOffset(s,4,this.length),w.read(this,s,!1,23,4)},Buffer.prototype.readDoubleLE=function readDoubleLE(s,i){return s>>>=0,i||checkOffset(s,8,this.length),w.read(this,s,!0,52,8)},Buffer.prototype.readDoubleBE=function readDoubleBE(s,i){return s>>>=0,i||checkOffset(s,8,this.length),w.read(this,s,!1,52,8)},Buffer.prototype.writeUintLE=Buffer.prototype.writeUIntLE=function writeUIntLE(s,i,u,_){if(s=+s,i>>>=0,u>>>=0,!_){checkInt(this,s,i,u,Math.pow(2,8*u)-1,0)}let w=1,x=0;for(this[i]=255&s;++x>>=0,u>>>=0,!_){checkInt(this,s,i,u,Math.pow(2,8*u)-1,0)}let w=u-1,x=1;for(this[i+w]=255&s;--w>=0&&(x*=256);)this[i+w]=s/x&255;return i+u},Buffer.prototype.writeUint8=Buffer.prototype.writeUInt8=function writeUInt8(s,i,u){return s=+s,i>>>=0,u||checkInt(this,s,i,1,255,0),this[i]=255&s,i+1},Buffer.prototype.writeUint16LE=Buffer.prototype.writeUInt16LE=function writeUInt16LE(s,i,u){return s=+s,i>>>=0,u||checkInt(this,s,i,2,65535,0),this[i]=255&s,this[i+1]=s>>>8,i+2},Buffer.prototype.writeUint16BE=Buffer.prototype.writeUInt16BE=function writeUInt16BE(s,i,u){return s=+s,i>>>=0,u||checkInt(this,s,i,2,65535,0),this[i]=s>>>8,this[i+1]=255&s,i+2},Buffer.prototype.writeUint32LE=Buffer.prototype.writeUInt32LE=function writeUInt32LE(s,i,u){return s=+s,i>>>=0,u||checkInt(this,s,i,4,4294967295,0),this[i+3]=s>>>24,this[i+2]=s>>>16,this[i+1]=s>>>8,this[i]=255&s,i+4},Buffer.prototype.writeUint32BE=Buffer.prototype.writeUInt32BE=function writeUInt32BE(s,i,u){return s=+s,i>>>=0,u||checkInt(this,s,i,4,4294967295,0),this[i]=s>>>24,this[i+1]=s>>>16,this[i+2]=s>>>8,this[i+3]=255&s,i+4},Buffer.prototype.writeBigUInt64LE=defineBigIntMethod((function writeBigUInt64LE(s,i=0){return wrtBigUInt64LE(this,s,i,BigInt(0),BigInt("0xffffffffffffffff"))})),Buffer.prototype.writeBigUInt64BE=defineBigIntMethod((function writeBigUInt64BE(s,i=0){return wrtBigUInt64BE(this,s,i,BigInt(0),BigInt("0xffffffffffffffff"))})),Buffer.prototype.writeIntLE=function writeIntLE(s,i,u,_){if(s=+s,i>>>=0,!_){const _=Math.pow(2,8*u-1);checkInt(this,s,i,u,_-1,-_)}let w=0,x=1,j=0;for(this[i]=255&s;++w>0)-j&255;return i+u},Buffer.prototype.writeIntBE=function writeIntBE(s,i,u,_){if(s=+s,i>>>=0,!_){const _=Math.pow(2,8*u-1);checkInt(this,s,i,u,_-1,-_)}let w=u-1,x=1,j=0;for(this[i+w]=255&s;--w>=0&&(x*=256);)s<0&&0===j&&0!==this[i+w+1]&&(j=1),this[i+w]=(s/x>>0)-j&255;return i+u},Buffer.prototype.writeInt8=function writeInt8(s,i,u){return s=+s,i>>>=0,u||checkInt(this,s,i,1,127,-128),s<0&&(s=255+s+1),this[i]=255&s,i+1},Buffer.prototype.writeInt16LE=function writeInt16LE(s,i,u){return s=+s,i>>>=0,u||checkInt(this,s,i,2,32767,-32768),this[i]=255&s,this[i+1]=s>>>8,i+2},Buffer.prototype.writeInt16BE=function writeInt16BE(s,i,u){return s=+s,i>>>=0,u||checkInt(this,s,i,2,32767,-32768),this[i]=s>>>8,this[i+1]=255&s,i+2},Buffer.prototype.writeInt32LE=function writeInt32LE(s,i,u){return s=+s,i>>>=0,u||checkInt(this,s,i,4,2147483647,-2147483648),this[i]=255&s,this[i+1]=s>>>8,this[i+2]=s>>>16,this[i+3]=s>>>24,i+4},Buffer.prototype.writeInt32BE=function writeInt32BE(s,i,u){return s=+s,i>>>=0,u||checkInt(this,s,i,4,2147483647,-2147483648),s<0&&(s=4294967295+s+1),this[i]=s>>>24,this[i+1]=s>>>16,this[i+2]=s>>>8,this[i+3]=255&s,i+4},Buffer.prototype.writeBigInt64LE=defineBigIntMethod((function writeBigInt64LE(s,i=0){return wrtBigUInt64LE(this,s,i,-BigInt("0x8000000000000000"),BigInt("0x7fffffffffffffff"))})),Buffer.prototype.writeBigInt64BE=defineBigIntMethod((function writeBigInt64BE(s,i=0){return wrtBigUInt64BE(this,s,i,-BigInt("0x8000000000000000"),BigInt("0x7fffffffffffffff"))})),Buffer.prototype.writeFloatLE=function writeFloatLE(s,i,u){return writeFloat(this,s,i,!0,u)},Buffer.prototype.writeFloatBE=function writeFloatBE(s,i,u){return writeFloat(this,s,i,!1,u)},Buffer.prototype.writeDoubleLE=function writeDoubleLE(s,i,u){return writeDouble(this,s,i,!0,u)},Buffer.prototype.writeDoubleBE=function writeDoubleBE(s,i,u){return writeDouble(this,s,i,!1,u)},Buffer.prototype.copy=function copy(s,i,u,_){if(!Buffer.isBuffer(s))throw new TypeError("argument should be a Buffer");if(u||(u=0),_||0===_||(_=this.length),i>=s.length&&(i=s.length),i||(i=0),_>0&&_=this.length)throw new RangeError("Index out of range");if(_<0)throw new RangeError("sourceEnd out of bounds");_>this.length&&(_=this.length),s.length-i<_-u&&(_=s.length-i+u);const w=_-u;return this===s&&"function"==typeof Uint8Array.prototype.copyWithin?this.copyWithin(i,u,_):Uint8Array.prototype.set.call(s,this.subarray(u,_),i),w},Buffer.prototype.fill=function fill(s,i,u,_){if("string"==typeof s){if("string"==typeof i?(_=i,i=0,u=this.length):"string"==typeof u&&(_=u,u=this.length),void 0!==_&&"string"!=typeof _)throw new TypeError("encoding must be a string");if("string"==typeof _&&!Buffer.isEncoding(_))throw new TypeError("Unknown encoding: "+_);if(1===s.length){const i=s.charCodeAt(0);("utf8"===_&&i<128||"latin1"===_)&&(s=i)}}else"number"==typeof s?s&=255:"boolean"==typeof s&&(s=Number(s));if(i<0||this.length>>=0,u=void 0===u?this.length:u>>>0,s||(s=0),"number"==typeof s)for(w=i;w=_+4;u-=3)i=`_${s.slice(u-3,u)}${i}`;return`${s.slice(0,u)}${i}`}function checkIntBI(s,i,u,_,w,x){if(s>u||s3?0===i||i===BigInt(0)?`>= 0${_} and < 2${_} ** ${8*(x+1)}${_}`:`>= -(2${_} ** ${8*(x+1)-1}${_}) and < 2 ** ${8*(x+1)-1}${_}`:`>= ${i}${_} and <= ${u}${_}`,new B.ERR_OUT_OF_RANGE("value",w,s)}!function checkBounds(s,i,u){validateNumber(i,"offset"),void 0!==s[i]&&void 0!==s[i+u]||boundsError(i,s.length-(u+1))}(_,w,x)}function validateNumber(s,i){if("number"!=typeof s)throw new B.ERR_INVALID_ARG_TYPE(i,"number",s)}function boundsError(s,i,u){if(Math.floor(s)!==s)throw validateNumber(s,u),new B.ERR_OUT_OF_RANGE(u||"offset","an integer",s);if(i<0)throw new B.ERR_BUFFER_OUT_OF_BOUNDS;throw new B.ERR_OUT_OF_RANGE(u||"offset",`>= ${u?1:0} and <= ${i}`,s)}E("ERR_BUFFER_OUT_OF_BOUNDS",(function(s){return s?`${s} is outside of buffer bounds`:"Attempt to access memory outside buffer bounds"}),RangeError),E("ERR_INVALID_ARG_TYPE",(function(s,i){return`The "${s}" argument must be of type number. Received type ${typeof i}`}),TypeError),E("ERR_OUT_OF_RANGE",(function(s,i,u){let _=`The value of "${s}" is out of range.`,w=u;return Number.isInteger(u)&&Math.abs(u)>2**32?w=addNumericalSeparator(String(u)):"bigint"==typeof u&&(w=String(u),(u>BigInt(2)**BigInt(32)||u<-(BigInt(2)**BigInt(32)))&&(w=addNumericalSeparator(w)),w+="n"),_+=` It must be ${i}. Received ${w}`,_}),RangeError);const $=/[^+/0-9A-Za-z-_]/g;function utf8ToBytes(s,i){let u;i=i||1/0;const _=s.length;let w=null;const x=[];for(let j=0;j<_;++j){if(u=s.charCodeAt(j),u>55295&&u<57344){if(!w){if(u>56319){(i-=3)>-1&&x.push(239,191,189);continue}if(j+1===_){(i-=3)>-1&&x.push(239,191,189);continue}w=u;continue}if(u<56320){(i-=3)>-1&&x.push(239,191,189),w=u;continue}u=65536+(w-55296<<10|u-56320)}else w&&(i-=3)>-1&&x.push(239,191,189);if(w=null,u<128){if((i-=1)<0)break;x.push(u)}else if(u<2048){if((i-=2)<0)break;x.push(u>>6|192,63&u|128)}else if(u<65536){if((i-=3)<0)break;x.push(u>>12|224,u>>6&63|128,63&u|128)}else{if(!(u<1114112))throw new Error("Invalid code point");if((i-=4)<0)break;x.push(u>>18|240,u>>12&63|128,u>>6&63|128,63&u|128)}}return x}function base64ToBytes(s){return _.toByteArray(function base64clean(s){if((s=(s=s.split("=")[0]).trim().replace($,"")).length<2)return"";for(;s.length%4!=0;)s+="=";return s}(s))}function blitBuffer(s,i,u,_){let w;for(w=0;w<_&&!(w+u>=i.length||w>=s.length);++w)i[w+u]=s[w];return w}function isInstance(s,i){return s instanceof i||null!=s&&null!=s.constructor&&null!=s.constructor.name&&s.constructor.name===i.name}function numberIsNaN(s){return s!=s}const U=function(){const s="0123456789abcdef",i=new Array(256);for(let u=0;u<16;++u){const _=16*u;for(let w=0;w<16;++w)i[_+w]=s[u]+s[w]}return i}();function defineBigIntMethod(s){return"undefined"==typeof BigInt?BufferBigIntNotDefined:s}function BufferBigIntNotDefined(){throw new Error("BigInt not supported")}},38075:(s,i,u)=>{"use strict";var _=u(70453),w=u(10487),x=w(_("String.prototype.indexOf"));s.exports=function callBoundIntrinsic(s,i){var u=_(s,!!i);return"function"==typeof u&&x(s,".prototype.")>-1?w(u):u}},10487:(s,i,u)=>{"use strict";var _=u(66743),w=u(70453),x=u(96897),j=u(69675),L=w("%Function.prototype.apply%"),B=w("%Function.prototype.call%"),$=w("%Reflect.apply%",!0)||_.call(B,L),U=u(30655),Y=w("%Math.max%");s.exports=function callBind(s){if("function"!=typeof s)throw new j("a function is required");var i=$(_,B,arguments);return x(i,1+Y(0,s.length-(arguments.length-1)),!0)};var Z=function applyBind(){return $(_,L,arguments)};U?U(s.exports,"apply",{value:Z}):s.exports.apply=Z},57427:(s,i)=>{"use strict";i.parse=function parse(s,i){if("string"!=typeof s)throw new TypeError("argument str must be a string");var u={},_=(i||{}).decode||decode,w=0;for(;w{"use strict";var _=u(16426),w={"text/plain":"Text","text/html":"Url",default:"Text"};s.exports=function copy(s,i){var u,x,j,L,B,$,U=!1;i||(i={}),u=i.debug||!1;try{if(j=_(),L=document.createRange(),B=document.getSelection(),($=document.createElement("span")).textContent=s,$.ariaHidden="true",$.style.all="unset",$.style.position="fixed",$.style.top=0,$.style.clip="rect(0, 0, 0, 0)",$.style.whiteSpace="pre",$.style.webkitUserSelect="text",$.style.MozUserSelect="text",$.style.msUserSelect="text",$.style.userSelect="text",$.addEventListener("copy",(function(_){if(_.stopPropagation(),i.format)if(_.preventDefault(),void 0===_.clipboardData){u&&console.warn("unable to use e.clipboardData"),u&&console.warn("trying IE specific stuff"),window.clipboardData.clearData();var x=w[i.format]||w.default;window.clipboardData.setData(x,s)}else _.clipboardData.clearData(),_.clipboardData.setData(i.format,s);i.onCopy&&(_.preventDefault(),i.onCopy(_.clipboardData))})),document.body.appendChild($),L.selectNodeContents($),B.addRange(L),!document.execCommand("copy"))throw new Error("copy command was unsuccessful");U=!0}catch(_){u&&console.error("unable to copy using execCommand: ",_),u&&console.warn("trying IE specific stuff");try{window.clipboardData.setData(i.format||"text",s),i.onCopy&&i.onCopy(window.clipboardData),U=!0}catch(_){u&&console.error("unable to copy using clipboardData: ",_),u&&console.error("falling back to prompt"),x=function format(s){var i=(/mac os x/i.test(navigator.userAgent)?"⌘":"Ctrl")+"+C";return s.replace(/#{\s*key\s*}/g,i)}("message"in i?i.message:"Copy to clipboard: #{key}, Enter"),window.prompt(x,s)}}finally{B&&("function"==typeof B.removeRange?B.removeRange(L):B.removeAllRanges()),$&&document.body.removeChild($),j()}return U}},2205:function(s,i,u){var _;_=void 0!==u.g?u.g:this,s.exports=function(s){if(s.CSS&&s.CSS.escape)return s.CSS.escape;var cssEscape=function(s){if(0==arguments.length)throw new TypeError("`CSS.escape` requires an argument.");for(var i,u=String(s),_=u.length,w=-1,x="",j=u.charCodeAt(0);++w<_;)0!=(i=u.charCodeAt(w))?x+=i>=1&&i<=31||127==i||0==w&&i>=48&&i<=57||1==w&&i>=48&&i<=57&&45==j?"\\"+i.toString(16)+" ":0==w&&1==_&&45==i||!(i>=128||45==i||95==i||i>=48&&i<=57||i>=65&&i<=90||i>=97&&i<=122)?"\\"+u.charAt(w):u.charAt(w):x+="�";return x};return s.CSS||(s.CSS={}),s.CSS.escape=cssEscape,cssEscape}(_)},81919:(s,i,u)=>{"use strict";var _=u(48287).Buffer;function isSpecificValue(s){return s instanceof _||s instanceof Date||s instanceof RegExp}function cloneSpecificValue(s){if(s instanceof _){var i=_.alloc?_.alloc(s.length):new _(s.length);return s.copy(i),i}if(s instanceof Date)return new Date(s.getTime());if(s instanceof RegExp)return new RegExp(s);throw new Error("Unexpected situation")}function deepCloneArray(s){var i=[];return s.forEach((function(s,u){"object"==typeof s&&null!==s?Array.isArray(s)?i[u]=deepCloneArray(s):isSpecificValue(s)?i[u]=cloneSpecificValue(s):i[u]=w({},s):i[u]=s})),i}function safeGetProperty(s,i){return"__proto__"===i?void 0:s[i]}var w=s.exports=function(){if(arguments.length<1||"object"!=typeof arguments[0])return!1;if(arguments.length<2)return arguments[0];var s,i,u=arguments[0];return Array.prototype.slice.call(arguments,1).forEach((function(_){"object"!=typeof _||null===_||Array.isArray(_)||Object.keys(_).forEach((function(x){return i=safeGetProperty(u,x),(s=safeGetProperty(_,x))===u?void 0:"object"!=typeof s||null===s?void(u[x]=s):Array.isArray(s)?void(u[x]=deepCloneArray(s)):isSpecificValue(s)?void(u[x]=cloneSpecificValue(s)):"object"!=typeof i||null===i||Array.isArray(i)?void(u[x]=w({},s)):void(u[x]=w(i,s))}))})),u}},14744:s=>{"use strict";var i=function isMergeableObject(s){return function isNonNullObject(s){return!!s&&"object"==typeof s}(s)&&!function isSpecial(s){var i=Object.prototype.toString.call(s);return"[object RegExp]"===i||"[object Date]"===i||function isReactElement(s){return s.$$typeof===u}(s)}(s)};var u="function"==typeof Symbol&&Symbol.for?Symbol.for("react.element"):60103;function cloneUnlessOtherwiseSpecified(s,i){return!1!==i.clone&&i.isMergeableObject(s)?deepmerge(function emptyTarget(s){return Array.isArray(s)?[]:{}}(s),s,i):s}function defaultArrayMerge(s,i,u){return s.concat(i).map((function(s){return cloneUnlessOtherwiseSpecified(s,u)}))}function getKeys(s){return Object.keys(s).concat(function getEnumerableOwnPropertySymbols(s){return Object.getOwnPropertySymbols?Object.getOwnPropertySymbols(s).filter((function(i){return Object.propertyIsEnumerable.call(s,i)})):[]}(s))}function propertyIsOnObject(s,i){try{return i in s}catch(s){return!1}}function mergeObject(s,i,u){var _={};return u.isMergeableObject(s)&&getKeys(s).forEach((function(i){_[i]=cloneUnlessOtherwiseSpecified(s[i],u)})),getKeys(i).forEach((function(w){(function propertyIsUnsafe(s,i){return propertyIsOnObject(s,i)&&!(Object.hasOwnProperty.call(s,i)&&Object.propertyIsEnumerable.call(s,i))})(s,w)||(propertyIsOnObject(s,w)&&u.isMergeableObject(i[w])?_[w]=function getMergeFunction(s,i){if(!i.customMerge)return deepmerge;var u=i.customMerge(s);return"function"==typeof u?u:deepmerge}(w,u)(s[w],i[w],u):_[w]=cloneUnlessOtherwiseSpecified(i[w],u))})),_}function deepmerge(s,u,_){(_=_||{}).arrayMerge=_.arrayMerge||defaultArrayMerge,_.isMergeableObject=_.isMergeableObject||i,_.cloneUnlessOtherwiseSpecified=cloneUnlessOtherwiseSpecified;var w=Array.isArray(u);return w===Array.isArray(s)?w?_.arrayMerge(s,u,_):mergeObject(s,u,_):cloneUnlessOtherwiseSpecified(u,_)}deepmerge.all=function deepmergeAll(s,i){if(!Array.isArray(s))throw new Error("first argument should be an array");return s.reduce((function(s,u){return deepmerge(s,u,i)}),{})};var _=deepmerge;s.exports=_},30041:(s,i,u)=>{"use strict";var _=u(30655),w=u(58068),x=u(69675),j=u(75795);s.exports=function defineDataProperty(s,i,u){if(!s||"object"!=typeof s&&"function"!=typeof s)throw new x("`obj` must be an object or a function`");if("string"!=typeof i&&"symbol"!=typeof i)throw new x("`property` must be a string or a symbol`");if(arguments.length>3&&"boolean"!=typeof arguments[3]&&null!==arguments[3])throw new x("`nonEnumerable`, if provided, must be a boolean or null");if(arguments.length>4&&"boolean"!=typeof arguments[4]&&null!==arguments[4])throw new x("`nonWritable`, if provided, must be a boolean or null");if(arguments.length>5&&"boolean"!=typeof arguments[5]&&null!==arguments[5])throw new x("`nonConfigurable`, if provided, must be a boolean or null");if(arguments.length>6&&"boolean"!=typeof arguments[6])throw new x("`loose`, if provided, must be a boolean");var L=arguments.length>3?arguments[3]:null,B=arguments.length>4?arguments[4]:null,$=arguments.length>5?arguments[5]:null,U=arguments.length>6&&arguments[6],Y=!!j&&j(s,i);if(_)_(s,i,{configurable:null===$&&Y?Y.configurable:!$,enumerable:null===L&&Y?Y.enumerable:!L,value:u,writable:null===B&&Y?Y.writable:!B});else{if(!U&&(L||B||$))throw new w("This environment does not support defining a property as non-configurable, non-writable, or non-enumerable.");s[i]=u}}},42838:function(s){s.exports=function(){"use strict";const{entries:s,setPrototypeOf:i,isFrozen:u,getPrototypeOf:_,getOwnPropertyDescriptor:w}=Object;let{freeze:x,seal:j,create:L}=Object,{apply:B,construct:$}="undefined"!=typeof Reflect&&Reflect;x||(x=function freeze(s){return s}),j||(j=function seal(s){return s}),B||(B=function apply(s,i,u){return s.apply(i,u)}),$||($=function construct(s,i){return new s(...i)});const U=unapply(Array.prototype.forEach),Y=unapply(Array.prototype.pop),Z=unapply(Array.prototype.push),ee=unapply(String.prototype.toLowerCase),ie=unapply(String.prototype.toString),ae=unapply(String.prototype.match),le=unapply(String.prototype.replace),ce=unapply(String.prototype.indexOf),pe=unapply(String.prototype.trim),de=unapply(Object.prototype.hasOwnProperty),fe=unapply(RegExp.prototype.test),ye=unconstruct(TypeError);function unapply(s){return function(i){for(var u=arguments.length,_=new Array(u>1?u-1:0),w=1;w2&&void 0!==arguments[2]?arguments[2]:ee;i&&i(s,null);let x=_.length;for(;x--;){let i=_[x];if("string"==typeof i){const s=w(i);s!==i&&(u(_)||(_[x]=s),i=s)}s[i]=!0}return s}function cleanArray(s){for(let i=0;i/gm),Ye=j(/\${[\w\W]*}/gm),Xe=j(/^data-[\-\w.\u00B7-\uFFFF]/),Qe=j(/^aria-[\-\w]+$/),et=j(/^(?:(?:(?:f|ht)tps?|mailto|tel|callto|sms|cid|xmpp):|[^a-z]|[a-z+.\-]+(?:[^a-z+.\-:]|$))/i),tt=j(/^(?:\w+script|data):/i),rt=j(/[\u0000-\u0020\u00A0\u1680\u180E\u2000-\u2029\u205F\u3000]/g),nt=j(/^html$/i),ot=j(/^[a-z][.\w]*(-[.\w]+)+$/i);var st=Object.freeze({__proto__:null,MUSTACHE_EXPR:We,ERB_EXPR:He,TMPLIT_EXPR:Ye,DATA_ATTR:Xe,ARIA_ATTR:Qe,IS_ALLOWED_URI:et,IS_SCRIPT_OR_DATA:tt,ATTR_WHITESPACE:rt,DOCTYPE_NAME:nt,CUSTOM_ELEMENT:ot});const it=function getGlobal(){return"undefined"==typeof window?null:window},at=function _createTrustedTypesPolicy(s,i){if("object"!=typeof s||"function"!=typeof s.createPolicy)return null;let u=null;const _="data-tt-policy-suffix";i&&i.hasAttribute(_)&&(u=i.getAttribute(_));const w="dompurify"+(u?"#"+u:"");try{return s.createPolicy(w,{createHTML:s=>s,createScriptURL:s=>s})}catch(s){return console.warn("TrustedTypes policy "+w+" could not be created."),null}};function createDOMPurify(){let i=arguments.length>0&&void 0!==arguments[0]?arguments[0]:it();const DOMPurify=s=>createDOMPurify(s);if(DOMPurify.version="3.1.2",DOMPurify.removed=[],!i||!i.document||9!==i.document.nodeType)return DOMPurify.isSupported=!1,DOMPurify;let{document:u}=i;const _=u,w=_.currentScript,{DocumentFragment:j,HTMLTemplateElement:B,Node:$,Element:We,NodeFilter:He,NamedNodeMap:Ye=i.NamedNodeMap||i.MozNamedAttrMap,HTMLFormElement:Xe,DOMParser:Qe,trustedTypes:tt}=i,rt=We.prototype,ot=lookupGetter(rt,"cloneNode"),lt=lookupGetter(rt,"nextSibling"),ct=lookupGetter(rt,"childNodes"),ut=lookupGetter(rt,"parentNode");if("function"==typeof B){const s=u.createElement("template");s.content&&s.content.ownerDocument&&(u=s.content.ownerDocument)}let pt,ht="";const{implementation:dt,createNodeIterator:mt,createDocumentFragment:gt,getElementsByTagName:yt}=u,{importNode:vt}=_;let bt={};DOMPurify.isSupported="function"==typeof s&&"function"==typeof ut&&dt&&void 0!==dt.createHTMLDocument;const{MUSTACHE_EXPR:_t,ERB_EXPR:Et,TMPLIT_EXPR:wt,DATA_ATTR:St,ARIA_ATTR:xt,IS_SCRIPT_OR_DATA:kt,ATTR_WHITESPACE:Ot,CUSTOM_ELEMENT:Ct}=st;let{IS_ALLOWED_URI:At}=st,jt=null;const Pt=addToSet({},[...be,..._e,...we,...xe,...Te]);let It=null;const Nt=addToSet({},[...Re,...qe,...$e,...ze]);let Mt=Object.seal(L(null,{tagNameCheck:{writable:!0,configurable:!1,enumerable:!0,value:null},attributeNameCheck:{writable:!0,configurable:!1,enumerable:!0,value:null},allowCustomizedBuiltInElements:{writable:!0,configurable:!1,enumerable:!0,value:!1}})),Tt=null,Rt=null,Dt=!0,Lt=!0,Bt=!1,Ft=!0,qt=!1,$t=!0,Vt=!1,Ut=!1,zt=!1,Wt=!1,Kt=!1,Ht=!1,Jt=!0,Gt=!1;const Yt="user-content-";let Xt=!0,Qt=!1,Zt={},er=null;const tr=addToSet({},["annotation-xml","audio","colgroup","desc","foreignobject","head","iframe","math","mi","mn","mo","ms","mtext","noembed","noframes","noscript","plaintext","script","style","svg","template","thead","title","video","xmp"]);let rr=null;const nr=addToSet({},["audio","video","img","source","image","track"]);let sr=null;const ir=addToSet({},["alt","class","for","id","label","name","pattern","placeholder","role","summary","title","value","style","xmlns"]),ar="http://www.w3.org/1998/Math/MathML",lr="http://www.w3.org/2000/svg",cr="http://www.w3.org/1999/xhtml";let ur=cr,pr=!1,dr=null;const fr=addToSet({},[ar,lr,cr],ie);let mr=null;const gr=["application/xhtml+xml","text/html"],yr="text/html";let vr=null,br=null;const _r=255,Er=u.createElement("form"),wr=function isRegexOrFunction(s){return s instanceof RegExp||s instanceof Function},Sr=function _parseConfig(){let s=arguments.length>0&&void 0!==arguments[0]?arguments[0]:{};if(!br||br!==s){if(s&&"object"==typeof s||(s={}),s=clone(s),mr=-1===gr.indexOf(s.PARSER_MEDIA_TYPE)?yr:s.PARSER_MEDIA_TYPE,vr="application/xhtml+xml"===mr?ie:ee,jt=de(s,"ALLOWED_TAGS")?addToSet({},s.ALLOWED_TAGS,vr):Pt,It=de(s,"ALLOWED_ATTR")?addToSet({},s.ALLOWED_ATTR,vr):Nt,dr=de(s,"ALLOWED_NAMESPACES")?addToSet({},s.ALLOWED_NAMESPACES,ie):fr,sr=de(s,"ADD_URI_SAFE_ATTR")?addToSet(clone(ir),s.ADD_URI_SAFE_ATTR,vr):ir,rr=de(s,"ADD_DATA_URI_TAGS")?addToSet(clone(nr),s.ADD_DATA_URI_TAGS,vr):nr,er=de(s,"FORBID_CONTENTS")?addToSet({},s.FORBID_CONTENTS,vr):tr,Tt=de(s,"FORBID_TAGS")?addToSet({},s.FORBID_TAGS,vr):{},Rt=de(s,"FORBID_ATTR")?addToSet({},s.FORBID_ATTR,vr):{},Zt=!!de(s,"USE_PROFILES")&&s.USE_PROFILES,Dt=!1!==s.ALLOW_ARIA_ATTR,Lt=!1!==s.ALLOW_DATA_ATTR,Bt=s.ALLOW_UNKNOWN_PROTOCOLS||!1,Ft=!1!==s.ALLOW_SELF_CLOSE_IN_ATTR,qt=s.SAFE_FOR_TEMPLATES||!1,$t=!1!==s.SAFE_FOR_XML,Vt=s.WHOLE_DOCUMENT||!1,Wt=s.RETURN_DOM||!1,Kt=s.RETURN_DOM_FRAGMENT||!1,Ht=s.RETURN_TRUSTED_TYPE||!1,zt=s.FORCE_BODY||!1,Jt=!1!==s.SANITIZE_DOM,Gt=s.SANITIZE_NAMED_PROPS||!1,Xt=!1!==s.KEEP_CONTENT,Qt=s.IN_PLACE||!1,At=s.ALLOWED_URI_REGEXP||et,ur=s.NAMESPACE||cr,Mt=s.CUSTOM_ELEMENT_HANDLING||{},s.CUSTOM_ELEMENT_HANDLING&&wr(s.CUSTOM_ELEMENT_HANDLING.tagNameCheck)&&(Mt.tagNameCheck=s.CUSTOM_ELEMENT_HANDLING.tagNameCheck),s.CUSTOM_ELEMENT_HANDLING&&wr(s.CUSTOM_ELEMENT_HANDLING.attributeNameCheck)&&(Mt.attributeNameCheck=s.CUSTOM_ELEMENT_HANDLING.attributeNameCheck),s.CUSTOM_ELEMENT_HANDLING&&"boolean"==typeof s.CUSTOM_ELEMENT_HANDLING.allowCustomizedBuiltInElements&&(Mt.allowCustomizedBuiltInElements=s.CUSTOM_ELEMENT_HANDLING.allowCustomizedBuiltInElements),qt&&(Lt=!1),Kt&&(Wt=!0),Zt&&(jt=addToSet({},Te),It=[],!0===Zt.html&&(addToSet(jt,be),addToSet(It,Re)),!0===Zt.svg&&(addToSet(jt,_e),addToSet(It,qe),addToSet(It,ze)),!0===Zt.svgFilters&&(addToSet(jt,we),addToSet(It,qe),addToSet(It,ze)),!0===Zt.mathMl&&(addToSet(jt,xe),addToSet(It,$e),addToSet(It,ze))),s.ADD_TAGS&&(jt===Pt&&(jt=clone(jt)),addToSet(jt,s.ADD_TAGS,vr)),s.ADD_ATTR&&(It===Nt&&(It=clone(It)),addToSet(It,s.ADD_ATTR,vr)),s.ADD_URI_SAFE_ATTR&&addToSet(sr,s.ADD_URI_SAFE_ATTR,vr),s.FORBID_CONTENTS&&(er===tr&&(er=clone(er)),addToSet(er,s.FORBID_CONTENTS,vr)),Xt&&(jt["#text"]=!0),Vt&&addToSet(jt,["html","head","body"]),jt.table&&(addToSet(jt,["tbody"]),delete Tt.tbody),s.TRUSTED_TYPES_POLICY){if("function"!=typeof s.TRUSTED_TYPES_POLICY.createHTML)throw ye('TRUSTED_TYPES_POLICY configuration option must provide a "createHTML" hook.');if("function"!=typeof s.TRUSTED_TYPES_POLICY.createScriptURL)throw ye('TRUSTED_TYPES_POLICY configuration option must provide a "createScriptURL" hook.');pt=s.TRUSTED_TYPES_POLICY,ht=pt.createHTML("")}else void 0===pt&&(pt=at(tt,w)),null!==pt&&"string"==typeof ht&&(ht=pt.createHTML(""));x&&x(s),br=s}},xr=addToSet({},["mi","mo","mn","ms","mtext"]),kr=addToSet({},["foreignobject","annotation-xml"]),Or=addToSet({},["title","style","font","a","script"]),Cr=addToSet({},[..._e,...we,...Se]),Ar=addToSet({},[...xe,...Pe]),jr=function _checkValidNamespace(s){let i=ut(s);i&&i.tagName||(i={namespaceURI:ur,tagName:"template"});const u=ee(s.tagName),_=ee(i.tagName);return!!dr[s.namespaceURI]&&(s.namespaceURI===lr?i.namespaceURI===cr?"svg"===u:i.namespaceURI===ar?"svg"===u&&("annotation-xml"===_||xr[_]):Boolean(Cr[u]):s.namespaceURI===ar?i.namespaceURI===cr?"math"===u:i.namespaceURI===lr?"math"===u&&kr[_]:Boolean(Ar[u]):s.namespaceURI===cr?!(i.namespaceURI===lr&&!kr[_])&&!(i.namespaceURI===ar&&!xr[_])&&!Ar[u]&&(Or[u]||!Cr[u]):!("application/xhtml+xml"!==mr||!dr[s.namespaceURI]))},Pr=function _forceRemove(s){Z(DOMPurify.removed,{element:s});try{s.parentNode.removeChild(s)}catch(i){s.remove()}},Ir=function _removeAttribute(s,i){try{Z(DOMPurify.removed,{attribute:i.getAttributeNode(s),from:i})}catch(s){Z(DOMPurify.removed,{attribute:null,from:i})}if(i.removeAttribute(s),"is"===s&&!It[s])if(Wt||Kt)try{Pr(i)}catch(s){}else try{i.setAttribute(s,"")}catch(s){}},Nr=function _initDocument(s){let i=null,_=null;if(zt)s=""+s;else{const i=ae(s,/^[\r\n\t ]+/);_=i&&i[0]}"application/xhtml+xml"===mr&&ur===cr&&(s=''+s+"");const w=pt?pt.createHTML(s):s;if(ur===cr)try{i=(new Qe).parseFromString(w,mr)}catch(s){}if(!i||!i.documentElement){i=dt.createDocument(ur,"template",null);try{i.documentElement.innerHTML=pr?ht:w}catch(s){}}const x=i.body||i.documentElement;return s&&_&&x.insertBefore(u.createTextNode(_),x.childNodes[0]||null),ur===cr?yt.call(i,Vt?"html":"body")[0]:Vt?i.documentElement:x},Mr=function _createNodeIterator(s){return mt.call(s.ownerDocument||s,s,He.SHOW_ELEMENT|He.SHOW_COMMENT|He.SHOW_TEXT|He.SHOW_PROCESSING_INSTRUCTION|He.SHOW_CDATA_SECTION,null)},Tr=function _isClobbered(s){return s instanceof Xe&&(void 0!==s.__depth&&"number"!=typeof s.__depth||void 0!==s.__removalCount&&"number"!=typeof s.__removalCount||"string"!=typeof s.nodeName||"string"!=typeof s.textContent||"function"!=typeof s.removeChild||!(s.attributes instanceof Ye)||"function"!=typeof s.removeAttribute||"function"!=typeof s.setAttribute||"string"!=typeof s.namespaceURI||"function"!=typeof s.insertBefore||"function"!=typeof s.hasChildNodes)},Rr=function _isNode(s){return"function"==typeof $&&s instanceof $},Dr=function _executeHook(s,i,u){bt[s]&&U(bt[s],(s=>{s.call(DOMPurify,i,u,br)}))},Lr=function _sanitizeElements(s){let i=null;if(Dr("beforeSanitizeElements",s,null),Tr(s))return Pr(s),!0;const u=vr(s.nodeName);if(Dr("uponSanitizeElement",s,{tagName:u,allowedTags:jt}),s.hasChildNodes()&&!Rr(s.firstElementChild)&&fe(/<[/\w]/g,s.innerHTML)&&fe(/<[/\w]/g,s.textContent))return Pr(s),!0;if(7===s.nodeType)return Pr(s),!0;if($t&&8===s.nodeType&&fe(/<[/\w]/g,s.data))return Pr(s),!0;if(!jt[u]||Tt[u]){if(!Tt[u]&&Fr(u)){if(Mt.tagNameCheck instanceof RegExp&&fe(Mt.tagNameCheck,u))return!1;if(Mt.tagNameCheck instanceof Function&&Mt.tagNameCheck(u))return!1}if(Xt&&!er[u]){const i=ut(s)||s.parentNode,u=ct(s)||s.childNodes;if(u&&i)for(let _=u.length-1;_>=0;--_){const w=ot(u[_],!0);w.__removalCount=(s.__removalCount||0)+1,i.insertBefore(w,lt(s))}}return Pr(s),!0}return s instanceof We&&!jr(s)?(Pr(s),!0):"noscript"!==u&&"noembed"!==u&&"noframes"!==u||!fe(/<\/no(script|embed|frames)/i,s.innerHTML)?(qt&&3===s.nodeType&&(i=s.textContent,U([_t,Et,wt],(s=>{i=le(i,s," ")})),s.textContent!==i&&(Z(DOMPurify.removed,{element:s.cloneNode()}),s.textContent=i)),Dr("afterSanitizeElements",s,null),!1):(Pr(s),!0)},Br=function _isValidAttribute(s,i,_){if(Jt&&("id"===i||"name"===i)&&(_ in u||_ in Er))return!1;if(Lt&&!Rt[i]&&fe(St,i));else if(Dt&&fe(xt,i));else if(!It[i]||Rt[i]){if(!(Fr(s)&&(Mt.tagNameCheck instanceof RegExp&&fe(Mt.tagNameCheck,s)||Mt.tagNameCheck instanceof Function&&Mt.tagNameCheck(s))&&(Mt.attributeNameCheck instanceof RegExp&&fe(Mt.attributeNameCheck,i)||Mt.attributeNameCheck instanceof Function&&Mt.attributeNameCheck(i))||"is"===i&&Mt.allowCustomizedBuiltInElements&&(Mt.tagNameCheck instanceof RegExp&&fe(Mt.tagNameCheck,_)||Mt.tagNameCheck instanceof Function&&Mt.tagNameCheck(_))))return!1}else if(sr[i]);else if(fe(At,le(_,Ot,"")));else if("src"!==i&&"xlink:href"!==i&&"href"!==i||"script"===s||0!==ce(_,"data:")||!rr[s])if(Bt&&!fe(kt,le(_,Ot,"")));else if(_)return!1;return!0},Fr=function _isBasicCustomElement(s){return"annotation-xml"!==s&&ae(s,Ct)},qr=function _sanitizeAttributes(s){Dr("beforeSanitizeAttributes",s,null);const{attributes:i}=s;if(!i)return;const u={attrName:"",attrValue:"",keepAttr:!0,allowedAttributes:It};let _=i.length;for(;_--;){const w=i[_],{name:x,namespaceURI:j,value:L}=w,B=vr(x);let $="value"===x?L:pe(L);if(u.attrName=B,u.attrValue=$,u.keepAttr=!0,u.forceKeepAttr=void 0,Dr("uponSanitizeAttribute",s,u),$=u.attrValue,u.forceKeepAttr)continue;if(Ir(x,s),!u.keepAttr)continue;if(!Ft&&fe(/\/>/i,$)){Ir(x,s);continue}qt&&U([_t,Et,wt],(s=>{$=le($,s," ")}));const Z=vr(s.nodeName);if(Br(Z,B,$)){if(!Gt||"id"!==B&&"name"!==B||(Ir(x,s),$=Yt+$),pt&&"object"==typeof tt&&"function"==typeof tt.getAttributeType)if(j);else switch(tt.getAttributeType(Z,B)){case"TrustedHTML":$=pt.createHTML($);break;case"TrustedScriptURL":$=pt.createScriptURL($)}try{j?s.setAttributeNS(j,x,$):s.setAttribute(x,$),Y(DOMPurify.removed)}catch(s){}}}Dr("afterSanitizeAttributes",s,null)},$r=function _sanitizeShadowDOM(s){let i=null;const u=Mr(s);for(Dr("beforeSanitizeShadowDOM",s,null);i=u.nextNode();){if(Dr("uponSanitizeShadowNode",i,null),Lr(i))continue;const s=ut(i);1===i.nodeType&&(s&&s.__depth?i.__depth=(i.__removalCount||0)+s.__depth+1:i.__depth=1),i.__depth>=_r&&Pr(i),i.content instanceof j&&(i.content.__depth=i.__depth,_sanitizeShadowDOM(i.content)),qr(i)}Dr("afterSanitizeShadowDOM",s,null)};return DOMPurify.sanitize=function(s){let i=arguments.length>1&&void 0!==arguments[1]?arguments[1]:{},u=null,w=null,x=null,L=null;if(pr=!s,pr&&(s="\x3c!--\x3e"),"string"!=typeof s&&!Rr(s)){if("function"!=typeof s.toString)throw ye("toString is not a function");if("string"!=typeof(s=s.toString()))throw ye("dirty is not a string, aborting")}if(!DOMPurify.isSupported)return s;if(Ut||Sr(i),DOMPurify.removed=[],"string"==typeof s&&(Qt=!1),Qt){if(s.nodeName){const i=vr(s.nodeName);if(!jt[i]||Tt[i])throw ye("root node is forbidden and cannot be sanitized in-place")}}else if(s instanceof $)u=Nr("\x3c!----\x3e"),w=u.ownerDocument.importNode(s,!0),1===w.nodeType&&"BODY"===w.nodeName||"HTML"===w.nodeName?u=w:u.appendChild(w);else{if(!Wt&&!qt&&!Vt&&-1===s.indexOf("<"))return pt&&Ht?pt.createHTML(s):s;if(u=Nr(s),!u)return Wt?null:Ht?ht:""}u&&zt&&Pr(u.firstChild);const B=Mr(Qt?s:u);for(;x=B.nextNode();){if(Lr(x))continue;const s=ut(x);1===x.nodeType&&(s&&s.__depth?x.__depth=(x.__removalCount||0)+s.__depth+1:x.__depth=1),x.__depth>=_r&&Pr(x),x.content instanceof j&&(x.content.__depth=x.__depth,$r(x.content)),qr(x)}if(Qt)return s;if(Wt){if(Kt)for(L=gt.call(u.ownerDocument);u.firstChild;)L.appendChild(u.firstChild);else L=u;return(It.shadowroot||It.shadowrootmode)&&(L=vt.call(_,L,!0)),L}let Y=Vt?u.outerHTML:u.innerHTML;return Vt&&jt["!doctype"]&&u.ownerDocument&&u.ownerDocument.doctype&&u.ownerDocument.doctype.name&&fe(nt,u.ownerDocument.doctype.name)&&(Y="\n"+Y),qt&&U([_t,Et,wt],(s=>{Y=le(Y,s," ")})),pt&&Ht?pt.createHTML(Y):Y},DOMPurify.setConfig=function(){Sr(arguments.length>0&&void 0!==arguments[0]?arguments[0]:{}),Ut=!0},DOMPurify.clearConfig=function(){br=null,Ut=!1},DOMPurify.isValidAttribute=function(s,i,u){br||Sr({});const _=vr(s),w=vr(i);return Br(_,w,u)},DOMPurify.addHook=function(s,i){"function"==typeof i&&(bt[s]=bt[s]||[],Z(bt[s],i))},DOMPurify.removeHook=function(s){if(bt[s])return Y(bt[s])},DOMPurify.removeHooks=function(s){bt[s]&&(bt[s]=[])},DOMPurify.removeAllHooks=function(){bt={}},DOMPurify}return createDOMPurify()}()},78004:s=>{"use strict";class SubRange{constructor(s,i){this.low=s,this.high=i,this.length=1+i-s}overlaps(s){return!(this.highs.high)}touches(s){return!(this.high+1s.high)}add(s){return new SubRange(Math.min(this.low,s.low),Math.max(this.high,s.high))}subtract(s){return s.low<=this.low&&s.high>=this.high?[]:s.low>this.low&&s.highs+i.length),0)}add(s,i){var _add=s=>{for(var i=0;i{for(var i=0;i{for(var i=0;i{for(var u=i.low;u<=i.high;)s.push(u),u++;return s}),[])}subranges(){return this.ranges.map((s=>({low:s.low,high:s.high,length:1+s.high-s.low})))}}s.exports=DRange},30655:(s,i,u)=>{"use strict";var _=u(70453)("%Object.defineProperty%",!0)||!1;if(_)try{_({},"a",{value:1})}catch(s){_=!1}s.exports=_},41237:s=>{"use strict";s.exports=EvalError},69383:s=>{"use strict";s.exports=Error},79290:s=>{"use strict";s.exports=RangeError},79538:s=>{"use strict";s.exports=ReferenceError},58068:s=>{"use strict";s.exports=SyntaxError},69675:s=>{"use strict";s.exports=TypeError},35345:s=>{"use strict";s.exports=URIError},37007:s=>{"use strict";var i,u="object"==typeof Reflect?Reflect:null,_=u&&"function"==typeof u.apply?u.apply:function ReflectApply(s,i,u){return Function.prototype.apply.call(s,i,u)};i=u&&"function"==typeof u.ownKeys?u.ownKeys:Object.getOwnPropertySymbols?function ReflectOwnKeys(s){return Object.getOwnPropertyNames(s).concat(Object.getOwnPropertySymbols(s))}:function ReflectOwnKeys(s){return Object.getOwnPropertyNames(s)};var w=Number.isNaN||function NumberIsNaN(s){return s!=s};function EventEmitter(){EventEmitter.init.call(this)}s.exports=EventEmitter,s.exports.once=function once(s,i){return new Promise((function(u,_){function errorListener(u){s.removeListener(i,resolver),_(u)}function resolver(){"function"==typeof s.removeListener&&s.removeListener("error",errorListener),u([].slice.call(arguments))}eventTargetAgnosticAddListener(s,i,resolver,{once:!0}),"error"!==i&&function addErrorHandlerIfEventEmitter(s,i,u){"function"==typeof s.on&&eventTargetAgnosticAddListener(s,"error",i,u)}(s,errorListener,{once:!0})}))},EventEmitter.EventEmitter=EventEmitter,EventEmitter.prototype._events=void 0,EventEmitter.prototype._eventsCount=0,EventEmitter.prototype._maxListeners=void 0;var x=10;function checkListener(s){if("function"!=typeof s)throw new TypeError('The "listener" argument must be of type Function. Received type '+typeof s)}function _getMaxListeners(s){return void 0===s._maxListeners?EventEmitter.defaultMaxListeners:s._maxListeners}function _addListener(s,i,u,_){var w,x,j;if(checkListener(u),void 0===(x=s._events)?(x=s._events=Object.create(null),s._eventsCount=0):(void 0!==x.newListener&&(s.emit("newListener",i,u.listener?u.listener:u),x=s._events),j=x[i]),void 0===j)j=x[i]=u,++s._eventsCount;else if("function"==typeof j?j=x[i]=_?[u,j]:[j,u]:_?j.unshift(u):j.push(u),(w=_getMaxListeners(s))>0&&j.length>w&&!j.warned){j.warned=!0;var L=new Error("Possible EventEmitter memory leak detected. "+j.length+" "+String(i)+" listeners added. Use emitter.setMaxListeners() to increase limit");L.name="MaxListenersExceededWarning",L.emitter=s,L.type=i,L.count=j.length,function ProcessEmitWarning(s){console&&console.warn&&console.warn(s)}(L)}return s}function onceWrapper(){if(!this.fired)return this.target.removeListener(this.type,this.wrapFn),this.fired=!0,0===arguments.length?this.listener.call(this.target):this.listener.apply(this.target,arguments)}function _onceWrap(s,i,u){var _={fired:!1,wrapFn:void 0,target:s,type:i,listener:u},w=onceWrapper.bind(_);return w.listener=u,_.wrapFn=w,w}function _listeners(s,i,u){var _=s._events;if(void 0===_)return[];var w=_[i];return void 0===w?[]:"function"==typeof w?u?[w.listener||w]:[w]:u?function unwrapListeners(s){for(var i=new Array(s.length),u=0;u0&&(j=i[0]),j instanceof Error)throw j;var L=new Error("Unhandled error."+(j?" ("+j.message+")":""));throw L.context=j,L}var B=x[s];if(void 0===B)return!1;if("function"==typeof B)_(B,this,i);else{var $=B.length,U=arrayClone(B,$);for(u=0;u<$;++u)_(U[u],this,i)}return!0},EventEmitter.prototype.addListener=function addListener(s,i){return _addListener(this,s,i,!1)},EventEmitter.prototype.on=EventEmitter.prototype.addListener,EventEmitter.prototype.prependListener=function prependListener(s,i){return _addListener(this,s,i,!0)},EventEmitter.prototype.once=function once(s,i){return checkListener(i),this.on(s,_onceWrap(this,s,i)),this},EventEmitter.prototype.prependOnceListener=function prependOnceListener(s,i){return checkListener(i),this.prependListener(s,_onceWrap(this,s,i)),this},EventEmitter.prototype.removeListener=function removeListener(s,i){var u,_,w,x,j;if(checkListener(i),void 0===(_=this._events))return this;if(void 0===(u=_[s]))return this;if(u===i||u.listener===i)0==--this._eventsCount?this._events=Object.create(null):(delete _[s],_.removeListener&&this.emit("removeListener",s,u.listener||i));else if("function"!=typeof u){for(w=-1,x=u.length-1;x>=0;x--)if(u[x]===i||u[x].listener===i){j=u[x].listener,w=x;break}if(w<0)return this;0===w?u.shift():function spliceOne(s,i){for(;i+1=0;_--)this.removeListener(s,i[_]);return this},EventEmitter.prototype.listeners=function listeners(s){return _listeners(this,s,!0)},EventEmitter.prototype.rawListeners=function rawListeners(s){return _listeners(this,s,!1)},EventEmitter.listenerCount=function(s,i){return"function"==typeof s.listenerCount?s.listenerCount(i):listenerCount.call(s,i)},EventEmitter.prototype.listenerCount=listenerCount,EventEmitter.prototype.eventNames=function eventNames(){return this._eventsCount>0?i(this._events):[]}},85587:(s,i,u)=>{"use strict";var _=u(26311),w=create(Error);function create(s){return FormattedError.displayName=s.displayName||s.name,FormattedError;function FormattedError(i){return i&&(i=_.apply(null,arguments)),new s(i)}}s.exports=w,w.eval=create(EvalError),w.range=create(RangeError),w.reference=create(ReferenceError),w.syntax=create(SyntaxError),w.type=create(TypeError),w.uri=create(URIError),w.create=create},26311:s=>{!function(){var i;function format(s){for(var i,u,_,w,x=1,j=[].slice.call(arguments),L=0,B=s.length,$="",U=!1,Y=!1,nextArg=function(){return j[x++]},slurpNumber=function(){for(var u="";/\d/.test(s[L]);)u+=s[L++],i=s[L];return u.length>0?parseInt(u):null};L{"use strict";var i=Object.prototype.toString,u=Math.max,_=function concatty(s,i){for(var u=[],_=0;_{"use strict";var _=u(89353);s.exports=Function.prototype.bind||_},70453:(s,i,u)=>{"use strict";var _,w=u(69383),x=u(41237),j=u(79290),L=u(79538),B=u(58068),$=u(69675),U=u(35345),Y=Function,getEvalledConstructor=function(s){try{return Y('"use strict"; return ('+s+").constructor;")()}catch(s){}},Z=Object.getOwnPropertyDescriptor;if(Z)try{Z({},"")}catch(s){Z=null}var throwTypeError=function(){throw new $},ee=Z?function(){try{return throwTypeError}catch(s){try{return Z(arguments,"callee").get}catch(s){return throwTypeError}}}():throwTypeError,ie=u(64039)(),ae=u(80024)(),le=Object.getPrototypeOf||(ae?function(s){return s.__proto__}:null),ce={},pe="undefined"!=typeof Uint8Array&&le?le(Uint8Array):_,de={__proto__:null,"%AggregateError%":"undefined"==typeof AggregateError?_:AggregateError,"%Array%":Array,"%ArrayBuffer%":"undefined"==typeof ArrayBuffer?_:ArrayBuffer,"%ArrayIteratorPrototype%":ie&&le?le([][Symbol.iterator]()):_,"%AsyncFromSyncIteratorPrototype%":_,"%AsyncFunction%":ce,"%AsyncGenerator%":ce,"%AsyncGeneratorFunction%":ce,"%AsyncIteratorPrototype%":ce,"%Atomics%":"undefined"==typeof Atomics?_:Atomics,"%BigInt%":"undefined"==typeof BigInt?_:BigInt,"%BigInt64Array%":"undefined"==typeof BigInt64Array?_:BigInt64Array,"%BigUint64Array%":"undefined"==typeof BigUint64Array?_:BigUint64Array,"%Boolean%":Boolean,"%DataView%":"undefined"==typeof DataView?_:DataView,"%Date%":Date,"%decodeURI%":decodeURI,"%decodeURIComponent%":decodeURIComponent,"%encodeURI%":encodeURI,"%encodeURIComponent%":encodeURIComponent,"%Error%":w,"%eval%":eval,"%EvalError%":x,"%Float32Array%":"undefined"==typeof Float32Array?_:Float32Array,"%Float64Array%":"undefined"==typeof Float64Array?_:Float64Array,"%FinalizationRegistry%":"undefined"==typeof FinalizationRegistry?_:FinalizationRegistry,"%Function%":Y,"%GeneratorFunction%":ce,"%Int8Array%":"undefined"==typeof Int8Array?_:Int8Array,"%Int16Array%":"undefined"==typeof Int16Array?_:Int16Array,"%Int32Array%":"undefined"==typeof Int32Array?_:Int32Array,"%isFinite%":isFinite,"%isNaN%":isNaN,"%IteratorPrototype%":ie&&le?le(le([][Symbol.iterator]())):_,"%JSON%":"object"==typeof JSON?JSON:_,"%Map%":"undefined"==typeof Map?_:Map,"%MapIteratorPrototype%":"undefined"!=typeof Map&&ie&&le?le((new Map)[Symbol.iterator]()):_,"%Math%":Math,"%Number%":Number,"%Object%":Object,"%parseFloat%":parseFloat,"%parseInt%":parseInt,"%Promise%":"undefined"==typeof Promise?_:Promise,"%Proxy%":"undefined"==typeof Proxy?_:Proxy,"%RangeError%":j,"%ReferenceError%":L,"%Reflect%":"undefined"==typeof Reflect?_:Reflect,"%RegExp%":RegExp,"%Set%":"undefined"==typeof Set?_:Set,"%SetIteratorPrototype%":"undefined"!=typeof Set&&ie&&le?le((new Set)[Symbol.iterator]()):_,"%SharedArrayBuffer%":"undefined"==typeof SharedArrayBuffer?_:SharedArrayBuffer,"%String%":String,"%StringIteratorPrototype%":ie&&le?le(""[Symbol.iterator]()):_,"%Symbol%":ie?Symbol:_,"%SyntaxError%":B,"%ThrowTypeError%":ee,"%TypedArray%":pe,"%TypeError%":$,"%Uint8Array%":"undefined"==typeof Uint8Array?_:Uint8Array,"%Uint8ClampedArray%":"undefined"==typeof Uint8ClampedArray?_:Uint8ClampedArray,"%Uint16Array%":"undefined"==typeof Uint16Array?_:Uint16Array,"%Uint32Array%":"undefined"==typeof Uint32Array?_:Uint32Array,"%URIError%":U,"%WeakMap%":"undefined"==typeof WeakMap?_:WeakMap,"%WeakRef%":"undefined"==typeof WeakRef?_:WeakRef,"%WeakSet%":"undefined"==typeof WeakSet?_:WeakSet};if(le)try{null.error}catch(s){var fe=le(le(s));de["%Error.prototype%"]=fe}var ye=function doEval(s){var i;if("%AsyncFunction%"===s)i=getEvalledConstructor("async function () {}");else if("%GeneratorFunction%"===s)i=getEvalledConstructor("function* () {}");else if("%AsyncGeneratorFunction%"===s)i=getEvalledConstructor("async function* () {}");else if("%AsyncGenerator%"===s){var u=doEval("%AsyncGeneratorFunction%");u&&(i=u.prototype)}else if("%AsyncIteratorPrototype%"===s){var _=doEval("%AsyncGenerator%");_&&le&&(i=le(_.prototype))}return de[s]=i,i},be={__proto__:null,"%ArrayBufferPrototype%":["ArrayBuffer","prototype"],"%ArrayPrototype%":["Array","prototype"],"%ArrayProto_entries%":["Array","prototype","entries"],"%ArrayProto_forEach%":["Array","prototype","forEach"],"%ArrayProto_keys%":["Array","prototype","keys"],"%ArrayProto_values%":["Array","prototype","values"],"%AsyncFunctionPrototype%":["AsyncFunction","prototype"],"%AsyncGenerator%":["AsyncGeneratorFunction","prototype"],"%AsyncGeneratorPrototype%":["AsyncGeneratorFunction","prototype","prototype"],"%BooleanPrototype%":["Boolean","prototype"],"%DataViewPrototype%":["DataView","prototype"],"%DatePrototype%":["Date","prototype"],"%ErrorPrototype%":["Error","prototype"],"%EvalErrorPrototype%":["EvalError","prototype"],"%Float32ArrayPrototype%":["Float32Array","prototype"],"%Float64ArrayPrototype%":["Float64Array","prototype"],"%FunctionPrototype%":["Function","prototype"],"%Generator%":["GeneratorFunction","prototype"],"%GeneratorPrototype%":["GeneratorFunction","prototype","prototype"],"%Int8ArrayPrototype%":["Int8Array","prototype"],"%Int16ArrayPrototype%":["Int16Array","prototype"],"%Int32ArrayPrototype%":["Int32Array","prototype"],"%JSONParse%":["JSON","parse"],"%JSONStringify%":["JSON","stringify"],"%MapPrototype%":["Map","prototype"],"%NumberPrototype%":["Number","prototype"],"%ObjectPrototype%":["Object","prototype"],"%ObjProto_toString%":["Object","prototype","toString"],"%ObjProto_valueOf%":["Object","prototype","valueOf"],"%PromisePrototype%":["Promise","prototype"],"%PromiseProto_then%":["Promise","prototype","then"],"%Promise_all%":["Promise","all"],"%Promise_reject%":["Promise","reject"],"%Promise_resolve%":["Promise","resolve"],"%RangeErrorPrototype%":["RangeError","prototype"],"%ReferenceErrorPrototype%":["ReferenceError","prototype"],"%RegExpPrototype%":["RegExp","prototype"],"%SetPrototype%":["Set","prototype"],"%SharedArrayBufferPrototype%":["SharedArrayBuffer","prototype"],"%StringPrototype%":["String","prototype"],"%SymbolPrototype%":["Symbol","prototype"],"%SyntaxErrorPrototype%":["SyntaxError","prototype"],"%TypedArrayPrototype%":["TypedArray","prototype"],"%TypeErrorPrototype%":["TypeError","prototype"],"%Uint8ArrayPrototype%":["Uint8Array","prototype"],"%Uint8ClampedArrayPrototype%":["Uint8ClampedArray","prototype"],"%Uint16ArrayPrototype%":["Uint16Array","prototype"],"%Uint32ArrayPrototype%":["Uint32Array","prototype"],"%URIErrorPrototype%":["URIError","prototype"],"%WeakMapPrototype%":["WeakMap","prototype"],"%WeakSetPrototype%":["WeakSet","prototype"]},_e=u(66743),we=u(9957),Se=_e.call(Function.call,Array.prototype.concat),xe=_e.call(Function.apply,Array.prototype.splice),Pe=_e.call(Function.call,String.prototype.replace),Te=_e.call(Function.call,String.prototype.slice),Re=_e.call(Function.call,RegExp.prototype.exec),qe=/[^%.[\]]+|\[(?:(-?\d+(?:\.\d+)?)|(["'])((?:(?!\2)[^\\]|\\.)*?)\2)\]|(?=(?:\.|\[\])(?:\.|\[\]|%$))/g,$e=/\\(\\)?/g,ze=function getBaseIntrinsic(s,i){var u,_=s;if(we(be,_)&&(_="%"+(u=be[_])[0]+"%"),we(de,_)){var w=de[_];if(w===ce&&(w=ye(_)),void 0===w&&!i)throw new $("intrinsic "+s+" exists, but is not available. Please file an issue!");return{alias:u,name:_,value:w}}throw new B("intrinsic "+s+" does not exist!")};s.exports=function GetIntrinsic(s,i){if("string"!=typeof s||0===s.length)throw new $("intrinsic name must be a non-empty string");if(arguments.length>1&&"boolean"!=typeof i)throw new $('"allowMissing" argument must be a boolean');if(null===Re(/^%?[^%]*%?$/,s))throw new B("`%` may not be present anywhere but at the beginning and end of the intrinsic name");var u=function stringToPath(s){var i=Te(s,0,1),u=Te(s,-1);if("%"===i&&"%"!==u)throw new B("invalid intrinsic syntax, expected closing `%`");if("%"===u&&"%"!==i)throw new B("invalid intrinsic syntax, expected opening `%`");var _=[];return Pe(s,qe,(function(s,i,u,w){_[_.length]=u?Pe(w,$e,"$1"):i||s})),_}(s),_=u.length>0?u[0]:"",w=ze("%"+_+"%",i),x=w.name,j=w.value,L=!1,U=w.alias;U&&(_=U[0],xe(u,Se([0,1],U)));for(var Y=1,ee=!0;Y=u.length){var ce=Z(j,ie);j=(ee=!!ce)&&"get"in ce&&!("originalValue"in ce.get)?ce.get:j[ie]}else ee=we(j,ie),j=j[ie];ee&&!L&&(de[x]=j)}}return j}},75795:(s,i,u)=>{"use strict";var _=u(70453)("%Object.getOwnPropertyDescriptor%",!0);if(_)try{_([],"length")}catch(s){_=null}s.exports=_},30592:(s,i,u)=>{"use strict";var _=u(30655),w=function hasPropertyDescriptors(){return!!_};w.hasArrayLengthDefineBug=function hasArrayLengthDefineBug(){if(!_)return null;try{return 1!==_([],"length",{value:1}).length}catch(s){return!0}},s.exports=w},80024:s=>{"use strict";var i={__proto__:null,foo:{}},u=Object;s.exports=function hasProto(){return{__proto__:i}.foo===i.foo&&!(i instanceof u)}},64039:(s,i,u)=>{"use strict";var _="undefined"!=typeof Symbol&&Symbol,w=u(41333);s.exports=function hasNativeSymbols(){return"function"==typeof _&&("function"==typeof Symbol&&("symbol"==typeof _("foo")&&("symbol"==typeof Symbol("bar")&&w())))}},41333:s=>{"use strict";s.exports=function hasSymbols(){if("function"!=typeof Symbol||"function"!=typeof Object.getOwnPropertySymbols)return!1;if("symbol"==typeof Symbol.iterator)return!0;var s={},i=Symbol("test"),u=Object(i);if("string"==typeof i)return!1;if("[object Symbol]"!==Object.prototype.toString.call(i))return!1;if("[object Symbol]"!==Object.prototype.toString.call(u))return!1;for(i in s[i]=42,s)return!1;if("function"==typeof Object.keys&&0!==Object.keys(s).length)return!1;if("function"==typeof Object.getOwnPropertyNames&&0!==Object.getOwnPropertyNames(s).length)return!1;var _=Object.getOwnPropertySymbols(s);if(1!==_.length||_[0]!==i)return!1;if(!Object.prototype.propertyIsEnumerable.call(s,i))return!1;if("function"==typeof Object.getOwnPropertyDescriptor){var w=Object.getOwnPropertyDescriptor(s,i);if(42!==w.value||!0!==w.enumerable)return!1}return!0}},9957:(s,i,u)=>{"use strict";var _=Function.prototype.call,w=Object.prototype.hasOwnProperty,x=u(66743);s.exports=x.call(_,w)},45981:s=>{function deepFreeze(s){return s instanceof Map?s.clear=s.delete=s.set=function(){throw new Error("map is read-only")}:s instanceof Set&&(s.add=s.clear=s.delete=function(){throw new Error("set is read-only")}),Object.freeze(s),Object.getOwnPropertyNames(s).forEach((function(i){var u=s[i];"object"!=typeof u||Object.isFrozen(u)||deepFreeze(u)})),s}var i=deepFreeze,u=deepFreeze;i.default=u;class Response{constructor(s){void 0===s.data&&(s.data={}),this.data=s.data,this.isMatchIgnored=!1}ignoreMatch(){this.isMatchIgnored=!0}}function escapeHTML(s){return s.replace(/&/g,"&").replace(//g,">").replace(/"/g,""").replace(/'/g,"'")}function inherit(s,...i){const u=Object.create(null);for(const i in s)u[i]=s[i];return i.forEach((function(s){for(const i in s)u[i]=s[i]})),u}const emitsWrappingTags=s=>!!s.kind;class HTMLRenderer{constructor(s,i){this.buffer="",this.classPrefix=i.classPrefix,s.walk(this)}addText(s){this.buffer+=escapeHTML(s)}openNode(s){if(!emitsWrappingTags(s))return;let i=s.kind;s.sublanguage||(i=`${this.classPrefix}${i}`),this.span(i)}closeNode(s){emitsWrappingTags(s)&&(this.buffer+="")}value(){return this.buffer}span(s){this.buffer+=``}}class TokenTree{constructor(){this.rootNode={children:[]},this.stack=[this.rootNode]}get top(){return this.stack[this.stack.length-1]}get root(){return this.rootNode}add(s){this.top.children.push(s)}openNode(s){const i={kind:s,children:[]};this.add(i),this.stack.push(i)}closeNode(){if(this.stack.length>1)return this.stack.pop()}closeAllNodes(){for(;this.closeNode(););}toJSON(){return JSON.stringify(this.rootNode,null,4)}walk(s){return this.constructor._walk(s,this.rootNode)}static _walk(s,i){return"string"==typeof i?s.addText(i):i.children&&(s.openNode(i),i.children.forEach((i=>this._walk(s,i))),s.closeNode(i)),s}static _collapse(s){"string"!=typeof s&&s.children&&(s.children.every((s=>"string"==typeof s))?s.children=[s.children.join("")]:s.children.forEach((s=>{TokenTree._collapse(s)})))}}class TokenTreeEmitter extends TokenTree{constructor(s){super(),this.options=s}addKeyword(s,i){""!==s&&(this.openNode(i),this.addText(s),this.closeNode())}addText(s){""!==s&&this.add(s)}addSublanguage(s,i){const u=s.root;u.kind=i,u.sublanguage=!0,this.add(u)}toHTML(){return new HTMLRenderer(this,this.options).value()}finalize(){return!0}}function source(s){return s?"string"==typeof s?s:s.source:null}const _=/\[(?:[^\\\]]|\\.)*\]|\(\??|\\([1-9][0-9]*)|\\./;const w="[a-zA-Z]\\w*",x="[a-zA-Z_]\\w*",j="\\b\\d+(\\.\\d+)?",L="(-?)(\\b0[xX][a-fA-F0-9]+|(\\b\\d+(\\.\\d*)?|\\.\\d+)([eE][-+]?\\d+)?)",B="\\b(0b[01]+)",$={begin:"\\\\[\\s\\S]",relevance:0},U={className:"string",begin:"'",end:"'",illegal:"\\n",contains:[$]},Y={className:"string",begin:'"',end:'"',illegal:"\\n",contains:[$]},Z={begin:/\b(a|an|the|are|I'm|isn't|don't|doesn't|won't|but|just|should|pretty|simply|enough|gonna|going|wtf|so|such|will|you|your|they|like|more)\b/},COMMENT=function(s,i,u={}){const _=inherit({className:"comment",begin:s,end:i,contains:[]},u);return _.contains.push(Z),_.contains.push({className:"doctag",begin:"(?:TODO|FIXME|NOTE|BUG|OPTIMIZE|HACK|XXX):",relevance:0}),_},ee=COMMENT("//","$"),ie=COMMENT("/\\*","\\*/"),ae=COMMENT("#","$"),le={className:"number",begin:j,relevance:0},ce={className:"number",begin:L,relevance:0},pe={className:"number",begin:B,relevance:0},de={className:"number",begin:j+"(%|em|ex|ch|rem|vw|vh|vmin|vmax|cm|mm|in|pt|pc|px|deg|grad|rad|turn|s|ms|Hz|kHz|dpi|dpcm|dppx)?",relevance:0},fe={begin:/(?=\/[^/\n]*\/)/,contains:[{className:"regexp",begin:/\//,end:/\/[gimuy]*/,illegal:/\n/,contains:[$,{begin:/\[/,end:/\]/,relevance:0,contains:[$]}]}]},ye={className:"title",begin:w,relevance:0},be={className:"title",begin:x,relevance:0},_e={begin:"\\.\\s*"+x,relevance:0};var we=Object.freeze({__proto__:null,MATCH_NOTHING_RE:/\b\B/,IDENT_RE:w,UNDERSCORE_IDENT_RE:x,NUMBER_RE:j,C_NUMBER_RE:L,BINARY_NUMBER_RE:B,RE_STARTERS_RE:"!|!=|!==|%|%=|&|&&|&=|\\*|\\*=|\\+|\\+=|,|-|-=|/=|/|:|;|<<|<<=|<=|<|===|==|=|>>>=|>>=|>=|>>>|>>|>|\\?|\\[|\\{|\\(|\\^|\\^=|\\||\\|=|\\|\\||~",SHEBANG:(s={})=>{const i=/^#![ ]*\//;return s.binary&&(s.begin=function concat(...s){return s.map((s=>source(s))).join("")}(i,/.*\b/,s.binary,/\b.*/)),inherit({className:"meta",begin:i,end:/$/,relevance:0,"on:begin":(s,i)=>{0!==s.index&&i.ignoreMatch()}},s)},BACKSLASH_ESCAPE:$,APOS_STRING_MODE:U,QUOTE_STRING_MODE:Y,PHRASAL_WORDS_MODE:Z,COMMENT,C_LINE_COMMENT_MODE:ee,C_BLOCK_COMMENT_MODE:ie,HASH_COMMENT_MODE:ae,NUMBER_MODE:le,C_NUMBER_MODE:ce,BINARY_NUMBER_MODE:pe,CSS_NUMBER_MODE:de,REGEXP_MODE:fe,TITLE_MODE:ye,UNDERSCORE_TITLE_MODE:be,METHOD_GUARD:_e,END_SAME_AS_BEGIN:function(s){return Object.assign(s,{"on:begin":(s,i)=>{i.data._beginMatch=s[1]},"on:end":(s,i)=>{i.data._beginMatch!==s[1]&&i.ignoreMatch()}})}});function skipIfhasPrecedingDot(s,i){"."===s.input[s.index-1]&&i.ignoreMatch()}function beginKeywords(s,i){i&&s.beginKeywords&&(s.begin="\\b("+s.beginKeywords.split(" ").join("|")+")(?!\\.)(?=\\b|\\s)",s.__beforeBegin=skipIfhasPrecedingDot,s.keywords=s.keywords||s.beginKeywords,delete s.beginKeywords,void 0===s.relevance&&(s.relevance=0))}function compileIllegal(s,i){Array.isArray(s.illegal)&&(s.illegal=function either(...s){return"("+s.map((s=>source(s))).join("|")+")"}(...s.illegal))}function compileMatch(s,i){if(s.match){if(s.begin||s.end)throw new Error("begin & end are not supported with match");s.begin=s.match,delete s.match}}function compileRelevance(s,i){void 0===s.relevance&&(s.relevance=1)}const Se=["of","and","for","in","not","or","if","then","parent","list","value"],xe="keyword";function compileKeywords(s,i,u=xe){const _={};return"string"==typeof s?compileList(u,s.split(" ")):Array.isArray(s)?compileList(u,s):Object.keys(s).forEach((function(u){Object.assign(_,compileKeywords(s[u],i,u))})),_;function compileList(s,u){i&&(u=u.map((s=>s.toLowerCase()))),u.forEach((function(i){const u=i.split("|");_[u[0]]=[s,scoreForKeyword(u[0],u[1])]}))}}function scoreForKeyword(s,i){return i?Number(i):function commonKeyword(s){return Se.includes(s.toLowerCase())}(s)?0:1}function compileLanguage(s,{plugins:i}){function langRe(i,u){return new RegExp(source(i),"m"+(s.case_insensitive?"i":"")+(u?"g":""))}class MultiRegex{constructor(){this.matchIndexes={},this.regexes=[],this.matchAt=1,this.position=0}addRule(s,i){i.position=this.position++,this.matchIndexes[this.matchAt]=i,this.regexes.push([i,s]),this.matchAt+=function countMatchGroups(s){return new RegExp(s.toString()+"|").exec("").length-1}(s)+1}compile(){0===this.regexes.length&&(this.exec=()=>null);const s=this.regexes.map((s=>s[1]));this.matcherRe=langRe(function join(s,i="|"){let u=0;return s.map((s=>{u+=1;const i=u;let w=source(s),x="";for(;w.length>0;){const s=_.exec(w);if(!s){x+=w;break}x+=w.substring(0,s.index),w=w.substring(s.index+s[0].length),"\\"===s[0][0]&&s[1]?x+="\\"+String(Number(s[1])+i):(x+=s[0],"("===s[0]&&u++)}return x})).map((s=>`(${s})`)).join(i)}(s),!0),this.lastIndex=0}exec(s){this.matcherRe.lastIndex=this.lastIndex;const i=this.matcherRe.exec(s);if(!i)return null;const u=i.findIndex(((s,i)=>i>0&&void 0!==s)),_=this.matchIndexes[u];return i.splice(0,u),Object.assign(i,_)}}class ResumableMultiRegex{constructor(){this.rules=[],this.multiRegexes=[],this.count=0,this.lastIndex=0,this.regexIndex=0}getMatcher(s){if(this.multiRegexes[s])return this.multiRegexes[s];const i=new MultiRegex;return this.rules.slice(s).forEach((([s,u])=>i.addRule(s,u))),i.compile(),this.multiRegexes[s]=i,i}resumingScanAtSamePosition(){return 0!==this.regexIndex}considerAll(){this.regexIndex=0}addRule(s,i){this.rules.push([s,i]),"begin"===i.type&&this.count++}exec(s){const i=this.getMatcher(this.regexIndex);i.lastIndex=this.lastIndex;let u=i.exec(s);if(this.resumingScanAtSamePosition())if(u&&u.index===this.lastIndex);else{const i=this.getMatcher(0);i.lastIndex=this.lastIndex+1,u=i.exec(s)}return u&&(this.regexIndex+=u.position+1,this.regexIndex===this.count&&this.considerAll()),u}}if(s.compilerExtensions||(s.compilerExtensions=[]),s.contains&&s.contains.includes("self"))throw new Error("ERR: contains `self` is not supported at the top-level of a language. See documentation.");return s.classNameAliases=inherit(s.classNameAliases||{}),function compileMode(i,u){const _=i;if(i.isCompiled)return _;[compileMatch].forEach((s=>s(i,u))),s.compilerExtensions.forEach((s=>s(i,u))),i.__beforeBegin=null,[beginKeywords,compileIllegal,compileRelevance].forEach((s=>s(i,u))),i.isCompiled=!0;let w=null;if("object"==typeof i.keywords&&(w=i.keywords.$pattern,delete i.keywords.$pattern),i.keywords&&(i.keywords=compileKeywords(i.keywords,s.case_insensitive)),i.lexemes&&w)throw new Error("ERR: Prefer `keywords.$pattern` to `mode.lexemes`, BOTH are not allowed. (see mode reference) ");return w=w||i.lexemes||/\w+/,_.keywordPatternRe=langRe(w,!0),u&&(i.begin||(i.begin=/\B|\b/),_.beginRe=langRe(i.begin),i.endSameAsBegin&&(i.end=i.begin),i.end||i.endsWithParent||(i.end=/\B|\b/),i.end&&(_.endRe=langRe(i.end)),_.terminatorEnd=source(i.end)||"",i.endsWithParent&&u.terminatorEnd&&(_.terminatorEnd+=(i.end?"|":"")+u.terminatorEnd)),i.illegal&&(_.illegalRe=langRe(i.illegal)),i.contains||(i.contains=[]),i.contains=[].concat(...i.contains.map((function(s){return function expandOrCloneMode(s){s.variants&&!s.cachedVariants&&(s.cachedVariants=s.variants.map((function(i){return inherit(s,{variants:null},i)})));if(s.cachedVariants)return s.cachedVariants;if(dependencyOnParent(s))return inherit(s,{starts:s.starts?inherit(s.starts):null});if(Object.isFrozen(s))return inherit(s);return s}("self"===s?i:s)}))),i.contains.forEach((function(s){compileMode(s,_)})),i.starts&&compileMode(i.starts,u),_.matcher=function buildModeRegex(s){const i=new ResumableMultiRegex;return s.contains.forEach((s=>i.addRule(s.begin,{rule:s,type:"begin"}))),s.terminatorEnd&&i.addRule(s.terminatorEnd,{type:"end"}),s.illegal&&i.addRule(s.illegal,{type:"illegal"}),i}(_),_}(s)}function dependencyOnParent(s){return!!s&&(s.endsWithParent||dependencyOnParent(s.starts))}function BuildVuePlugin(s){const i={props:["language","code","autodetect"],data:function(){return{detectedLanguage:"",unknownLanguage:!1}},computed:{className(){return this.unknownLanguage?"":"hljs "+this.detectedLanguage},highlighted(){if(!this.autoDetect&&!s.getLanguage(this.language))return console.warn(`The language "${this.language}" you specified could not be found.`),this.unknownLanguage=!0,escapeHTML(this.code);let i={};return this.autoDetect?(i=s.highlightAuto(this.code),this.detectedLanguage=i.language):(i=s.highlight(this.language,this.code,this.ignoreIllegals),this.detectedLanguage=this.language),i.value},autoDetect(){return!this.language||function hasValueOrEmptyAttribute(s){return Boolean(s||""===s)}(this.autodetect)},ignoreIllegals:()=>!0},render(s){return s("pre",{},[s("code",{class:this.className,domProps:{innerHTML:this.highlighted}})])}};return{Component:i,VuePlugin:{install(s){s.component("highlightjs",i)}}}}const Pe={"after:highlightElement":({el:s,result:i,text:u})=>{const _=nodeStream(s);if(!_.length)return;const w=document.createElement("div");w.innerHTML=i.value,i.value=function mergeStreams(s,i,u){let _=0,w="";const x=[];function selectStream(){return s.length&&i.length?s[0].offset!==i[0].offset?s[0].offset"}function close(s){w+=""}function render(s){("start"===s.event?open:close)(s.node)}for(;s.length||i.length;){let i=selectStream();if(w+=escapeHTML(u.substring(_,i[0].offset)),_=i[0].offset,i===s){x.reverse().forEach(close);do{render(i.splice(0,1)[0]),i=selectStream()}while(i===s&&i.length&&i[0].offset===_);x.reverse().forEach(open)}else"start"===i[0].event?x.push(i[0].node):x.pop(),render(i.splice(0,1)[0])}return w+escapeHTML(u.substr(_))}(_,nodeStream(w),u)}};function tag(s){return s.nodeName.toLowerCase()}function nodeStream(s){const i=[];return function _nodeStream(s,u){for(let _=s.firstChild;_;_=_.nextSibling)3===_.nodeType?u+=_.nodeValue.length:1===_.nodeType&&(i.push({event:"start",offset:u,node:_}),u=_nodeStream(_,u),tag(_).match(/br|hr|img|input/)||i.push({event:"stop",offset:u,node:_}));return u}(s,0),i}const Te={},error=s=>{console.error(s)},warn=(s,...i)=>{console.log(`WARN: ${s}`,...i)},deprecated=(s,i)=>{Te[`${s}/${i}`]||(console.log(`Deprecated as of ${s}. ${i}`),Te[`${s}/${i}`]=!0)},Re=escapeHTML,qe=inherit,$e=Symbol("nomatch");var ze=function(s){const u=Object.create(null),_=Object.create(null),w=[];let x=!0;const j=/(^(<[^>]+>|\t|)+|\n)/gm,L="Could not find the language '{}', did you forget to load/include a language module?",B={disableAutodetect:!0,name:"Plain text",contains:[]};let $={noHighlightRe:/^(no-?highlight)$/i,languageDetectRe:/\blang(?:uage)?-([\w-]+)\b/i,classPrefix:"hljs-",tabReplace:null,useBR:!1,languages:null,__emitter:TokenTreeEmitter};function shouldNotHighlight(s){return $.noHighlightRe.test(s)}function highlight(s,i,u,_){let w="",x="";"object"==typeof i?(w=s,u=i.ignoreIllegals,x=i.language,_=void 0):(deprecated("10.7.0","highlight(lang, code, ...args) has been deprecated."),deprecated("10.7.0","Please use highlight(code, options) instead.\nhttps://github.com/highlightjs/highlight.js/issues/2277"),x=s,w=i);const j={code:w,language:x};fire("before:highlight",j);const L=j.result?j.result:_highlight(j.language,j.code,u,_);return L.code=j.code,fire("after:highlight",L),L}function _highlight(s,i,_,j){function keywordData(s,i){const u=U.case_insensitive?i[0].toLowerCase():i[0];return Object.prototype.hasOwnProperty.call(s.keywords,u)&&s.keywords[u]}function processBuffer(){null!=ee.subLanguage?function processSubLanguage(){if(""===le)return;let s=null;if("string"==typeof ee.subLanguage){if(!u[ee.subLanguage])return void ae.addText(le);s=_highlight(ee.subLanguage,le,!0,ie[ee.subLanguage]),ie[ee.subLanguage]=s.top}else s=highlightAuto(le,ee.subLanguage.length?ee.subLanguage:null);ee.relevance>0&&(ce+=s.relevance),ae.addSublanguage(s.emitter,s.language)}():function processKeywords(){if(!ee.keywords)return void ae.addText(le);let s=0;ee.keywordPatternRe.lastIndex=0;let i=ee.keywordPatternRe.exec(le),u="";for(;i;){u+=le.substring(s,i.index);const _=keywordData(ee,i);if(_){const[s,w]=_;if(ae.addText(u),u="",ce+=w,s.startsWith("_"))u+=i[0];else{const u=U.classNameAliases[s]||s;ae.addKeyword(i[0],u)}}else u+=i[0];s=ee.keywordPatternRe.lastIndex,i=ee.keywordPatternRe.exec(le)}u+=le.substr(s),ae.addText(u)}(),le=""}function startNewMode(s){return s.className&&ae.openNode(U.classNameAliases[s.className]||s.className),ee=Object.create(s,{parent:{value:ee}}),ee}function endOfMode(s,i,u){let _=function startsWith(s,i){const u=s&&s.exec(i);return u&&0===u.index}(s.endRe,u);if(_){if(s["on:end"]){const u=new Response(s);s["on:end"](i,u),u.isMatchIgnored&&(_=!1)}if(_){for(;s.endsParent&&s.parent;)s=s.parent;return s}}if(s.endsWithParent)return endOfMode(s.parent,i,u)}function doIgnore(s){return 0===ee.matcher.regexIndex?(le+=s[0],1):(fe=!0,0)}function doBeginMatch(s){const i=s[0],u=s.rule,_=new Response(u),w=[u.__beforeBegin,u["on:begin"]];for(const u of w)if(u&&(u(s,_),_.isMatchIgnored))return doIgnore(i);return u&&u.endSameAsBegin&&(u.endRe=function escape(s){return new RegExp(s.replace(/[-/\\^$*+?.()|[\]{}]/g,"\\$&"),"m")}(i)),u.skip?le+=i:(u.excludeBegin&&(le+=i),processBuffer(),u.returnBegin||u.excludeBegin||(le=i)),startNewMode(u),u.returnBegin?0:i.length}function doEndMatch(s){const u=s[0],_=i.substr(s.index),w=endOfMode(ee,s,_);if(!w)return $e;const x=ee;x.skip?le+=u:(x.returnEnd||x.excludeEnd||(le+=u),processBuffer(),x.excludeEnd&&(le=u));do{ee.className&&ae.closeNode(),ee.skip||ee.subLanguage||(ce+=ee.relevance),ee=ee.parent}while(ee!==w.parent);return w.starts&&(w.endSameAsBegin&&(w.starts.endRe=w.endRe),startNewMode(w.starts)),x.returnEnd?0:u.length}let B={};function processLexeme(u,w){const j=w&&w[0];if(le+=u,null==j)return processBuffer(),0;if("begin"===B.type&&"end"===w.type&&B.index===w.index&&""===j){if(le+=i.slice(w.index,w.index+1),!x){const i=new Error("0 width match regex");throw i.languageName=s,i.badRule=B.rule,i}return 1}if(B=w,"begin"===w.type)return doBeginMatch(w);if("illegal"===w.type&&!_){const s=new Error('Illegal lexeme "'+j+'" for mode "'+(ee.className||"")+'"');throw s.mode=ee,s}if("end"===w.type){const s=doEndMatch(w);if(s!==$e)return s}if("illegal"===w.type&&""===j)return 1;if(de>1e5&&de>3*w.index){throw new Error("potential infinite loop, way more iterations than matches")}return le+=j,j.length}const U=getLanguage(s);if(!U)throw error(L.replace("{}",s)),new Error('Unknown language: "'+s+'"');const Y=compileLanguage(U,{plugins:w});let Z="",ee=j||Y;const ie={},ae=new $.__emitter($);!function processContinuations(){const s=[];for(let i=ee;i!==U;i=i.parent)i.className&&s.unshift(i.className);s.forEach((s=>ae.openNode(s)))}();let le="",ce=0,pe=0,de=0,fe=!1;try{for(ee.matcher.considerAll();;){de++,fe?fe=!1:ee.matcher.considerAll(),ee.matcher.lastIndex=pe;const s=ee.matcher.exec(i);if(!s)break;const u=processLexeme(i.substring(pe,s.index),s);pe=s.index+u}return processLexeme(i.substr(pe)),ae.closeAllNodes(),ae.finalize(),Z=ae.toHTML(),{relevance:Math.floor(ce),value:Z,language:s,illegal:!1,emitter:ae,top:ee}}catch(u){if(u.message&&u.message.includes("Illegal"))return{illegal:!0,illegalBy:{msg:u.message,context:i.slice(pe-100,pe+100),mode:u.mode},sofar:Z,relevance:0,value:Re(i),emitter:ae};if(x)return{illegal:!1,relevance:0,value:Re(i),emitter:ae,language:s,top:ee,errorRaised:u};throw u}}function highlightAuto(s,i){i=i||$.languages||Object.keys(u);const _=function justTextHighlightResult(s){const i={relevance:0,emitter:new $.__emitter($),value:Re(s),illegal:!1,top:B};return i.emitter.addText(s),i}(s),w=i.filter(getLanguage).filter(autoDetection).map((i=>_highlight(i,s,!1)));w.unshift(_);const x=w.sort(((s,i)=>{if(s.relevance!==i.relevance)return i.relevance-s.relevance;if(s.language&&i.language){if(getLanguage(s.language).supersetOf===i.language)return 1;if(getLanguage(i.language).supersetOf===s.language)return-1}return 0})),[j,L]=x,U=j;return U.second_best=L,U}const U={"before:highlightElement":({el:s})=>{$.useBR&&(s.innerHTML=s.innerHTML.replace(/\n/g,"").replace(//g,"\n"))},"after:highlightElement":({result:s})=>{$.useBR&&(s.value=s.value.replace(/\n/g,"
"))}},Y=/^(<[^>]+>|\t)+/gm,Z={"after:highlightElement":({result:s})=>{$.tabReplace&&(s.value=s.value.replace(Y,(s=>s.replace(/\t/g,$.tabReplace))))}};function highlightElement(s){let i=null;const u=function blockLanguage(s){let i=s.className+" ";i+=s.parentNode?s.parentNode.className:"";const u=$.languageDetectRe.exec(i);if(u){const i=getLanguage(u[1]);return i||(warn(L.replace("{}",u[1])),warn("Falling back to no-highlight mode for this block.",s)),i?u[1]:"no-highlight"}return i.split(/\s+/).find((s=>shouldNotHighlight(s)||getLanguage(s)))}(s);if(shouldNotHighlight(u))return;fire("before:highlightElement",{el:s,language:u}),i=s;const w=i.textContent,x=u?highlight(w,{language:u,ignoreIllegals:!0}):highlightAuto(w);fire("after:highlightElement",{el:s,result:x,text:w}),s.innerHTML=x.value,function updateClassName(s,i,u){const w=i?_[i]:u;s.classList.add("hljs"),w&&s.classList.add(w)}(s,u,x.language),s.result={language:x.language,re:x.relevance,relavance:x.relevance},x.second_best&&(s.second_best={language:x.second_best.language,re:x.second_best.relevance,relavance:x.second_best.relevance})}const initHighlighting=()=>{if(initHighlighting.called)return;initHighlighting.called=!0,deprecated("10.6.0","initHighlighting() is deprecated. Use highlightAll() instead.");document.querySelectorAll("pre code").forEach(highlightElement)};let ee=!1;function highlightAll(){if("loading"===document.readyState)return void(ee=!0);document.querySelectorAll("pre code").forEach(highlightElement)}function getLanguage(s){return s=(s||"").toLowerCase(),u[s]||u[_[s]]}function registerAliases(s,{languageName:i}){"string"==typeof s&&(s=[s]),s.forEach((s=>{_[s.toLowerCase()]=i}))}function autoDetection(s){const i=getLanguage(s);return i&&!i.disableAutodetect}function fire(s,i){const u=s;w.forEach((function(s){s[u]&&s[u](i)}))}"undefined"!=typeof window&&window.addEventListener&&window.addEventListener("DOMContentLoaded",(function boot(){ee&&highlightAll()}),!1),Object.assign(s,{highlight,highlightAuto,highlightAll,fixMarkup:function deprecateFixMarkup(s){return deprecated("10.2.0","fixMarkup will be removed entirely in v11.0"),deprecated("10.2.0","Please see https://github.com/highlightjs/highlight.js/issues/2534"),function fixMarkup(s){return $.tabReplace||$.useBR?s.replace(j,(s=>"\n"===s?$.useBR?"
":s:$.tabReplace?s.replace(/\t/g,$.tabReplace):s)):s}(s)},highlightElement,highlightBlock:function deprecateHighlightBlock(s){return deprecated("10.7.0","highlightBlock will be removed entirely in v12.0"),deprecated("10.7.0","Please use highlightElement now."),highlightElement(s)},configure:function configure(s){s.useBR&&(deprecated("10.3.0","'useBR' will be removed entirely in v11.0"),deprecated("10.3.0","Please see https://github.com/highlightjs/highlight.js/issues/2559")),$=qe($,s)},initHighlighting,initHighlightingOnLoad:function initHighlightingOnLoad(){deprecated("10.6.0","initHighlightingOnLoad() is deprecated. Use highlightAll() instead."),ee=!0},registerLanguage:function registerLanguage(i,_){let w=null;try{w=_(s)}catch(s){if(error("Language definition for '{}' could not be registered.".replace("{}",i)),!x)throw s;error(s),w=B}w.name||(w.name=i),u[i]=w,w.rawDefinition=_.bind(null,s),w.aliases&®isterAliases(w.aliases,{languageName:i})},unregisterLanguage:function unregisterLanguage(s){delete u[s];for(const i of Object.keys(_))_[i]===s&&delete _[i]},listLanguages:function listLanguages(){return Object.keys(u)},getLanguage,registerAliases,requireLanguage:function requireLanguage(s){deprecated("10.4.0","requireLanguage will be removed entirely in v11."),deprecated("10.4.0","Please see https://github.com/highlightjs/highlight.js/pull/2844");const i=getLanguage(s);if(i)return i;throw new Error("The '{}' language is required, but not loaded.".replace("{}",s))},autoDetection,inherit:qe,addPlugin:function addPlugin(s){!function upgradePluginAPI(s){s["before:highlightBlock"]&&!s["before:highlightElement"]&&(s["before:highlightElement"]=i=>{s["before:highlightBlock"](Object.assign({block:i.el},i))}),s["after:highlightBlock"]&&!s["after:highlightElement"]&&(s["after:highlightElement"]=i=>{s["after:highlightBlock"](Object.assign({block:i.el},i))})}(s),w.push(s)},vuePlugin:BuildVuePlugin(s).VuePlugin}),s.debugMode=function(){x=!1},s.safeMode=function(){x=!0},s.versionString="10.7.3";for(const s in we)"object"==typeof we[s]&&i(we[s]);return Object.assign(s,we),s.addPlugin(U),s.addPlugin(Pe),s.addPlugin(Z),s}({});s.exports=ze},35344:s=>{function concat(...s){return s.map((s=>function source(s){return s?"string"==typeof s?s:s.source:null}(s))).join("")}s.exports=function bash(s){const i={},u={begin:/\$\{/,end:/\}/,contains:["self",{begin:/:-/,contains:[i]}]};Object.assign(i,{className:"variable",variants:[{begin:concat(/\$[\w\d#@][\w\d_]*/,"(?![\\w\\d])(?![$])")},u]});const _={className:"subst",begin:/\$\(/,end:/\)/,contains:[s.BACKSLASH_ESCAPE]},w={begin:/<<-?\s*(?=\w+)/,starts:{contains:[s.END_SAME_AS_BEGIN({begin:/(\w+)/,end:/(\w+)/,className:"string"})]}},x={className:"string",begin:/"/,end:/"/,contains:[s.BACKSLASH_ESCAPE,i,_]};_.contains.push(x);const j={begin:/\$\(\(/,end:/\)\)/,contains:[{begin:/\d+#[0-9a-f]+/,className:"number"},s.NUMBER_MODE,i]},L=s.SHEBANG({binary:`(${["fish","bash","zsh","sh","csh","ksh","tcsh","dash","scsh"].join("|")})`,relevance:10}),B={className:"function",begin:/\w[\w\d_]*\s*\(\s*\)\s*\{/,returnBegin:!0,contains:[s.inherit(s.TITLE_MODE,{begin:/\w[\w\d_]*/})],relevance:0};return{name:"Bash",aliases:["sh","zsh"],keywords:{$pattern:/\b[a-z._-]+\b/,keyword:"if then else elif fi for while in do done case esac function",literal:"true false",built_in:"break cd continue eval exec exit export getopts hash pwd readonly return shift test times trap umask unset alias bind builtin caller command declare echo enable help let local logout mapfile printf read readarray source type typeset ulimit unalias set shopt autoload bg bindkey bye cap chdir clone comparguments compcall compctl compdescribe compfiles compgroups compquote comptags comptry compvalues dirs disable disown echotc echoti emulate fc fg float functions getcap getln history integer jobs kill limit log noglob popd print pushd pushln rehash sched setcap setopt stat suspend ttyctl unfunction unhash unlimit unsetopt vared wait whence where which zcompile zformat zftp zle zmodload zparseopts zprof zpty zregexparse zsocket zstyle ztcp"},contains:[L,s.SHEBANG(),B,j,s.HASH_COMMENT_MODE,w,x,{className:"",begin:/\\"/},{className:"string",begin:/'/,end:/'/},i]}}},73402:s=>{function concat(...s){return s.map((s=>function source(s){return s?"string"==typeof s?s:s.source:null}(s))).join("")}s.exports=function http(s){const i="HTTP/(2|1\\.[01])",u={className:"attribute",begin:concat("^",/[A-Za-z][A-Za-z0-9-]*/,"(?=\\:\\s)"),starts:{contains:[{className:"punctuation",begin:/: /,relevance:0,starts:{end:"$",relevance:0}}]}},_=[u,{begin:"\\n\\n",starts:{subLanguage:[],endsWithParent:!0}}];return{name:"HTTP",aliases:["https"],illegal:/\S/,contains:[{begin:"^(?="+i+" \\d{3})",end:/$/,contains:[{className:"meta",begin:i},{className:"number",begin:"\\b\\d{3}\\b"}],starts:{end:/\b\B/,illegal:/\S/,contains:_}},{begin:"(?=^[A-Z]+ (.*?) "+i+"$)",end:/$/,contains:[{className:"string",begin:" ",end:" ",excludeBegin:!0,excludeEnd:!0},{className:"meta",begin:i},{className:"keyword",begin:"[A-Z]+"}],starts:{end:/\b\B/,illegal:/\S/,contains:_}},s.inherit(u,{relevance:0})]}}},95089:s=>{const i="[A-Za-z$_][0-9A-Za-z$_]*",u=["as","in","of","if","for","while","finally","var","new","function","do","return","void","else","break","catch","instanceof","with","throw","case","default","try","switch","continue","typeof","delete","let","yield","const","class","debugger","async","await","static","import","from","export","extends"],_=["true","false","null","undefined","NaN","Infinity"],w=[].concat(["setInterval","setTimeout","clearInterval","clearTimeout","require","exports","eval","isFinite","isNaN","parseFloat","parseInt","decodeURI","decodeURIComponent","encodeURI","encodeURIComponent","escape","unescape"],["arguments","this","super","console","window","document","localStorage","module","global"],["Intl","DataView","Number","Math","Date","String","RegExp","Object","Function","Boolean","Error","Symbol","Set","Map","WeakSet","WeakMap","Proxy","Reflect","JSON","Promise","Float64Array","Int16Array","Int32Array","Int8Array","Uint16Array","Uint32Array","Float32Array","Array","Uint8Array","Uint8ClampedArray","ArrayBuffer","BigInt64Array","BigUint64Array","BigInt"],["EvalError","InternalError","RangeError","ReferenceError","SyntaxError","TypeError","URIError"]);function lookahead(s){return concat("(?=",s,")")}function concat(...s){return s.map((s=>function source(s){return s?"string"==typeof s?s:s.source:null}(s))).join("")}s.exports=function javascript(s){const x=i,j="<>",L="",B={begin:/<[A-Za-z0-9\\._:-]+/,end:/\/[A-Za-z0-9\\._:-]+>|\/>/,isTrulyOpeningTag:(s,i)=>{const u=s[0].length+s.index,_=s.input[u];"<"!==_?">"===_&&(((s,{after:i})=>{const u="",returnBegin:!0,end:"\\s*=>",contains:[{className:"params",variants:[{begin:s.UNDERSCORE_IDENT_RE,relevance:0},{className:null,begin:/\(\s*\)/,skip:!0},{begin:/\(/,end:/\)/,excludeBegin:!0,excludeEnd:!0,keywords:$,contains:ye}]}]},{begin:/,/,relevance:0},{className:"",begin:/\s/,end:/\s*/,skip:!0},{variants:[{begin:j,end:L},{begin:B.begin,"on:begin":B.isTrulyOpeningTag,end:B.end}],subLanguage:"xml",contains:[{begin:B.begin,end:B.end,skip:!0,contains:["self"]}]}],relevance:0},{className:"function",beginKeywords:"function",end:/[{;]/,excludeEnd:!0,keywords:$,contains:["self",s.inherit(s.TITLE_MODE,{begin:x}),be],illegal:/%/},{beginKeywords:"while if switch catch for"},{className:"function",begin:s.UNDERSCORE_IDENT_RE+"\\([^()]*(\\([^()]*(\\([^()]*\\)[^()]*)*\\)[^()]*)*\\)\\s*\\{",returnBegin:!0,contains:[be,s.inherit(s.TITLE_MODE,{begin:x})]},{variants:[{begin:"\\."+x},{begin:"\\$"+x}],relevance:0},{className:"class",beginKeywords:"class",end:/[{;=]/,excludeEnd:!0,illegal:/[:"[\]]/,contains:[{beginKeywords:"extends"},s.UNDERSCORE_TITLE_MODE]},{begin:/\b(?=constructor)/,end:/[{;]/,excludeEnd:!0,contains:[s.inherit(s.TITLE_MODE,{begin:x}),"self",be]},{begin:"(get|set)\\s+(?="+x+"\\()",end:/\{/,keywords:"get set",contains:[s.inherit(s.TITLE_MODE,{begin:x}),{begin:/\(\)/},be]},{begin:/\$[(.]/}]}}},65772:s=>{s.exports=function json(s){const i={literal:"true false null"},u=[s.C_LINE_COMMENT_MODE,s.C_BLOCK_COMMENT_MODE],_=[s.QUOTE_STRING_MODE,s.C_NUMBER_MODE],w={end:",",endsWithParent:!0,excludeEnd:!0,contains:_,keywords:i},x={begin:/\{/,end:/\}/,contains:[{className:"attr",begin:/"/,end:/"/,contains:[s.BACKSLASH_ESCAPE],illegal:"\\n"},s.inherit(w,{begin:/:/})].concat(u),illegal:"\\S"},j={begin:"\\[",end:"\\]",contains:[s.inherit(w)],illegal:"\\S"};return _.push(x,j),u.forEach((function(s){_.push(s)})),{name:"JSON",contains:_,keywords:i,illegal:"\\S"}}},26571:s=>{s.exports=function powershell(s){const i={$pattern:/-?[A-z\.\-]+\b/,keyword:"if else foreach return do while until elseif begin for trap data dynamicparam end break throw param continue finally in switch exit filter try process catch hidden static parameter",built_in:"ac asnp cat cd CFS chdir clc clear clhy cli clp cls clv cnsn compare copy cp cpi cpp curl cvpa dbp del diff dir dnsn ebp echo|0 epal epcsv epsn erase etsn exsn fc fhx fl ft fw gal gbp gc gcb gci gcm gcs gdr gerr ghy gi gin gjb gl gm gmo gp gps gpv group gsn gsnp gsv gtz gu gv gwmi h history icm iex ihy ii ipal ipcsv ipmo ipsn irm ise iwmi iwr kill lp ls man md measure mi mount move mp mv nal ndr ni nmo npssc nsn nv ogv oh popd ps pushd pwd r rbp rcjb rcsn rd rdr ren ri rjb rm rmdir rmo rni rnp rp rsn rsnp rujb rv rvpa rwmi sajb sal saps sasv sbp sc scb select set shcm si sl sleep sls sort sp spjb spps spsv start stz sujb sv swmi tee trcm type wget where wjb write"},u={begin:"`[\\s\\S]",relevance:0},_={className:"variable",variants:[{begin:/\$\B/},{className:"keyword",begin:/\$this/},{begin:/\$[\w\d][\w\d_:]*/}]},w={className:"string",variants:[{begin:/"/,end:/"/},{begin:/@"/,end:/^"@/}],contains:[u,_,{className:"variable",begin:/\$[A-z]/,end:/[^A-z]/}]},x={className:"string",variants:[{begin:/'/,end:/'/},{begin:/@'/,end:/^'@/}]},j=s.inherit(s.COMMENT(null,null),{variants:[{begin:/#/,end:/$/},{begin:/<#/,end:/#>/}],contains:[{className:"doctag",variants:[{begin:/\.(synopsis|description|example|inputs|outputs|notes|link|component|role|functionality)/},{begin:/\.(parameter|forwardhelptargetname|forwardhelpcategory|remotehelprunspace|externalhelp)\s+\S+/}]}]}),L={className:"built_in",variants:[{begin:"(".concat("Add|Clear|Close|Copy|Enter|Exit|Find|Format|Get|Hide|Join|Lock|Move|New|Open|Optimize|Pop|Push|Redo|Remove|Rename|Reset|Resize|Search|Select|Set|Show|Skip|Split|Step|Switch|Undo|Unlock|Watch|Backup|Checkpoint|Compare|Compress|Convert|ConvertFrom|ConvertTo|Dismount|Edit|Expand|Export|Group|Import|Initialize|Limit|Merge|Mount|Out|Publish|Restore|Save|Sync|Unpublish|Update|Approve|Assert|Build|Complete|Confirm|Deny|Deploy|Disable|Enable|Install|Invoke|Register|Request|Restart|Resume|Start|Stop|Submit|Suspend|Uninstall|Unregister|Wait|Debug|Measure|Ping|Repair|Resolve|Test|Trace|Connect|Disconnect|Read|Receive|Send|Write|Block|Grant|Protect|Revoke|Unblock|Unprotect|Use|ForEach|Sort|Tee|Where",")+(-)[\\w\\d]+")}]},B={className:"class",beginKeywords:"class enum",end:/\s*[{]/,excludeEnd:!0,relevance:0,contains:[s.TITLE_MODE]},$={className:"function",begin:/function\s+/,end:/\s*\{|$/,excludeEnd:!0,returnBegin:!0,relevance:0,contains:[{begin:"function",relevance:0,className:"keyword"},{className:"title",begin:/\w[\w\d]*((-)[\w\d]+)*/,relevance:0},{begin:/\(/,end:/\)/,className:"params",relevance:0,contains:[_]}]},U={begin:/using\s/,end:/$/,returnBegin:!0,contains:[w,x,{className:"keyword",begin:/(using|assembly|command|module|namespace|type)/}]},Y={variants:[{className:"operator",begin:"(".concat("-and|-as|-band|-bnot|-bor|-bxor|-casesensitive|-ccontains|-ceq|-cge|-cgt|-cle|-clike|-clt|-cmatch|-cne|-cnotcontains|-cnotlike|-cnotmatch|-contains|-creplace|-csplit|-eq|-exact|-f|-file|-ge|-gt|-icontains|-ieq|-ige|-igt|-ile|-ilike|-ilt|-imatch|-in|-ine|-inotcontains|-inotlike|-inotmatch|-ireplace|-is|-isnot|-isplit|-join|-le|-like|-lt|-match|-ne|-not|-notcontains|-notin|-notlike|-notmatch|-or|-regex|-replace|-shl|-shr|-split|-wildcard|-xor",")\\b")},{className:"literal",begin:/(-)[\w\d]+/,relevance:0}]},Z={className:"function",begin:/\[.*\]\s*[\w]+[ ]??\(/,end:/$/,returnBegin:!0,relevance:0,contains:[{className:"keyword",begin:"(".concat(i.keyword.toString().replace(/\s/g,"|"),")\\b"),endsParent:!0,relevance:0},s.inherit(s.TITLE_MODE,{endsParent:!0})]},ee=[Z,j,u,s.NUMBER_MODE,w,x,L,_,{className:"literal",begin:/\$(null|true|false)\b/},{className:"selector-tag",begin:/@\B/,relevance:0}],ie={begin:/\[/,end:/\]/,excludeBegin:!0,excludeEnd:!0,relevance:0,contains:[].concat("self",ee,{begin:"("+["string","char","byte","int","long","bool","decimal","single","double","DateTime","xml","array","hashtable","void"].join("|")+")",className:"built_in",relevance:0},{className:"type",begin:/[\.\w\d]+/,relevance:0})};return Z.contains.unshift(ie),{name:"PowerShell",aliases:["ps","ps1"],case_insensitive:!0,keywords:i,contains:ee.concat(B,$,U,Y,ie)}}},17285:s=>{function source(s){return s?"string"==typeof s?s:s.source:null}function lookahead(s){return concat("(?=",s,")")}function concat(...s){return s.map((s=>source(s))).join("")}function either(...s){return"("+s.map((s=>source(s))).join("|")+")"}s.exports=function xml(s){const i=concat(/[A-Z_]/,function optional(s){return concat("(",s,")?")}(/[A-Z0-9_.-]*:/),/[A-Z0-9_.-]*/),u={className:"symbol",begin:/&[a-z]+;|&#[0-9]+;|&#x[a-f0-9]+;/},_={begin:/\s/,contains:[{className:"meta-keyword",begin:/#?[a-z_][a-z1-9_-]+/,illegal:/\n/}]},w=s.inherit(_,{begin:/\(/,end:/\)/}),x=s.inherit(s.APOS_STRING_MODE,{className:"meta-string"}),j=s.inherit(s.QUOTE_STRING_MODE,{className:"meta-string"}),L={endsWithParent:!0,illegal:/`]+/}]}]}]};return{name:"HTML, XML",aliases:["html","xhtml","rss","atom","xjb","xsd","xsl","plist","wsf","svg"],case_insensitive:!0,contains:[{className:"meta",begin://,relevance:10,contains:[_,j,x,w,{begin:/\[/,end:/\]/,contains:[{className:"meta",begin://,contains:[_,w,j,x]}]}]},s.COMMENT(//,{relevance:10}),{begin://,relevance:10},u,{className:"meta",begin:/<\?xml/,end:/\?>/,relevance:10},{className:"tag",begin:/)/,end:/>/,keywords:{name:"style"},contains:[L],starts:{end:/<\/style>/,returnEnd:!0,subLanguage:["css","xml"]}},{className:"tag",begin:/)/,end:/>/,keywords:{name:"script"},contains:[L],starts:{end:/<\/script>/,returnEnd:!0,subLanguage:["javascript","handlebars","xml"]}},{className:"tag",begin:/<>|<\/>/},{className:"tag",begin:concat(//,/>/,/\s/)))),end:/\/?>/,contains:[{className:"name",begin:i,relevance:0,starts:L}]},{className:"tag",begin:concat(/<\//,lookahead(concat(i,/>/))),contains:[{className:"name",begin:i,relevance:0},{begin:/>/,relevance:0,endsParent:!0}]}]}}},17533:s=>{s.exports=function yaml(s){var i="true false yes no null",u="[\\w#;/?:@&=+$,.~*'()[\\]]+",_={className:"string",relevance:0,variants:[{begin:/'/,end:/'/},{begin:/"/,end:/"/},{begin:/\S+/}],contains:[s.BACKSLASH_ESCAPE,{className:"template-variable",variants:[{begin:/\{\{/,end:/\}\}/},{begin:/%\{/,end:/\}/}]}]},w=s.inherit(_,{variants:[{begin:/'/,end:/'/},{begin:/"/,end:/"/},{begin:/[^\s,{}[\]]+/}]}),x={className:"number",begin:"\\b[0-9]{4}(-[0-9][0-9]){0,2}([Tt \\t][0-9][0-9]?(:[0-9][0-9]){2})?(\\.[0-9]*)?([ \\t])*(Z|[-+][0-9][0-9]?(:[0-9][0-9])?)?\\b"},j={end:",",endsWithParent:!0,excludeEnd:!0,keywords:i,relevance:0},L={begin:/\{/,end:/\}/,contains:[j],illegal:"\\n",relevance:0},B={begin:"\\[",end:"\\]",contains:[j],illegal:"\\n",relevance:0},$=[{className:"attr",variants:[{begin:"\\w[\\w :\\/.-]*:(?=[ \t]|$)"},{begin:'"\\w[\\w :\\/.-]*":(?=[ \t]|$)'},{begin:"'\\w[\\w :\\/.-]*':(?=[ \t]|$)"}]},{className:"meta",begin:"^---\\s*$",relevance:10},{className:"string",begin:"[\\|>]([1-9]?[+-])?[ ]*\\n( +)[^ ][^\\n]*\\n(\\2[^\\n]+\\n?)*"},{begin:"<%[%=-]?",end:"[%-]?%>",subLanguage:"ruby",excludeBegin:!0,excludeEnd:!0,relevance:0},{className:"type",begin:"!\\w+!"+u},{className:"type",begin:"!<"+u+">"},{className:"type",begin:"!"+u},{className:"type",begin:"!!"+u},{className:"meta",begin:"&"+s.UNDERSCORE_IDENT_RE+"$"},{className:"meta",begin:"\\*"+s.UNDERSCORE_IDENT_RE+"$"},{className:"bullet",begin:"-(?=[ ]|$)",relevance:0},s.HASH_COMMENT_MODE,{beginKeywords:i,keywords:{literal:i}},x,{className:"number",begin:s.C_NUMBER_RE+"\\b",relevance:0},L,B,_],U=[...$];return U.pop(),U.push(w),j.contains=U,{name:"YAML",case_insensitive:!0,aliases:["yml"],contains:$}}},251:(s,i)=>{i.read=function(s,i,u,_,w){var x,j,L=8*w-_-1,B=(1<>1,U=-7,Y=u?w-1:0,Z=u?-1:1,ee=s[i+Y];for(Y+=Z,x=ee&(1<<-U)-1,ee>>=-U,U+=L;U>0;x=256*x+s[i+Y],Y+=Z,U-=8);for(j=x&(1<<-U)-1,x>>=-U,U+=_;U>0;j=256*j+s[i+Y],Y+=Z,U-=8);if(0===x)x=1-$;else{if(x===B)return j?NaN:1/0*(ee?-1:1);j+=Math.pow(2,_),x-=$}return(ee?-1:1)*j*Math.pow(2,x-_)},i.write=function(s,i,u,_,w,x){var j,L,B,$=8*x-w-1,U=(1<<$)-1,Y=U>>1,Z=23===w?Math.pow(2,-24)-Math.pow(2,-77):0,ee=_?0:x-1,ie=_?1:-1,ae=i<0||0===i&&1/i<0?1:0;for(i=Math.abs(i),isNaN(i)||i===1/0?(L=isNaN(i)?1:0,j=U):(j=Math.floor(Math.log(i)/Math.LN2),i*(B=Math.pow(2,-j))<1&&(j--,B*=2),(i+=j+Y>=1?Z/B:Z*Math.pow(2,1-Y))*B>=2&&(j++,B/=2),j+Y>=U?(L=0,j=U):j+Y>=1?(L=(i*B-1)*Math.pow(2,w),j+=Y):(L=i*Math.pow(2,Y-1)*Math.pow(2,w),j=0));w>=8;s[u+ee]=255&L,ee+=ie,L/=256,w-=8);for(j=j<0;s[u+ee]=255&j,ee+=ie,j/=256,$-=8);s[u+ee-ie]|=128*ae}},9404:function(s){s.exports=function(){"use strict";var s=Array.prototype.slice;function createClass(s,i){i&&(s.prototype=Object.create(i.prototype)),s.prototype.constructor=s}function Iterable(s){return isIterable(s)?s:Seq(s)}function KeyedIterable(s){return isKeyed(s)?s:KeyedSeq(s)}function IndexedIterable(s){return isIndexed(s)?s:IndexedSeq(s)}function SetIterable(s){return isIterable(s)&&!isAssociative(s)?s:SetSeq(s)}function isIterable(s){return!(!s||!s[i])}function isKeyed(s){return!(!s||!s[u])}function isIndexed(s){return!(!s||!s[_])}function isAssociative(s){return isKeyed(s)||isIndexed(s)}function isOrdered(s){return!(!s||!s[w])}createClass(KeyedIterable,Iterable),createClass(IndexedIterable,Iterable),createClass(SetIterable,Iterable),Iterable.isIterable=isIterable,Iterable.isKeyed=isKeyed,Iterable.isIndexed=isIndexed,Iterable.isAssociative=isAssociative,Iterable.isOrdered=isOrdered,Iterable.Keyed=KeyedIterable,Iterable.Indexed=IndexedIterable,Iterable.Set=SetIterable;var i="@@__IMMUTABLE_ITERABLE__@@",u="@@__IMMUTABLE_KEYED__@@",_="@@__IMMUTABLE_INDEXED__@@",w="@@__IMMUTABLE_ORDERED__@@",x="delete",j=5,L=1<>>0;if(""+u!==i||4294967295===u)return NaN;i=u}return i<0?ensureSize(s)+i:i}function returnTrue(){return!0}function wholeSlice(s,i,u){return(0===s||void 0!==u&&s<=-u)&&(void 0===i||void 0!==u&&i>=u)}function resolveBegin(s,i){return resolveIndex(s,i,0)}function resolveEnd(s,i){return resolveIndex(s,i,i)}function resolveIndex(s,i,u){return void 0===s?u:s<0?Math.max(0,i+s):void 0===i?s:Math.min(i,s)}var Z=0,ee=1,ie=2,ae="function"==typeof Symbol&&Symbol.iterator,le="@@iterator",ce=ae||le;function Iterator(s){this.next=s}function iteratorValue(s,i,u,_){var w=0===s?i:1===s?u:[i,u];return _?_.value=w:_={value:w,done:!1},_}function iteratorDone(){return{value:void 0,done:!0}}function hasIterator(s){return!!getIteratorFn(s)}function isIterator(s){return s&&"function"==typeof s.next}function getIterator(s){var i=getIteratorFn(s);return i&&i.call(s)}function getIteratorFn(s){var i=s&&(ae&&s[ae]||s[le]);if("function"==typeof i)return i}function isArrayLike(s){return s&&"number"==typeof s.length}function Seq(s){return null==s?emptySequence():isIterable(s)?s.toSeq():seqFromValue(s)}function KeyedSeq(s){return null==s?emptySequence().toKeyedSeq():isIterable(s)?isKeyed(s)?s.toSeq():s.fromEntrySeq():keyedSeqFromValue(s)}function IndexedSeq(s){return null==s?emptySequence():isIterable(s)?isKeyed(s)?s.entrySeq():s.toIndexedSeq():indexedSeqFromValue(s)}function SetSeq(s){return(null==s?emptySequence():isIterable(s)?isKeyed(s)?s.entrySeq():s:indexedSeqFromValue(s)).toSetSeq()}Iterator.prototype.toString=function(){return"[Iterator]"},Iterator.KEYS=Z,Iterator.VALUES=ee,Iterator.ENTRIES=ie,Iterator.prototype.inspect=Iterator.prototype.toSource=function(){return this.toString()},Iterator.prototype[ce]=function(){return this},createClass(Seq,Iterable),Seq.of=function(){return Seq(arguments)},Seq.prototype.toSeq=function(){return this},Seq.prototype.toString=function(){return this.__toString("Seq {","}")},Seq.prototype.cacheResult=function(){return!this._cache&&this.__iterateUncached&&(this._cache=this.entrySeq().toArray(),this.size=this._cache.length),this},Seq.prototype.__iterate=function(s,i){return seqIterate(this,s,i,!0)},Seq.prototype.__iterator=function(s,i){return seqIterator(this,s,i,!0)},createClass(KeyedSeq,Seq),KeyedSeq.prototype.toKeyedSeq=function(){return this},createClass(IndexedSeq,Seq),IndexedSeq.of=function(){return IndexedSeq(arguments)},IndexedSeq.prototype.toIndexedSeq=function(){return this},IndexedSeq.prototype.toString=function(){return this.__toString("Seq [","]")},IndexedSeq.prototype.__iterate=function(s,i){return seqIterate(this,s,i,!1)},IndexedSeq.prototype.__iterator=function(s,i){return seqIterator(this,s,i,!1)},createClass(SetSeq,Seq),SetSeq.of=function(){return SetSeq(arguments)},SetSeq.prototype.toSetSeq=function(){return this},Seq.isSeq=isSeq,Seq.Keyed=KeyedSeq,Seq.Set=SetSeq,Seq.Indexed=IndexedSeq;var pe,de,fe,ye="@@__IMMUTABLE_SEQ__@@";function ArraySeq(s){this._array=s,this.size=s.length}function ObjectSeq(s){var i=Object.keys(s);this._object=s,this._keys=i,this.size=i.length}function IterableSeq(s){this._iterable=s,this.size=s.length||s.size}function IteratorSeq(s){this._iterator=s,this._iteratorCache=[]}function isSeq(s){return!(!s||!s[ye])}function emptySequence(){return pe||(pe=new ArraySeq([]))}function keyedSeqFromValue(s){var i=Array.isArray(s)?new ArraySeq(s).fromEntrySeq():isIterator(s)?new IteratorSeq(s).fromEntrySeq():hasIterator(s)?new IterableSeq(s).fromEntrySeq():"object"==typeof s?new ObjectSeq(s):void 0;if(!i)throw new TypeError("Expected Array or iterable object of [k, v] entries, or keyed object: "+s);return i}function indexedSeqFromValue(s){var i=maybeIndexedSeqFromValue(s);if(!i)throw new TypeError("Expected Array or iterable object of values: "+s);return i}function seqFromValue(s){var i=maybeIndexedSeqFromValue(s)||"object"==typeof s&&new ObjectSeq(s);if(!i)throw new TypeError("Expected Array or iterable object of values, or keyed object: "+s);return i}function maybeIndexedSeqFromValue(s){return isArrayLike(s)?new ArraySeq(s):isIterator(s)?new IteratorSeq(s):hasIterator(s)?new IterableSeq(s):void 0}function seqIterate(s,i,u,_){var w=s._cache;if(w){for(var x=w.length-1,j=0;j<=x;j++){var L=w[u?x-j:j];if(!1===i(L[1],_?L[0]:j,s))return j+1}return j}return s.__iterateUncached(i,u)}function seqIterator(s,i,u,_){var w=s._cache;if(w){var x=w.length-1,j=0;return new Iterator((function(){var s=w[u?x-j:j];return j++>x?iteratorDone():iteratorValue(i,_?s[0]:j-1,s[1])}))}return s.__iteratorUncached(i,u)}function fromJS(s,i){return i?fromJSWith(i,s,"",{"":s}):fromJSDefault(s)}function fromJSWith(s,i,u,_){return Array.isArray(i)?s.call(_,u,IndexedSeq(i).map((function(u,_){return fromJSWith(s,u,_,i)}))):isPlainObj(i)?s.call(_,u,KeyedSeq(i).map((function(u,_){return fromJSWith(s,u,_,i)}))):i}function fromJSDefault(s){return Array.isArray(s)?IndexedSeq(s).map(fromJSDefault).toList():isPlainObj(s)?KeyedSeq(s).map(fromJSDefault).toMap():s}function isPlainObj(s){return s&&(s.constructor===Object||void 0===s.constructor)}function is(s,i){if(s===i||s!=s&&i!=i)return!0;if(!s||!i)return!1;if("function"==typeof s.valueOf&&"function"==typeof i.valueOf){if((s=s.valueOf())===(i=i.valueOf())||s!=s&&i!=i)return!0;if(!s||!i)return!1}return!("function"!=typeof s.equals||"function"!=typeof i.equals||!s.equals(i))}function deepEqual(s,i){if(s===i)return!0;if(!isIterable(i)||void 0!==s.size&&void 0!==i.size&&s.size!==i.size||void 0!==s.__hash&&void 0!==i.__hash&&s.__hash!==i.__hash||isKeyed(s)!==isKeyed(i)||isIndexed(s)!==isIndexed(i)||isOrdered(s)!==isOrdered(i))return!1;if(0===s.size&&0===i.size)return!0;var u=!isAssociative(s);if(isOrdered(s)){var _=s.entries();return i.every((function(s,i){var w=_.next().value;return w&&is(w[1],s)&&(u||is(w[0],i))}))&&_.next().done}var w=!1;if(void 0===s.size)if(void 0===i.size)"function"==typeof s.cacheResult&&s.cacheResult();else{w=!0;var x=s;s=i,i=x}var j=!0,L=i.__iterate((function(i,_){if(u?!s.has(i):w?!is(i,s.get(_,$)):!is(s.get(_,$),i))return j=!1,!1}));return j&&s.size===L}function Repeat(s,i){if(!(this instanceof Repeat))return new Repeat(s,i);if(this._value=s,this.size=void 0===i?1/0:Math.max(0,i),0===this.size){if(de)return de;de=this}}function invariant(s,i){if(!s)throw new Error(i)}function Range(s,i,u){if(!(this instanceof Range))return new Range(s,i,u);if(invariant(0!==u,"Cannot step a Range by 0"),s=s||0,void 0===i&&(i=1/0),u=void 0===u?1:Math.abs(u),i_?iteratorDone():iteratorValue(s,w,u[i?_-w++:w++])}))},createClass(ObjectSeq,KeyedSeq),ObjectSeq.prototype.get=function(s,i){return void 0===i||this.has(s)?this._object[s]:i},ObjectSeq.prototype.has=function(s){return this._object.hasOwnProperty(s)},ObjectSeq.prototype.__iterate=function(s,i){for(var u=this._object,_=this._keys,w=_.length-1,x=0;x<=w;x++){var j=_[i?w-x:x];if(!1===s(u[j],j,this))return x+1}return x},ObjectSeq.prototype.__iterator=function(s,i){var u=this._object,_=this._keys,w=_.length-1,x=0;return new Iterator((function(){var j=_[i?w-x:x];return x++>w?iteratorDone():iteratorValue(s,j,u[j])}))},ObjectSeq.prototype[w]=!0,createClass(IterableSeq,IndexedSeq),IterableSeq.prototype.__iterateUncached=function(s,i){if(i)return this.cacheResult().__iterate(s,i);var u=getIterator(this._iterable),_=0;if(isIterator(u))for(var w;!(w=u.next()).done&&!1!==s(w.value,_++,this););return _},IterableSeq.prototype.__iteratorUncached=function(s,i){if(i)return this.cacheResult().__iterator(s,i);var u=getIterator(this._iterable);if(!isIterator(u))return new Iterator(iteratorDone);var _=0;return new Iterator((function(){var i=u.next();return i.done?i:iteratorValue(s,_++,i.value)}))},createClass(IteratorSeq,IndexedSeq),IteratorSeq.prototype.__iterateUncached=function(s,i){if(i)return this.cacheResult().__iterate(s,i);for(var u,_=this._iterator,w=this._iteratorCache,x=0;x=_.length){var i=u.next();if(i.done)return i;_[w]=i.value}return iteratorValue(s,w,_[w++])}))},createClass(Repeat,IndexedSeq),Repeat.prototype.toString=function(){return 0===this.size?"Repeat []":"Repeat [ "+this._value+" "+this.size+" times ]"},Repeat.prototype.get=function(s,i){return this.has(s)?this._value:i},Repeat.prototype.includes=function(s){return is(this._value,s)},Repeat.prototype.slice=function(s,i){var u=this.size;return wholeSlice(s,i,u)?this:new Repeat(this._value,resolveEnd(i,u)-resolveBegin(s,u))},Repeat.prototype.reverse=function(){return this},Repeat.prototype.indexOf=function(s){return is(this._value,s)?0:-1},Repeat.prototype.lastIndexOf=function(s){return is(this._value,s)?this.size:-1},Repeat.prototype.__iterate=function(s,i){for(var u=0;u=0&&i=0&&uu?iteratorDone():iteratorValue(s,x++,j)}))},Range.prototype.equals=function(s){return s instanceof Range?this._start===s._start&&this._end===s._end&&this._step===s._step:deepEqual(this,s)},createClass(Collection,Iterable),createClass(KeyedCollection,Collection),createClass(IndexedCollection,Collection),createClass(SetCollection,Collection),Collection.Keyed=KeyedCollection,Collection.Indexed=IndexedCollection,Collection.Set=SetCollection;var be="function"==typeof Math.imul&&-2===Math.imul(4294967295,2)?Math.imul:function imul(s,i){var u=65535&(s|=0),_=65535&(i|=0);return u*_+((s>>>16)*_+u*(i>>>16)<<16>>>0)|0};function smi(s){return s>>>1&1073741824|3221225471&s}function hash(s){if(!1===s||null==s)return 0;if("function"==typeof s.valueOf&&(!1===(s=s.valueOf())||null==s))return 0;if(!0===s)return 1;var i=typeof s;if("number"===i){if(s!=s||s===1/0)return 0;var u=0|s;for(u!==s&&(u^=4294967295*s);s>4294967295;)u^=s/=4294967295;return smi(u)}if("string"===i)return s.length>Re?cachedHashString(s):hashString(s);if("function"==typeof s.hashCode)return s.hashCode();if("object"===i)return hashJSObj(s);if("function"==typeof s.toString)return hashString(s.toString());throw new Error("Value type "+i+" cannot be hashed.")}function cachedHashString(s){var i=ze[s];return void 0===i&&(i=hashString(s),$e===qe&&($e=0,ze={}),$e++,ze[s]=i),i}function hashString(s){for(var i=0,u=0;u0)switch(s.nodeType){case 1:return s.uniqueID;case 9:return s.documentElement&&s.documentElement.uniqueID}}var Se,xe="function"==typeof WeakMap;xe&&(Se=new WeakMap);var Pe=0,Te="__immutablehash__";"function"==typeof Symbol&&(Te=Symbol(Te));var Re=16,qe=255,$e=0,ze={};function assertNotInfinite(s){invariant(s!==1/0,"Cannot perform this action with an infinite size.")}function Map(s){return null==s?emptyMap():isMap(s)&&!isOrdered(s)?s:emptyMap().withMutations((function(i){var u=KeyedIterable(s);assertNotInfinite(u.size),u.forEach((function(s,u){return i.set(u,s)}))}))}function isMap(s){return!(!s||!s[He])}createClass(Map,KeyedCollection),Map.of=function(){var i=s.call(arguments,0);return emptyMap().withMutations((function(s){for(var u=0;u=i.length)throw new Error("Missing value for key: "+i[u]);s.set(i[u],i[u+1])}}))},Map.prototype.toString=function(){return this.__toString("Map {","}")},Map.prototype.get=function(s,i){return this._root?this._root.get(0,void 0,s,i):i},Map.prototype.set=function(s,i){return updateMap(this,s,i)},Map.prototype.setIn=function(s,i){return this.updateIn(s,$,(function(){return i}))},Map.prototype.remove=function(s){return updateMap(this,s,$)},Map.prototype.deleteIn=function(s){return this.updateIn(s,(function(){return $}))},Map.prototype.update=function(s,i,u){return 1===arguments.length?s(this):this.updateIn([s],i,u)},Map.prototype.updateIn=function(s,i,u){u||(u=i,i=void 0);var _=updateInDeepMap(this,forceIterator(s),i,u);return _===$?void 0:_},Map.prototype.clear=function(){return 0===this.size?this:this.__ownerID?(this.size=0,this._root=null,this.__hash=void 0,this.__altered=!0,this):emptyMap()},Map.prototype.merge=function(){return mergeIntoMapWith(this,void 0,arguments)},Map.prototype.mergeWith=function(i){return mergeIntoMapWith(this,i,s.call(arguments,1))},Map.prototype.mergeIn=function(i){var u=s.call(arguments,1);return this.updateIn(i,emptyMap(),(function(s){return"function"==typeof s.merge?s.merge.apply(s,u):u[u.length-1]}))},Map.prototype.mergeDeep=function(){return mergeIntoMapWith(this,deepMerger,arguments)},Map.prototype.mergeDeepWith=function(i){var u=s.call(arguments,1);return mergeIntoMapWith(this,deepMergerWith(i),u)},Map.prototype.mergeDeepIn=function(i){var u=s.call(arguments,1);return this.updateIn(i,emptyMap(),(function(s){return"function"==typeof s.mergeDeep?s.mergeDeep.apply(s,u):u[u.length-1]}))},Map.prototype.sort=function(s){return OrderedMap(sortFactory(this,s))},Map.prototype.sortBy=function(s,i){return OrderedMap(sortFactory(this,i,s))},Map.prototype.withMutations=function(s){var i=this.asMutable();return s(i),i.wasAltered()?i.__ensureOwner(this.__ownerID):this},Map.prototype.asMutable=function(){return this.__ownerID?this:this.__ensureOwner(new OwnerID)},Map.prototype.asImmutable=function(){return this.__ensureOwner()},Map.prototype.wasAltered=function(){return this.__altered},Map.prototype.__iterator=function(s,i){return new MapIterator(this,s,i)},Map.prototype.__iterate=function(s,i){var u=this,_=0;return this._root&&this._root.iterate((function(i){return _++,s(i[1],i[0],u)}),i),_},Map.prototype.__ensureOwner=function(s){return s===this.__ownerID?this:s?makeMap(this.size,this._root,s,this.__hash):(this.__ownerID=s,this.__altered=!1,this)},Map.isMap=isMap;var We,He="@@__IMMUTABLE_MAP__@@",Ye=Map.prototype;function ArrayMapNode(s,i){this.ownerID=s,this.entries=i}function BitmapIndexedNode(s,i,u){this.ownerID=s,this.bitmap=i,this.nodes=u}function HashArrayMapNode(s,i,u){this.ownerID=s,this.count=i,this.nodes=u}function HashCollisionNode(s,i,u){this.ownerID=s,this.keyHash=i,this.entries=u}function ValueNode(s,i,u){this.ownerID=s,this.keyHash=i,this.entry=u}function MapIterator(s,i,u){this._type=i,this._reverse=u,this._stack=s._root&&mapIteratorFrame(s._root)}function mapIteratorValue(s,i){return iteratorValue(s,i[0],i[1])}function mapIteratorFrame(s,i){return{node:s,index:0,__prev:i}}function makeMap(s,i,u,_){var w=Object.create(Ye);return w.size=s,w._root=i,w.__ownerID=u,w.__hash=_,w.__altered=!1,w}function emptyMap(){return We||(We=makeMap(0))}function updateMap(s,i,u){var _,w;if(s._root){var x=MakeRef(U),j=MakeRef(Y);if(_=updateNode(s._root,s.__ownerID,0,void 0,i,u,x,j),!j.value)return s;w=s.size+(x.value?u===$?-1:1:0)}else{if(u===$)return s;w=1,_=new ArrayMapNode(s.__ownerID,[[i,u]])}return s.__ownerID?(s.size=w,s._root=_,s.__hash=void 0,s.__altered=!0,s):_?makeMap(w,_):emptyMap()}function updateNode(s,i,u,_,w,x,j,L){return s?s.update(i,u,_,w,x,j,L):x===$?s:(SetRef(L),SetRef(j),new ValueNode(i,_,[w,x]))}function isLeafNode(s){return s.constructor===ValueNode||s.constructor===HashCollisionNode}function mergeIntoNode(s,i,u,_,w){if(s.keyHash===_)return new HashCollisionNode(i,_,[s.entry,w]);var x,L=(0===u?s.keyHash:s.keyHash>>>u)&B,$=(0===u?_:_>>>u)&B;return new BitmapIndexedNode(i,1<>>=1)j[B]=1&u?i[x++]:void 0;return j[_]=w,new HashArrayMapNode(s,x+1,j)}function mergeIntoMapWith(s,i,u){for(var _=[],w=0;w>1&1431655765))+(s>>2&858993459))+(s>>4)&252645135,s+=s>>8,127&(s+=s>>16)}function setIn(s,i,u,_){var w=_?s:arrCopy(s);return w[i]=u,w}function spliceIn(s,i,u,_){var w=s.length+1;if(_&&i+1===w)return s[i]=u,s;for(var x=new Array(w),j=0,L=0;L=Xe)return createNodes(s,B,_,w);var ee=s&&s===this.ownerID,ie=ee?B:arrCopy(B);return Z?L?U===Y-1?ie.pop():ie[U]=ie.pop():ie[U]=[_,w]:ie.push([_,w]),ee?(this.entries=ie,this):new ArrayMapNode(s,ie)}},BitmapIndexedNode.prototype.get=function(s,i,u,_){void 0===i&&(i=hash(u));var w=1<<((0===s?i:i>>>s)&B),x=this.bitmap;return 0==(x&w)?_:this.nodes[popCount(x&w-1)].get(s+j,i,u,_)},BitmapIndexedNode.prototype.update=function(s,i,u,_,w,x,L){void 0===u&&(u=hash(_));var U=(0===i?u:u>>>i)&B,Y=1<=Qe)return expandNodes(s,ae,Z,U,ce);if(ee&&!ce&&2===ae.length&&isLeafNode(ae[1^ie]))return ae[1^ie];if(ee&&ce&&1===ae.length&&isLeafNode(ce))return ce;var pe=s&&s===this.ownerID,de=ee?ce?Z:Z^Y:Z|Y,fe=ee?ce?setIn(ae,ie,ce,pe):spliceOut(ae,ie,pe):spliceIn(ae,ie,ce,pe);return pe?(this.bitmap=de,this.nodes=fe,this):new BitmapIndexedNode(s,de,fe)},HashArrayMapNode.prototype.get=function(s,i,u,_){void 0===i&&(i=hash(u));var w=(0===s?i:i>>>s)&B,x=this.nodes[w];return x?x.get(s+j,i,u,_):_},HashArrayMapNode.prototype.update=function(s,i,u,_,w,x,L){void 0===u&&(u=hash(_));var U=(0===i?u:u>>>i)&B,Y=w===$,Z=this.nodes,ee=Z[U];if(Y&&!ee)return this;var ie=updateNode(ee,s,i+j,u,_,w,x,L);if(ie===ee)return this;var ae=this.count;if(ee){if(!ie&&--ae0&&_=0&&s>>i&B;if(_>=this.array.length)return new VNode([],s);var w,x=0===_;if(i>0){var L=this.array[_];if((w=L&&L.removeBefore(s,i-j,u))===L&&x)return this}if(x&&!w)return this;var $=editableVNode(this,s);if(!x)for(var U=0;U<_;U++)$.array[U]=void 0;return w&&($.array[_]=w),$},VNode.prototype.removeAfter=function(s,i,u){if(u===(i?1<>>i&B;if(w>=this.array.length)return this;if(i>0){var x=this.array[w];if((_=x&&x.removeAfter(s,i-j,u))===x&&w===this.array.length-1)return this}var L=editableVNode(this,s);return L.array.splice(w+1),_&&(L.array[w]=_),L};var nt,ot,st={};function iterateList(s,i){var u=s._origin,_=s._capacity,w=getTailOffset(_),x=s._tail;return iterateNodeOrLeaf(s._root,s._level,0);function iterateNodeOrLeaf(s,i,u){return 0===i?iterateLeaf(s,u):iterateNode(s,i,u)}function iterateLeaf(s,j){var B=j===w?x&&x.array:s&&s.array,$=j>u?0:u-j,U=_-j;return U>L&&(U=L),function(){if($===U)return st;var s=i?--U:$++;return B&&B[s]}}function iterateNode(s,w,x){var B,$=s&&s.array,U=x>u?0:u-x>>w,Y=1+(_-x>>w);return Y>L&&(Y=L),function(){for(;;){if(B){var s=B();if(s!==st)return s;B=null}if(U===Y)return st;var u=i?--Y:U++;B=iterateNodeOrLeaf($&&$[u],w-j,x+(u<=s.size||i<0)return s.withMutations((function(s){i<0?setListBounds(s,i).set(0,u):setListBounds(s,0,i+1).set(i,u)}));i+=s._origin;var _=s._tail,w=s._root,x=MakeRef(Y);return i>=getTailOffset(s._capacity)?_=updateVNode(_,s.__ownerID,0,i,u,x):w=updateVNode(w,s.__ownerID,s._level,i,u,x),x.value?s.__ownerID?(s._root=w,s._tail=_,s.__hash=void 0,s.__altered=!0,s):makeList(s._origin,s._capacity,s._level,w,_):s}function updateVNode(s,i,u,_,w,x){var L,$=_>>>u&B,U=s&&$0){var Y=s&&s.array[$],Z=updateVNode(Y,i,u-j,_,w,x);return Z===Y?s:((L=editableVNode(s,i)).array[$]=Z,L)}return U&&s.array[$]===w?s:(SetRef(x),L=editableVNode(s,i),void 0===w&&$===L.array.length-1?L.array.pop():L.array[$]=w,L)}function editableVNode(s,i){return i&&s&&i===s.ownerID?s:new VNode(s?s.array.slice():[],i)}function listNodeFor(s,i){if(i>=getTailOffset(s._capacity))return s._tail;if(i<1<0;)u=u.array[i>>>_&B],_-=j;return u}}function setListBounds(s,i,u){void 0!==i&&(i|=0),void 0!==u&&(u|=0);var _=s.__ownerID||new OwnerID,w=s._origin,x=s._capacity,L=w+i,$=void 0===u?x:u<0?x+u:w+u;if(L===w&&$===x)return s;if(L>=$)return s.clear();for(var U=s._level,Y=s._root,Z=0;L+Z<0;)Y=new VNode(Y&&Y.array.length?[void 0,Y]:[],_),Z+=1<<(U+=j);Z&&(L+=Z,w+=Z,$+=Z,x+=Z);for(var ee=getTailOffset(x),ie=getTailOffset($);ie>=1<ee?new VNode([],_):ae;if(ae&&ie>ee&&Lj;pe-=j){var de=ee>>>pe&B;ce=ce.array[de]=editableVNode(ce.array[de],_)}ce.array[ee>>>j&B]=ae}if($=ie)L-=ie,$-=ie,U=j,Y=null,le=le&&le.removeBefore(_,0,L);else if(L>w||ie>>U&B;if(fe!==ie>>>U&B)break;fe&&(Z+=(1<w&&(Y=Y.removeBefore(_,U,L-Z)),Y&&iew&&(w=L.size),isIterable(j)||(L=L.map((function(s){return fromJS(s)}))),_.push(L)}return w>s.size&&(s=s.setSize(w)),mergeIntoCollectionWith(s,i,_)}function getTailOffset(s){return s>>j<=L&&j.size>=2*x.size?(_=(w=j.filter((function(s,i){return void 0!==s&&B!==i}))).toKeyedSeq().map((function(s){return s[0]})).flip().toMap(),s.__ownerID&&(_.__ownerID=w.__ownerID=s.__ownerID)):(_=x.remove(i),w=B===j.size-1?j.pop():j.set(B,void 0))}else if(U){if(u===j.get(B)[1])return s;_=x,w=j.set(B,[i,u])}else _=x.set(i,j.size),w=j.set(j.size,[i,u]);return s.__ownerID?(s.size=_.size,s._map=_,s._list=w,s.__hash=void 0,s):makeOrderedMap(_,w)}function ToKeyedSequence(s,i){this._iter=s,this._useKeys=i,this.size=s.size}function ToIndexedSequence(s){this._iter=s,this.size=s.size}function ToSetSequence(s){this._iter=s,this.size=s.size}function FromEntriesSequence(s){this._iter=s,this.size=s.size}function flipFactory(s){var i=makeSequence(s);return i._iter=s,i.size=s.size,i.flip=function(){return s},i.reverse=function(){var i=s.reverse.apply(this);return i.flip=function(){return s.reverse()},i},i.has=function(i){return s.includes(i)},i.includes=function(i){return s.has(i)},i.cacheResult=cacheResultThrough,i.__iterateUncached=function(i,u){var _=this;return s.__iterate((function(s,u){return!1!==i(u,s,_)}),u)},i.__iteratorUncached=function(i,u){if(i===ie){var _=s.__iterator(i,u);return new Iterator((function(){var s=_.next();if(!s.done){var i=s.value[0];s.value[0]=s.value[1],s.value[1]=i}return s}))}return s.__iterator(i===ee?Z:ee,u)},i}function mapFactory(s,i,u){var _=makeSequence(s);return _.size=s.size,_.has=function(i){return s.has(i)},_.get=function(_,w){var x=s.get(_,$);return x===$?w:i.call(u,x,_,s)},_.__iterateUncached=function(_,w){var x=this;return s.__iterate((function(s,w,j){return!1!==_(i.call(u,s,w,j),w,x)}),w)},_.__iteratorUncached=function(_,w){var x=s.__iterator(ie,w);return new Iterator((function(){var w=x.next();if(w.done)return w;var j=w.value,L=j[0];return iteratorValue(_,L,i.call(u,j[1],L,s),w)}))},_}function reverseFactory(s,i){var u=makeSequence(s);return u._iter=s,u.size=s.size,u.reverse=function(){return s},s.flip&&(u.flip=function(){var i=flipFactory(s);return i.reverse=function(){return s.flip()},i}),u.get=function(u,_){return s.get(i?u:-1-u,_)},u.has=function(u){return s.has(i?u:-1-u)},u.includes=function(i){return s.includes(i)},u.cacheResult=cacheResultThrough,u.__iterate=function(i,u){var _=this;return s.__iterate((function(s,u){return i(s,u,_)}),!u)},u.__iterator=function(i,u){return s.__iterator(i,!u)},u}function filterFactory(s,i,u,_){var w=makeSequence(s);return _&&(w.has=function(_){var w=s.get(_,$);return w!==$&&!!i.call(u,w,_,s)},w.get=function(_,w){var x=s.get(_,$);return x!==$&&i.call(u,x,_,s)?x:w}),w.__iterateUncached=function(w,x){var j=this,L=0;return s.__iterate((function(s,x,B){if(i.call(u,s,x,B))return L++,w(s,_?x:L-1,j)}),x),L},w.__iteratorUncached=function(w,x){var j=s.__iterator(ie,x),L=0;return new Iterator((function(){for(;;){var x=j.next();if(x.done)return x;var B=x.value,$=B[0],U=B[1];if(i.call(u,U,$,s))return iteratorValue(w,_?$:L++,U,x)}}))},w}function countByFactory(s,i,u){var _=Map().asMutable();return s.__iterate((function(w,x){_.update(i.call(u,w,x,s),0,(function(s){return s+1}))})),_.asImmutable()}function groupByFactory(s,i,u){var _=isKeyed(s),w=(isOrdered(s)?OrderedMap():Map()).asMutable();s.__iterate((function(x,j){w.update(i.call(u,x,j,s),(function(s){return(s=s||[]).push(_?[j,x]:x),s}))}));var x=iterableClass(s);return w.map((function(i){return reify(s,x(i))}))}function sliceFactory(s,i,u,_){var w=s.size;if(void 0!==i&&(i|=0),void 0!==u&&(u===1/0?u=w:u|=0),wholeSlice(i,u,w))return s;var x=resolveBegin(i,w),j=resolveEnd(u,w);if(x!=x||j!=j)return sliceFactory(s.toSeq().cacheResult(),i,u,_);var L,B=j-x;B==B&&(L=B<0?0:B);var $=makeSequence(s);return $.size=0===L?L:s.size&&L||void 0,!_&&isSeq(s)&&L>=0&&($.get=function(i,u){return(i=wrapIndex(this,i))>=0&&iL)return iteratorDone();var s=w.next();return _||i===ee?s:iteratorValue(i,B-1,i===Z?void 0:s.value[1],s)}))},$}function takeWhileFactory(s,i,u){var _=makeSequence(s);return _.__iterateUncached=function(_,w){var x=this;if(w)return this.cacheResult().__iterate(_,w);var j=0;return s.__iterate((function(s,w,L){return i.call(u,s,w,L)&&++j&&_(s,w,x)})),j},_.__iteratorUncached=function(_,w){var x=this;if(w)return this.cacheResult().__iterator(_,w);var j=s.__iterator(ie,w),L=!0;return new Iterator((function(){if(!L)return iteratorDone();var s=j.next();if(s.done)return s;var w=s.value,B=w[0],$=w[1];return i.call(u,$,B,x)?_===ie?s:iteratorValue(_,B,$,s):(L=!1,iteratorDone())}))},_}function skipWhileFactory(s,i,u,_){var w=makeSequence(s);return w.__iterateUncached=function(w,x){var j=this;if(x)return this.cacheResult().__iterate(w,x);var L=!0,B=0;return s.__iterate((function(s,x,$){if(!L||!(L=i.call(u,s,x,$)))return B++,w(s,_?x:B-1,j)})),B},w.__iteratorUncached=function(w,x){var j=this;if(x)return this.cacheResult().__iterator(w,x);var L=s.__iterator(ie,x),B=!0,$=0;return new Iterator((function(){var s,x,U;do{if((s=L.next()).done)return _||w===ee?s:iteratorValue(w,$++,w===Z?void 0:s.value[1],s);var Y=s.value;x=Y[0],U=Y[1],B&&(B=i.call(u,U,x,j))}while(B);return w===ie?s:iteratorValue(w,x,U,s)}))},w}function concatFactory(s,i){var u=isKeyed(s),_=[s].concat(i).map((function(s){return isIterable(s)?u&&(s=KeyedIterable(s)):s=u?keyedSeqFromValue(s):indexedSeqFromValue(Array.isArray(s)?s:[s]),s})).filter((function(s){return 0!==s.size}));if(0===_.length)return s;if(1===_.length){var w=_[0];if(w===s||u&&isKeyed(w)||isIndexed(s)&&isIndexed(w))return w}var x=new ArraySeq(_);return u?x=x.toKeyedSeq():isIndexed(s)||(x=x.toSetSeq()),(x=x.flatten(!0)).size=_.reduce((function(s,i){if(void 0!==s){var u=i.size;if(void 0!==u)return s+u}}),0),x}function flattenFactory(s,i,u){var _=makeSequence(s);return _.__iterateUncached=function(_,w){var x=0,j=!1;function flatDeep(s,L){var B=this;s.__iterate((function(s,w){return(!i||L0}function zipWithFactory(s,i,u){var _=makeSequence(s);return _.size=new ArraySeq(u).map((function(s){return s.size})).min(),_.__iterate=function(s,i){for(var u,_=this.__iterator(ee,i),w=0;!(u=_.next()).done&&!1!==s(u.value,w++,this););return w},_.__iteratorUncached=function(s,_){var w=u.map((function(s){return s=Iterable(s),getIterator(_?s.reverse():s)})),x=0,j=!1;return new Iterator((function(){var u;return j||(u=w.map((function(s){return s.next()})),j=u.some((function(s){return s.done}))),j?iteratorDone():iteratorValue(s,x++,i.apply(null,u.map((function(s){return s.value}))))}))},_}function reify(s,i){return isSeq(s)?i:s.constructor(i)}function validateEntry(s){if(s!==Object(s))throw new TypeError("Expected [K, V] tuple: "+s)}function resolveSize(s){return assertNotInfinite(s.size),ensureSize(s)}function iterableClass(s){return isKeyed(s)?KeyedIterable:isIndexed(s)?IndexedIterable:SetIterable}function makeSequence(s){return Object.create((isKeyed(s)?KeyedSeq:isIndexed(s)?IndexedSeq:SetSeq).prototype)}function cacheResultThrough(){return this._iter.cacheResult?(this._iter.cacheResult(),this.size=this._iter.size,this):Seq.prototype.cacheResult.call(this)}function defaultComparator(s,i){return s>i?1:s=0;u--)i={value:arguments[u],next:i};return this.__ownerID?(this.size=s,this._head=i,this.__hash=void 0,this.__altered=!0,this):makeStack(s,i)},Stack.prototype.pushAll=function(s){if(0===(s=IndexedIterable(s)).size)return this;assertNotInfinite(s.size);var i=this.size,u=this._head;return s.reverse().forEach((function(s){i++,u={value:s,next:u}})),this.__ownerID?(this.size=i,this._head=u,this.__hash=void 0,this.__altered=!0,this):makeStack(i,u)},Stack.prototype.pop=function(){return this.slice(1)},Stack.prototype.unshift=function(){return this.push.apply(this,arguments)},Stack.prototype.unshiftAll=function(s){return this.pushAll(s)},Stack.prototype.shift=function(){return this.pop.apply(this,arguments)},Stack.prototype.clear=function(){return 0===this.size?this:this.__ownerID?(this.size=0,this._head=void 0,this.__hash=void 0,this.__altered=!0,this):emptyStack()},Stack.prototype.slice=function(s,i){if(wholeSlice(s,i,this.size))return this;var u=resolveBegin(s,this.size);if(resolveEnd(i,this.size)!==this.size)return IndexedCollection.prototype.slice.call(this,s,i);for(var _=this.size-u,w=this._head;u--;)w=w.next;return this.__ownerID?(this.size=_,this._head=w,this.__hash=void 0,this.__altered=!0,this):makeStack(_,w)},Stack.prototype.__ensureOwner=function(s){return s===this.__ownerID?this:s?makeStack(this.size,this._head,s,this.__hash):(this.__ownerID=s,this.__altered=!1,this)},Stack.prototype.__iterate=function(s,i){if(i)return this.reverse().__iterate(s);for(var u=0,_=this._head;_&&!1!==s(_.value,u++,this);)_=_.next;return u},Stack.prototype.__iterator=function(s,i){if(i)return this.reverse().__iterator(s);var u=0,_=this._head;return new Iterator((function(){if(_){var i=_.value;return _=_.next,iteratorValue(s,u++,i)}return iteratorDone()}))},Stack.isStack=isStack;var ht,dt="@@__IMMUTABLE_STACK__@@",mt=Stack.prototype;function makeStack(s,i,u,_){var w=Object.create(mt);return w.size=s,w._head=i,w.__ownerID=u,w.__hash=_,w.__altered=!1,w}function emptyStack(){return ht||(ht=makeStack(0))}function mixin(s,i){var keyCopier=function(u){s.prototype[u]=i[u]};return Object.keys(i).forEach(keyCopier),Object.getOwnPropertySymbols&&Object.getOwnPropertySymbols(i).forEach(keyCopier),s}mt[dt]=!0,mt.withMutations=Ye.withMutations,mt.asMutable=Ye.asMutable,mt.asImmutable=Ye.asImmutable,mt.wasAltered=Ye.wasAltered,Iterable.Iterator=Iterator,mixin(Iterable,{toArray:function(){assertNotInfinite(this.size);var s=new Array(this.size||0);return this.valueSeq().__iterate((function(i,u){s[u]=i})),s},toIndexedSeq:function(){return new ToIndexedSequence(this)},toJS:function(){return this.toSeq().map((function(s){return s&&"function"==typeof s.toJS?s.toJS():s})).__toJS()},toJSON:function(){return this.toSeq().map((function(s){return s&&"function"==typeof s.toJSON?s.toJSON():s})).__toJS()},toKeyedSeq:function(){return new ToKeyedSequence(this,!0)},toMap:function(){return Map(this.toKeyedSeq())},toObject:function(){assertNotInfinite(this.size);var s={};return this.__iterate((function(i,u){s[u]=i})),s},toOrderedMap:function(){return OrderedMap(this.toKeyedSeq())},toOrderedSet:function(){return OrderedSet(isKeyed(this)?this.valueSeq():this)},toSet:function(){return Set(isKeyed(this)?this.valueSeq():this)},toSetSeq:function(){return new ToSetSequence(this)},toSeq:function(){return isIndexed(this)?this.toIndexedSeq():isKeyed(this)?this.toKeyedSeq():this.toSetSeq()},toStack:function(){return Stack(isKeyed(this)?this.valueSeq():this)},toList:function(){return List(isKeyed(this)?this.valueSeq():this)},toString:function(){return"[Iterable]"},__toString:function(s,i){return 0===this.size?s+i:s+" "+this.toSeq().map(this.__toStringMapper).join(", ")+" "+i},concat:function(){return reify(this,concatFactory(this,s.call(arguments,0)))},includes:function(s){return this.some((function(i){return is(i,s)}))},entries:function(){return this.__iterator(ie)},every:function(s,i){assertNotInfinite(this.size);var u=!0;return this.__iterate((function(_,w,x){if(!s.call(i,_,w,x))return u=!1,!1})),u},filter:function(s,i){return reify(this,filterFactory(this,s,i,!0))},find:function(s,i,u){var _=this.findEntry(s,i);return _?_[1]:u},forEach:function(s,i){return assertNotInfinite(this.size),this.__iterate(i?s.bind(i):s)},join:function(s){assertNotInfinite(this.size),s=void 0!==s?""+s:",";var i="",u=!0;return this.__iterate((function(_){u?u=!1:i+=s,i+=null!=_?_.toString():""})),i},keys:function(){return this.__iterator(Z)},map:function(s,i){return reify(this,mapFactory(this,s,i))},reduce:function(s,i,u){var _,w;return assertNotInfinite(this.size),arguments.length<2?w=!0:_=i,this.__iterate((function(i,x,j){w?(w=!1,_=i):_=s.call(u,_,i,x,j)})),_},reduceRight:function(s,i,u){var _=this.toKeyedSeq().reverse();return _.reduce.apply(_,arguments)},reverse:function(){return reify(this,reverseFactory(this,!0))},slice:function(s,i){return reify(this,sliceFactory(this,s,i,!0))},some:function(s,i){return!this.every(not(s),i)},sort:function(s){return reify(this,sortFactory(this,s))},values:function(){return this.__iterator(ee)},butLast:function(){return this.slice(0,-1)},isEmpty:function(){return void 0!==this.size?0===this.size:!this.some((function(){return!0}))},count:function(s,i){return ensureSize(s?this.toSeq().filter(s,i):this)},countBy:function(s,i){return countByFactory(this,s,i)},equals:function(s){return deepEqual(this,s)},entrySeq:function(){var s=this;if(s._cache)return new ArraySeq(s._cache);var i=s.toSeq().map(entryMapper).toIndexedSeq();return i.fromEntrySeq=function(){return s.toSeq()},i},filterNot:function(s,i){return this.filter(not(s),i)},findEntry:function(s,i,u){var _=u;return this.__iterate((function(u,w,x){if(s.call(i,u,w,x))return _=[w,u],!1})),_},findKey:function(s,i){var u=this.findEntry(s,i);return u&&u[0]},findLast:function(s,i,u){return this.toKeyedSeq().reverse().find(s,i,u)},findLastEntry:function(s,i,u){return this.toKeyedSeq().reverse().findEntry(s,i,u)},findLastKey:function(s,i){return this.toKeyedSeq().reverse().findKey(s,i)},first:function(){return this.find(returnTrue)},flatMap:function(s,i){return reify(this,flatMapFactory(this,s,i))},flatten:function(s){return reify(this,flattenFactory(this,s,!0))},fromEntrySeq:function(){return new FromEntriesSequence(this)},get:function(s,i){return this.find((function(i,u){return is(u,s)}),void 0,i)},getIn:function(s,i){for(var u,_=this,w=forceIterator(s);!(u=w.next()).done;){var x=u.value;if((_=_&&_.get?_.get(x,$):$)===$)return i}return _},groupBy:function(s,i){return groupByFactory(this,s,i)},has:function(s){return this.get(s,$)!==$},hasIn:function(s){return this.getIn(s,$)!==$},isSubset:function(s){return s="function"==typeof s.includes?s:Iterable(s),this.every((function(i){return s.includes(i)}))},isSuperset:function(s){return(s="function"==typeof s.isSubset?s:Iterable(s)).isSubset(this)},keyOf:function(s){return this.findKey((function(i){return is(i,s)}))},keySeq:function(){return this.toSeq().map(keyMapper).toIndexedSeq()},last:function(){return this.toSeq().reverse().first()},lastKeyOf:function(s){return this.toKeyedSeq().reverse().keyOf(s)},max:function(s){return maxFactory(this,s)},maxBy:function(s,i){return maxFactory(this,i,s)},min:function(s){return maxFactory(this,s?neg(s):defaultNegComparator)},minBy:function(s,i){return maxFactory(this,i?neg(i):defaultNegComparator,s)},rest:function(){return this.slice(1)},skip:function(s){return this.slice(Math.max(0,s))},skipLast:function(s){return reify(this,this.toSeq().reverse().skip(s).reverse())},skipWhile:function(s,i){return reify(this,skipWhileFactory(this,s,i,!0))},skipUntil:function(s,i){return this.skipWhile(not(s),i)},sortBy:function(s,i){return reify(this,sortFactory(this,i,s))},take:function(s){return this.slice(0,Math.max(0,s))},takeLast:function(s){return reify(this,this.toSeq().reverse().take(s).reverse())},takeWhile:function(s,i){return reify(this,takeWhileFactory(this,s,i))},takeUntil:function(s,i){return this.takeWhile(not(s),i)},valueSeq:function(){return this.toIndexedSeq()},hashCode:function(){return this.__hash||(this.__hash=hashIterable(this))}});var gt=Iterable.prototype;gt[i]=!0,gt[ce]=gt.values,gt.__toJS=gt.toArray,gt.__toStringMapper=quoteString,gt.inspect=gt.toSource=function(){return this.toString()},gt.chain=gt.flatMap,gt.contains=gt.includes,mixin(KeyedIterable,{flip:function(){return reify(this,flipFactory(this))},mapEntries:function(s,i){var u=this,_=0;return reify(this,this.toSeq().map((function(w,x){return s.call(i,[x,w],_++,u)})).fromEntrySeq())},mapKeys:function(s,i){var u=this;return reify(this,this.toSeq().flip().map((function(_,w){return s.call(i,_,w,u)})).flip())}});var yt=KeyedIterable.prototype;function keyMapper(s,i){return i}function entryMapper(s,i){return[i,s]}function not(s){return function(){return!s.apply(this,arguments)}}function neg(s){return function(){return-s.apply(this,arguments)}}function quoteString(s){return"string"==typeof s?JSON.stringify(s):String(s)}function defaultZipper(){return arrCopy(arguments)}function defaultNegComparator(s,i){return si?-1:0}function hashIterable(s){if(s.size===1/0)return 0;var i=isOrdered(s),u=isKeyed(s),_=i?1:0;return murmurHashOfSize(s.__iterate(u?i?function(s,i){_=31*_+hashMerge(hash(s),hash(i))|0}:function(s,i){_=_+hashMerge(hash(s),hash(i))|0}:i?function(s){_=31*_+hash(s)|0}:function(s){_=_+hash(s)|0}),_)}function murmurHashOfSize(s,i){return i=be(i,3432918353),i=be(i<<15|i>>>-15,461845907),i=be(i<<13|i>>>-13,5),i=be((i=(i+3864292196|0)^s)^i>>>16,2246822507),i=smi((i=be(i^i>>>13,3266489909))^i>>>16)}function hashMerge(s,i){return s^i+2654435769+(s<<6)+(s>>2)|0}return yt[u]=!0,yt[ce]=gt.entries,yt.__toJS=gt.toObject,yt.__toStringMapper=function(s,i){return JSON.stringify(i)+": "+quoteString(s)},mixin(IndexedIterable,{toKeyedSeq:function(){return new ToKeyedSequence(this,!1)},filter:function(s,i){return reify(this,filterFactory(this,s,i,!1))},findIndex:function(s,i){var u=this.findEntry(s,i);return u?u[0]:-1},indexOf:function(s){var i=this.keyOf(s);return void 0===i?-1:i},lastIndexOf:function(s){var i=this.lastKeyOf(s);return void 0===i?-1:i},reverse:function(){return reify(this,reverseFactory(this,!1))},slice:function(s,i){return reify(this,sliceFactory(this,s,i,!1))},splice:function(s,i){var u=arguments.length;if(i=Math.max(0|i,0),0===u||2===u&&!i)return this;s=resolveBegin(s,s<0?this.count():this.size);var _=this.slice(0,s);return reify(this,1===u?_:_.concat(arrCopy(arguments,2),this.slice(s+i)))},findLastIndex:function(s,i){var u=this.findLastEntry(s,i);return u?u[0]:-1},first:function(){return this.get(0)},flatten:function(s){return reify(this,flattenFactory(this,s,!1))},get:function(s,i){return(s=wrapIndex(this,s))<0||this.size===1/0||void 0!==this.size&&s>this.size?i:this.find((function(i,u){return u===s}),void 0,i)},has:function(s){return(s=wrapIndex(this,s))>=0&&(void 0!==this.size?this.size===1/0||s{"function"==typeof Object.create?s.exports=function inherits(s,i){i&&(s.super_=i,s.prototype=Object.create(i.prototype,{constructor:{value:s,enumerable:!1,writable:!0,configurable:!0}}))}:s.exports=function inherits(s,i){if(i){s.super_=i;var TempCtor=function(){};TempCtor.prototype=i.prototype,s.prototype=new TempCtor,s.prototype.constructor=s}}},5419:s=>{s.exports=function(s,i,u,_){var w=new Blob(void 0!==_?[_,s]:[s],{type:u||"application/octet-stream"});if(void 0!==window.navigator.msSaveBlob)window.navigator.msSaveBlob(w,i);else{var x=window.URL&&window.URL.createObjectURL?window.URL.createObjectURL(w):window.webkitURL.createObjectURL(w),j=document.createElement("a");j.style.display="none",j.href=x,j.setAttribute("download",i),void 0===j.download&&j.setAttribute("target","_blank"),document.body.appendChild(j),j.click(),setTimeout((function(){document.body.removeChild(j),window.URL.revokeObjectURL(x)}),200)}}},20181:(s,i,u)=>{var _=NaN,w="[object Symbol]",x=/^\s+|\s+$/g,j=/^[-+]0x[0-9a-f]+$/i,L=/^0b[01]+$/i,B=/^0o[0-7]+$/i,$=parseInt,U="object"==typeof u.g&&u.g&&u.g.Object===Object&&u.g,Y="object"==typeof self&&self&&self.Object===Object&&self,Z=U||Y||Function("return this")(),ee=Object.prototype.toString,ie=Math.max,ae=Math.min,now=function(){return Z.Date.now()};function isObject(s){var i=typeof s;return!!s&&("object"==i||"function"==i)}function toNumber(s){if("number"==typeof s)return s;if(function isSymbol(s){return"symbol"==typeof s||function isObjectLike(s){return!!s&&"object"==typeof s}(s)&&ee.call(s)==w}(s))return _;if(isObject(s)){var i="function"==typeof s.valueOf?s.valueOf():s;s=isObject(i)?i+"":i}if("string"!=typeof s)return 0===s?s:+s;s=s.replace(x,"");var u=L.test(s);return u||B.test(s)?$(s.slice(2),u?2:8):j.test(s)?_:+s}s.exports=function debounce(s,i,u){var _,w,x,j,L,B,$=0,U=!1,Y=!1,Z=!0;if("function"!=typeof s)throw new TypeError("Expected a function");function invokeFunc(i){var u=_,x=w;return _=w=void 0,$=i,j=s.apply(x,u)}function shouldInvoke(s){var u=s-B;return void 0===B||u>=i||u<0||Y&&s-$>=x}function timerExpired(){var s=now();if(shouldInvoke(s))return trailingEdge(s);L=setTimeout(timerExpired,function remainingWait(s){var u=i-(s-B);return Y?ae(u,x-(s-$)):u}(s))}function trailingEdge(s){return L=void 0,Z&&_?invokeFunc(s):(_=w=void 0,j)}function debounced(){var s=now(),u=shouldInvoke(s);if(_=arguments,w=this,B=s,u){if(void 0===L)return function leadingEdge(s){return $=s,L=setTimeout(timerExpired,i),U?invokeFunc(s):j}(B);if(Y)return L=setTimeout(timerExpired,i),invokeFunc(B)}return void 0===L&&(L=setTimeout(timerExpired,i)),j}return i=toNumber(i)||0,isObject(u)&&(U=!!u.leading,x=(Y="maxWait"in u)?ie(toNumber(u.maxWait)||0,i):x,Z="trailing"in u?!!u.trailing:Z),debounced.cancel=function cancel(){void 0!==L&&clearTimeout(L),$=0,_=B=w=L=void 0},debounced.flush=function flush(){return void 0===L?j:trailingEdge(now())},debounced}},55580:(s,i,u)=>{var _=u(56110)(u(9325),"DataView");s.exports=_},21549:(s,i,u)=>{var _=u(22032),w=u(63862),x=u(66721),j=u(12749),L=u(35749);function Hash(s){var i=-1,u=null==s?0:s.length;for(this.clear();++i{var _=u(39344),w=u(94033);function LazyWrapper(s){this.__wrapped__=s,this.__actions__=[],this.__dir__=1,this.__filtered__=!1,this.__iteratees__=[],this.__takeCount__=4294967295,this.__views__=[]}LazyWrapper.prototype=_(w.prototype),LazyWrapper.prototype.constructor=LazyWrapper,s.exports=LazyWrapper},80079:(s,i,u)=>{var _=u(63702),w=u(70080),x=u(24739),j=u(48655),L=u(31175);function ListCache(s){var i=-1,u=null==s?0:s.length;for(this.clear();++i{var _=u(39344),w=u(94033);function LodashWrapper(s,i){this.__wrapped__=s,this.__actions__=[],this.__chain__=!!i,this.__index__=0,this.__values__=void 0}LodashWrapper.prototype=_(w.prototype),LodashWrapper.prototype.constructor=LodashWrapper,s.exports=LodashWrapper},68223:(s,i,u)=>{var _=u(56110)(u(9325),"Map");s.exports=_},53661:(s,i,u)=>{var _=u(63040),w=u(17670),x=u(90289),j=u(4509),L=u(72949);function MapCache(s){var i=-1,u=null==s?0:s.length;for(this.clear();++i{var _=u(56110)(u(9325),"Promise");s.exports=_},76545:(s,i,u)=>{var _=u(56110)(u(9325),"Set");s.exports=_},38859:(s,i,u)=>{var _=u(53661),w=u(31380),x=u(51459);function SetCache(s){var i=-1,u=null==s?0:s.length;for(this.__data__=new _;++i{var _=u(80079),w=u(51420),x=u(90938),j=u(63605),L=u(29817),B=u(80945);function Stack(s){var i=this.__data__=new _(s);this.size=i.size}Stack.prototype.clear=w,Stack.prototype.delete=x,Stack.prototype.get=j,Stack.prototype.has=L,Stack.prototype.set=B,s.exports=Stack},51873:(s,i,u)=>{var _=u(9325).Symbol;s.exports=_},37828:(s,i,u)=>{var _=u(9325).Uint8Array;s.exports=_},28303:(s,i,u)=>{var _=u(56110)(u(9325),"WeakMap");s.exports=_},91033:s=>{s.exports=function apply(s,i,u){switch(u.length){case 0:return s.call(i);case 1:return s.call(i,u[0]);case 2:return s.call(i,u[0],u[1]);case 3:return s.call(i,u[0],u[1],u[2])}return s.apply(i,u)}},83729:s=>{s.exports=function arrayEach(s,i){for(var u=-1,_=null==s?0:s.length;++u<_&&!1!==i(s[u],u,s););return s}},79770:s=>{s.exports=function arrayFilter(s,i){for(var u=-1,_=null==s?0:s.length,w=0,x=[];++u<_;){var j=s[u];i(j,u,s)&&(x[w++]=j)}return x}},15325:(s,i,u)=>{var _=u(96131);s.exports=function arrayIncludes(s,i){return!!(null==s?0:s.length)&&_(s,i,0)>-1}},70695:(s,i,u)=>{var _=u(78096),w=u(72428),x=u(56449),j=u(3656),L=u(30361),B=u(37167),$=Object.prototype.hasOwnProperty;s.exports=function arrayLikeKeys(s,i){var u=x(s),U=!u&&w(s),Y=!u&&!U&&j(s),Z=!u&&!U&&!Y&&B(s),ee=u||U||Y||Z,ie=ee?_(s.length,String):[],ae=ie.length;for(var le in s)!i&&!$.call(s,le)||ee&&("length"==le||Y&&("offset"==le||"parent"==le)||Z&&("buffer"==le||"byteLength"==le||"byteOffset"==le)||L(le,ae))||ie.push(le);return ie}},34932:s=>{s.exports=function arrayMap(s,i){for(var u=-1,_=null==s?0:s.length,w=Array(_);++u<_;)w[u]=i(s[u],u,s);return w}},14528:s=>{s.exports=function arrayPush(s,i){for(var u=-1,_=i.length,w=s.length;++u<_;)s[w+u]=i[u];return s}},40882:s=>{s.exports=function arrayReduce(s,i,u,_){var w=-1,x=null==s?0:s.length;for(_&&x&&(u=s[++w]);++w{s.exports=function arraySome(s,i){for(var u=-1,_=null==s?0:s.length;++u<_;)if(i(s[u],u,s))return!0;return!1}},61074:s=>{s.exports=function asciiToArray(s){return s.split("")}},1733:s=>{var i=/[^\x00-\x2f\x3a-\x40\x5b-\x60\x7b-\x7f]+/g;s.exports=function asciiWords(s){return s.match(i)||[]}},87805:(s,i,u)=>{var _=u(43360),w=u(75288);s.exports=function assignMergeValue(s,i,u){(void 0!==u&&!w(s[i],u)||void 0===u&&!(i in s))&&_(s,i,u)}},16547:(s,i,u)=>{var _=u(43360),w=u(75288),x=Object.prototype.hasOwnProperty;s.exports=function assignValue(s,i,u){var j=s[i];x.call(s,i)&&w(j,u)&&(void 0!==u||i in s)||_(s,i,u)}},26025:(s,i,u)=>{var _=u(75288);s.exports=function assocIndexOf(s,i){for(var u=s.length;u--;)if(_(s[u][0],i))return u;return-1}},74733:(s,i,u)=>{var _=u(21791),w=u(95950);s.exports=function baseAssign(s,i){return s&&_(i,w(i),s)}},43838:(s,i,u)=>{var _=u(21791),w=u(37241);s.exports=function baseAssignIn(s,i){return s&&_(i,w(i),s)}},43360:(s,i,u)=>{var _=u(93243);s.exports=function baseAssignValue(s,i,u){"__proto__"==i&&_?_(s,i,{configurable:!0,enumerable:!0,value:u,writable:!0}):s[i]=u}},9999:(s,i,u)=>{var _=u(37217),w=u(83729),x=u(16547),j=u(74733),L=u(43838),B=u(93290),$=u(23007),U=u(92271),Y=u(48948),Z=u(50002),ee=u(83349),ie=u(5861),ae=u(76189),le=u(77199),ce=u(35529),pe=u(56449),de=u(3656),fe=u(87730),ye=u(23805),be=u(38440),_e=u(95950),we=u(37241),Se="[object Arguments]",xe="[object Function]",Pe="[object Object]",Te={};Te[Se]=Te["[object Array]"]=Te["[object ArrayBuffer]"]=Te["[object DataView]"]=Te["[object Boolean]"]=Te["[object Date]"]=Te["[object Float32Array]"]=Te["[object Float64Array]"]=Te["[object Int8Array]"]=Te["[object Int16Array]"]=Te["[object Int32Array]"]=Te["[object Map]"]=Te["[object Number]"]=Te[Pe]=Te["[object RegExp]"]=Te["[object Set]"]=Te["[object String]"]=Te["[object Symbol]"]=Te["[object Uint8Array]"]=Te["[object Uint8ClampedArray]"]=Te["[object Uint16Array]"]=Te["[object Uint32Array]"]=!0,Te["[object Error]"]=Te[xe]=Te["[object WeakMap]"]=!1,s.exports=function baseClone(s,i,u,Re,qe,$e){var ze,We=1&i,He=2&i,Ye=4&i;if(u&&(ze=qe?u(s,Re,qe,$e):u(s)),void 0!==ze)return ze;if(!ye(s))return s;var Xe=pe(s);if(Xe){if(ze=ae(s),!We)return $(s,ze)}else{var Qe=ie(s),et=Qe==xe||"[object GeneratorFunction]"==Qe;if(de(s))return B(s,We);if(Qe==Pe||Qe==Se||et&&!qe){if(ze=He||et?{}:ce(s),!We)return He?Y(s,L(ze,s)):U(s,j(ze,s))}else{if(!Te[Qe])return qe?s:{};ze=le(s,Qe,We)}}$e||($e=new _);var tt=$e.get(s);if(tt)return tt;$e.set(s,ze),be(s)?s.forEach((function(_){ze.add(baseClone(_,i,u,_,s,$e))})):fe(s)&&s.forEach((function(_,w){ze.set(w,baseClone(_,i,u,w,s,$e))}));var rt=Xe?void 0:(Ye?He?ee:Z:He?we:_e)(s);return w(rt||s,(function(_,w){rt&&(_=s[w=_]),x(ze,w,baseClone(_,i,u,w,s,$e))})),ze}},39344:(s,i,u)=>{var _=u(23805),w=Object.create,x=function(){function object(){}return function(s){if(!_(s))return{};if(w)return w(s);object.prototype=s;var i=new object;return object.prototype=void 0,i}}();s.exports=x},80909:(s,i,u)=>{var _=u(30641),w=u(38329)(_);s.exports=w},2523:s=>{s.exports=function baseFindIndex(s,i,u,_){for(var w=s.length,x=u+(_?1:-1);_?x--:++x{var _=u(14528),w=u(45891);s.exports=function baseFlatten(s,i,u,x,j){var L=-1,B=s.length;for(u||(u=w),j||(j=[]);++L0&&u($)?i>1?baseFlatten($,i-1,u,x,j):_(j,$):x||(j[j.length]=$)}return j}},86649:(s,i,u)=>{var _=u(83221)();s.exports=_},30641:(s,i,u)=>{var _=u(86649),w=u(95950);s.exports=function baseForOwn(s,i){return s&&_(s,i,w)}},47422:(s,i,u)=>{var _=u(31769),w=u(77797);s.exports=function baseGet(s,i){for(var u=0,x=(i=_(i,s)).length;null!=s&&u{var _=u(14528),w=u(56449);s.exports=function baseGetAllKeys(s,i,u){var x=i(s);return w(s)?x:_(x,u(s))}},72552:(s,i,u)=>{var _=u(51873),w=u(659),x=u(59350),j=_?_.toStringTag:void 0;s.exports=function baseGetTag(s){return null==s?void 0===s?"[object Undefined]":"[object Null]":j&&j in Object(s)?w(s):x(s)}},20426:s=>{var i=Object.prototype.hasOwnProperty;s.exports=function baseHas(s,u){return null!=s&&i.call(s,u)}},28077:s=>{s.exports=function baseHasIn(s,i){return null!=s&&i in Object(s)}},96131:(s,i,u)=>{var _=u(2523),w=u(85463),x=u(76959);s.exports=function baseIndexOf(s,i,u){return i==i?x(s,i,u):_(s,w,u)}},27534:(s,i,u)=>{var _=u(72552),w=u(40346);s.exports=function baseIsArguments(s){return w(s)&&"[object Arguments]"==_(s)}},60270:(s,i,u)=>{var _=u(87068),w=u(40346);s.exports=function baseIsEqual(s,i,u,x,j){return s===i||(null==s||null==i||!w(s)&&!w(i)?s!=s&&i!=i:_(s,i,u,x,baseIsEqual,j))}},87068:(s,i,u)=>{var _=u(37217),w=u(25911),x=u(21986),j=u(50689),L=u(5861),B=u(56449),$=u(3656),U=u(37167),Y="[object Arguments]",Z="[object Array]",ee="[object Object]",ie=Object.prototype.hasOwnProperty;s.exports=function baseIsEqualDeep(s,i,u,ae,le,ce){var pe=B(s),de=B(i),fe=pe?Z:L(s),ye=de?Z:L(i),be=(fe=fe==Y?ee:fe)==ee,_e=(ye=ye==Y?ee:ye)==ee,we=fe==ye;if(we&&$(s)){if(!$(i))return!1;pe=!0,be=!1}if(we&&!be)return ce||(ce=new _),pe||U(s)?w(s,i,u,ae,le,ce):x(s,i,fe,u,ae,le,ce);if(!(1&u)){var Se=be&&ie.call(s,"__wrapped__"),xe=_e&&ie.call(i,"__wrapped__");if(Se||xe){var Pe=Se?s.value():s,Te=xe?i.value():i;return ce||(ce=new _),le(Pe,Te,u,ae,ce)}}return!!we&&(ce||(ce=new _),j(s,i,u,ae,le,ce))}},29172:(s,i,u)=>{var _=u(5861),w=u(40346);s.exports=function baseIsMap(s){return w(s)&&"[object Map]"==_(s)}},41799:(s,i,u)=>{var _=u(37217),w=u(60270);s.exports=function baseIsMatch(s,i,u,x){var j=u.length,L=j,B=!x;if(null==s)return!L;for(s=Object(s);j--;){var $=u[j];if(B&&$[2]?$[1]!==s[$[0]]:!($[0]in s))return!1}for(;++j{s.exports=function baseIsNaN(s){return s!=s}},45083:(s,i,u)=>{var _=u(1882),w=u(87296),x=u(23805),j=u(47473),L=/^\[object .+?Constructor\]$/,B=Function.prototype,$=Object.prototype,U=B.toString,Y=$.hasOwnProperty,Z=RegExp("^"+U.call(Y).replace(/[\\^$.*+?()[\]{}|]/g,"\\$&").replace(/hasOwnProperty|(function).*?(?=\\\()| for .+?(?=\\\])/g,"$1.*?")+"$");s.exports=function baseIsNative(s){return!(!x(s)||w(s))&&(_(s)?Z:L).test(j(s))}},16038:(s,i,u)=>{var _=u(5861),w=u(40346);s.exports=function baseIsSet(s){return w(s)&&"[object Set]"==_(s)}},4901:(s,i,u)=>{var _=u(72552),w=u(30294),x=u(40346),j={};j["[object Float32Array]"]=j["[object Float64Array]"]=j["[object Int8Array]"]=j["[object Int16Array]"]=j["[object Int32Array]"]=j["[object Uint8Array]"]=j["[object Uint8ClampedArray]"]=j["[object Uint16Array]"]=j["[object Uint32Array]"]=!0,j["[object Arguments]"]=j["[object Array]"]=j["[object ArrayBuffer]"]=j["[object Boolean]"]=j["[object DataView]"]=j["[object Date]"]=j["[object Error]"]=j["[object Function]"]=j["[object Map]"]=j["[object Number]"]=j["[object Object]"]=j["[object RegExp]"]=j["[object Set]"]=j["[object String]"]=j["[object WeakMap]"]=!1,s.exports=function baseIsTypedArray(s){return x(s)&&w(s.length)&&!!j[_(s)]}},15389:(s,i,u)=>{var _=u(93663),w=u(87978),x=u(83488),j=u(56449),L=u(50583);s.exports=function baseIteratee(s){return"function"==typeof s?s:null==s?x:"object"==typeof s?j(s)?w(s[0],s[1]):_(s):L(s)}},88984:(s,i,u)=>{var _=u(55527),w=u(3650),x=Object.prototype.hasOwnProperty;s.exports=function baseKeys(s){if(!_(s))return w(s);var i=[];for(var u in Object(s))x.call(s,u)&&"constructor"!=u&&i.push(u);return i}},72903:(s,i,u)=>{var _=u(23805),w=u(55527),x=u(90181),j=Object.prototype.hasOwnProperty;s.exports=function baseKeysIn(s){if(!_(s))return x(s);var i=w(s),u=[];for(var L in s)("constructor"!=L||!i&&j.call(s,L))&&u.push(L);return u}},94033:s=>{s.exports=function baseLodash(){}},93663:(s,i,u)=>{var _=u(41799),w=u(10776),x=u(67197);s.exports=function baseMatches(s){var i=w(s);return 1==i.length&&i[0][2]?x(i[0][0],i[0][1]):function(u){return u===s||_(u,s,i)}}},87978:(s,i,u)=>{var _=u(60270),w=u(58156),x=u(80631),j=u(28586),L=u(30756),B=u(67197),$=u(77797);s.exports=function baseMatchesProperty(s,i){return j(s)&&L(i)?B($(s),i):function(u){var j=w(u,s);return void 0===j&&j===i?x(u,s):_(i,j,3)}}},85250:(s,i,u)=>{var _=u(37217),w=u(87805),x=u(86649),j=u(42824),L=u(23805),B=u(37241),$=u(14974);s.exports=function baseMerge(s,i,u,U,Y){s!==i&&x(i,(function(x,B){if(Y||(Y=new _),L(x))j(s,i,B,u,baseMerge,U,Y);else{var Z=U?U($(s,B),x,B+"",s,i,Y):void 0;void 0===Z&&(Z=x),w(s,B,Z)}}),B)}},42824:(s,i,u)=>{var _=u(87805),w=u(93290),x=u(71961),j=u(23007),L=u(35529),B=u(72428),$=u(56449),U=u(83693),Y=u(3656),Z=u(1882),ee=u(23805),ie=u(11331),ae=u(37167),le=u(14974),ce=u(69884);s.exports=function baseMergeDeep(s,i,u,pe,de,fe,ye){var be=le(s,u),_e=le(i,u),we=ye.get(_e);if(we)_(s,u,we);else{var Se=fe?fe(be,_e,u+"",s,i,ye):void 0,xe=void 0===Se;if(xe){var Pe=$(_e),Te=!Pe&&Y(_e),Re=!Pe&&!Te&&ae(_e);Se=_e,Pe||Te||Re?$(be)?Se=be:U(be)?Se=j(be):Te?(xe=!1,Se=w(_e,!0)):Re?(xe=!1,Se=x(_e,!0)):Se=[]:ie(_e)||B(_e)?(Se=be,B(be)?Se=ce(be):ee(be)&&!Z(be)||(Se=L(_e))):xe=!1}xe&&(ye.set(_e,Se),de(Se,_e,pe,fe,ye),ye.delete(_e)),_(s,u,Se)}}},47237:s=>{s.exports=function baseProperty(s){return function(i){return null==i?void 0:i[s]}}},17255:(s,i,u)=>{var _=u(47422);s.exports=function basePropertyDeep(s){return function(i){return _(i,s)}}},54552:s=>{s.exports=function basePropertyOf(s){return function(i){return null==s?void 0:s[i]}}},85558:s=>{s.exports=function baseReduce(s,i,u,_,w){return w(s,(function(s,w,x){u=_?(_=!1,s):i(u,s,w,x)})),u}},69302:(s,i,u)=>{var _=u(83488),w=u(56757),x=u(32865);s.exports=function baseRest(s,i){return x(w(s,i,_),s+"")}},73170:(s,i,u)=>{var _=u(16547),w=u(31769),x=u(30361),j=u(23805),L=u(77797);s.exports=function baseSet(s,i,u,B){if(!j(s))return s;for(var $=-1,U=(i=w(i,s)).length,Y=U-1,Z=s;null!=Z&&++${var _=u(83488),w=u(48152),x=w?function(s,i){return w.set(s,i),s}:_;s.exports=x},19570:(s,i,u)=>{var _=u(37334),w=u(93243),x=u(83488),j=w?function(s,i){return w(s,"toString",{configurable:!0,enumerable:!1,value:_(i),writable:!0})}:x;s.exports=j},25160:s=>{s.exports=function baseSlice(s,i,u){var _=-1,w=s.length;i<0&&(i=-i>w?0:w+i),(u=u>w?w:u)<0&&(u+=w),w=i>u?0:u-i>>>0,i>>>=0;for(var x=Array(w);++_{var _=u(80909);s.exports=function baseSome(s,i){var u;return _(s,(function(s,_,w){return!(u=i(s,_,w))})),!!u}},78096:s=>{s.exports=function baseTimes(s,i){for(var u=-1,_=Array(s);++u{var _=u(51873),w=u(34932),x=u(56449),j=u(44394),L=_?_.prototype:void 0,B=L?L.toString:void 0;s.exports=function baseToString(s){if("string"==typeof s)return s;if(x(s))return w(s,baseToString)+"";if(j(s))return B?B.call(s):"";var i=s+"";return"0"==i&&1/s==-Infinity?"-0":i}},54128:(s,i,u)=>{var _=u(31800),w=/^\s+/;s.exports=function baseTrim(s){return s?s.slice(0,_(s)+1).replace(w,""):s}},27301:s=>{s.exports=function baseUnary(s){return function(i){return s(i)}}},19931:(s,i,u)=>{var _=u(31769),w=u(68090),x=u(68969),j=u(77797);s.exports=function baseUnset(s,i){return i=_(i,s),null==(s=x(s,i))||delete s[j(w(i))]}},51234:s=>{s.exports=function baseZipObject(s,i,u){for(var _=-1,w=s.length,x=i.length,j={};++_{s.exports=function cacheHas(s,i){return s.has(i)}},31769:(s,i,u)=>{var _=u(56449),w=u(28586),x=u(61802),j=u(13222);s.exports=function castPath(s,i){return _(s)?s:w(s,i)?[s]:x(j(s))}},28754:(s,i,u)=>{var _=u(25160);s.exports=function castSlice(s,i,u){var w=s.length;return u=void 0===u?w:u,!i&&u>=w?s:_(s,i,u)}},49653:(s,i,u)=>{var _=u(37828);s.exports=function cloneArrayBuffer(s){var i=new s.constructor(s.byteLength);return new _(i).set(new _(s)),i}},93290:(s,i,u)=>{s=u.nmd(s);var _=u(9325),w=i&&!i.nodeType&&i,x=w&&s&&!s.nodeType&&s,j=x&&x.exports===w?_.Buffer:void 0,L=j?j.allocUnsafe:void 0;s.exports=function cloneBuffer(s,i){if(i)return s.slice();var u=s.length,_=L?L(u):new s.constructor(u);return s.copy(_),_}},76169:(s,i,u)=>{var _=u(49653);s.exports=function cloneDataView(s,i){var u=i?_(s.buffer):s.buffer;return new s.constructor(u,s.byteOffset,s.byteLength)}},73201:s=>{var i=/\w*$/;s.exports=function cloneRegExp(s){var u=new s.constructor(s.source,i.exec(s));return u.lastIndex=s.lastIndex,u}},93736:(s,i,u)=>{var _=u(51873),w=_?_.prototype:void 0,x=w?w.valueOf:void 0;s.exports=function cloneSymbol(s){return x?Object(x.call(s)):{}}},71961:(s,i,u)=>{var _=u(49653);s.exports=function cloneTypedArray(s,i){var u=i?_(s.buffer):s.buffer;return new s.constructor(u,s.byteOffset,s.length)}},91596:s=>{var i=Math.max;s.exports=function composeArgs(s,u,_,w){for(var x=-1,j=s.length,L=_.length,B=-1,$=u.length,U=i(j-L,0),Y=Array($+U),Z=!w;++B<$;)Y[B]=u[B];for(;++x{var i=Math.max;s.exports=function composeArgsRight(s,u,_,w){for(var x=-1,j=s.length,L=-1,B=_.length,$=-1,U=u.length,Y=i(j-B,0),Z=Array(Y+U),ee=!w;++x{s.exports=function copyArray(s,i){var u=-1,_=s.length;for(i||(i=Array(_));++u<_;)i[u]=s[u];return i}},21791:(s,i,u)=>{var _=u(16547),w=u(43360);s.exports=function copyObject(s,i,u,x){var j=!u;u||(u={});for(var L=-1,B=i.length;++L{var _=u(21791),w=u(4664);s.exports=function copySymbols(s,i){return _(s,w(s),i)}},48948:(s,i,u)=>{var _=u(21791),w=u(86375);s.exports=function copySymbolsIn(s,i){return _(s,w(s),i)}},55481:(s,i,u)=>{var _=u(9325)["__core-js_shared__"];s.exports=_},58523:s=>{s.exports=function countHolders(s,i){for(var u=s.length,_=0;u--;)s[u]===i&&++_;return _}},20999:(s,i,u)=>{var _=u(69302),w=u(36800);s.exports=function createAssigner(s){return _((function(i,u){var _=-1,x=u.length,j=x>1?u[x-1]:void 0,L=x>2?u[2]:void 0;for(j=s.length>3&&"function"==typeof j?(x--,j):void 0,L&&w(u[0],u[1],L)&&(j=x<3?void 0:j,x=1),i=Object(i);++_{var _=u(64894);s.exports=function createBaseEach(s,i){return function(u,w){if(null==u)return u;if(!_(u))return s(u,w);for(var x=u.length,j=i?x:-1,L=Object(u);(i?j--:++j{s.exports=function createBaseFor(s){return function(i,u,_){for(var w=-1,x=Object(i),j=_(i),L=j.length;L--;){var B=j[s?L:++w];if(!1===u(x[B],B,x))break}return i}}},11842:(s,i,u)=>{var _=u(82819),w=u(9325);s.exports=function createBind(s,i,u){var x=1&i,j=_(s);return function wrapper(){return(this&&this!==w&&this instanceof wrapper?j:s).apply(x?u:this,arguments)}}},12507:(s,i,u)=>{var _=u(28754),w=u(49698),x=u(63912),j=u(13222);s.exports=function createCaseFirst(s){return function(i){i=j(i);var u=w(i)?x(i):void 0,L=u?u[0]:i.charAt(0),B=u?_(u,1).join(""):i.slice(1);return L[s]()+B}}},45539:(s,i,u)=>{var _=u(40882),w=u(50828),x=u(66645),j=RegExp("['’]","g");s.exports=function createCompounder(s){return function(i){return _(x(w(i).replace(j,"")),s,"")}}},82819:(s,i,u)=>{var _=u(39344),w=u(23805);s.exports=function createCtor(s){return function(){var i=arguments;switch(i.length){case 0:return new s;case 1:return new s(i[0]);case 2:return new s(i[0],i[1]);case 3:return new s(i[0],i[1],i[2]);case 4:return new s(i[0],i[1],i[2],i[3]);case 5:return new s(i[0],i[1],i[2],i[3],i[4]);case 6:return new s(i[0],i[1],i[2],i[3],i[4],i[5]);case 7:return new s(i[0],i[1],i[2],i[3],i[4],i[5],i[6])}var u=_(s.prototype),x=s.apply(u,i);return w(x)?x:u}}},77078:(s,i,u)=>{var _=u(91033),w=u(82819),x=u(37471),j=u(18073),L=u(11287),B=u(36306),$=u(9325);s.exports=function createCurry(s,i,u){var U=w(s);return function wrapper(){for(var w=arguments.length,Y=Array(w),Z=w,ee=L(wrapper);Z--;)Y[Z]=arguments[Z];var ie=w<3&&Y[0]!==ee&&Y[w-1]!==ee?[]:B(Y,ee);return(w-=ie.length){var _=u(15389),w=u(64894),x=u(95950);s.exports=function createFind(s){return function(i,u,j){var L=Object(i);if(!w(i)){var B=_(u,3);i=x(i),u=function(s){return B(L[s],s,L)}}var $=s(i,u,j);return $>-1?L[B?i[$]:$]:void 0}}},37471:(s,i,u)=>{var _=u(91596),w=u(53320),x=u(58523),j=u(82819),L=u(18073),B=u(11287),$=u(68294),U=u(36306),Y=u(9325);s.exports=function createHybrid(s,i,u,Z,ee,ie,ae,le,ce,pe){var de=128&i,fe=1&i,ye=2&i,be=24&i,_e=512&i,we=ye?void 0:j(s);return function wrapper(){for(var Se=arguments.length,xe=Array(Se),Pe=Se;Pe--;)xe[Pe]=arguments[Pe];if(be)var Te=B(wrapper),Re=x(xe,Te);if(Z&&(xe=_(xe,Z,ee,be)),ie&&(xe=w(xe,ie,ae,be)),Se-=Re,be&&Se1&&xe.reverse(),de&&ce{var _=u(91033),w=u(82819),x=u(9325);s.exports=function createPartial(s,i,u,j){var L=1&i,B=w(s);return function wrapper(){for(var i=-1,w=arguments.length,$=-1,U=j.length,Y=Array(U+w),Z=this&&this!==x&&this instanceof wrapper?B:s;++${var _=u(85087),w=u(54641),x=u(70981);s.exports=function createRecurry(s,i,u,j,L,B,$,U,Y,Z){var ee=8&i;i|=ee?32:64,4&(i&=~(ee?64:32))||(i&=-4);var ie=[s,i,L,ee?B:void 0,ee?$:void 0,ee?void 0:B,ee?void 0:$,U,Y,Z],ae=u.apply(void 0,ie);return _(s)&&w(ae,ie),ae.placeholder=j,x(ae,s,i)}},66977:(s,i,u)=>{var _=u(68882),w=u(11842),x=u(77078),j=u(37471),L=u(24168),B=u(37381),$=u(3209),U=u(54641),Y=u(70981),Z=u(61489),ee=Math.max;s.exports=function createWrap(s,i,u,ie,ae,le,ce,pe){var de=2&i;if(!de&&"function"!=typeof s)throw new TypeError("Expected a function");var fe=ie?ie.length:0;if(fe||(i&=-97,ie=ae=void 0),ce=void 0===ce?ce:ee(Z(ce),0),pe=void 0===pe?pe:Z(pe),fe-=ae?ae.length:0,64&i){var ye=ie,be=ae;ie=ae=void 0}var _e=de?void 0:B(s),we=[s,i,u,ie,ae,ye,be,le,ce,pe];if(_e&&$(we,_e),s=we[0],i=we[1],u=we[2],ie=we[3],ae=we[4],!(pe=we[9]=void 0===we[9]?de?0:s.length:ee(we[9]-fe,0))&&24&i&&(i&=-25),i&&1!=i)Se=8==i||16==i?x(s,i,pe):32!=i&&33!=i||ae.length?j.apply(void 0,we):L(s,i,u,ie);else var Se=w(s,i,u);return Y((_e?_:U)(Se,we),s,i)}},53138:(s,i,u)=>{var _=u(11331);s.exports=function customOmitClone(s){return _(s)?void 0:s}},24647:(s,i,u)=>{var _=u(54552)({À:"A",Á:"A",Â:"A",Ã:"A",Ä:"A",Å:"A",à:"a",á:"a",â:"a",ã:"a",ä:"a",å:"a",Ç:"C",ç:"c",Ð:"D",ð:"d",È:"E",É:"E",Ê:"E",Ë:"E",è:"e",é:"e",ê:"e",ë:"e",Ì:"I",Í:"I",Î:"I",Ï:"I",ì:"i",í:"i",î:"i",ï:"i",Ñ:"N",ñ:"n",Ò:"O",Ó:"O",Ô:"O",Õ:"O",Ö:"O",Ø:"O",ò:"o",ó:"o",ô:"o",õ:"o",ö:"o",ø:"o",Ù:"U",Ú:"U",Û:"U",Ü:"U",ù:"u",ú:"u",û:"u",ü:"u",Ý:"Y",ý:"y",ÿ:"y",Æ:"Ae",æ:"ae",Þ:"Th",þ:"th",ß:"ss",Ā:"A",Ă:"A",Ą:"A",ā:"a",ă:"a",ą:"a",Ć:"C",Ĉ:"C",Ċ:"C",Č:"C",ć:"c",ĉ:"c",ċ:"c",č:"c",Ď:"D",Đ:"D",ď:"d",đ:"d",Ē:"E",Ĕ:"E",Ė:"E",Ę:"E",Ě:"E",ē:"e",ĕ:"e",ė:"e",ę:"e",ě:"e",Ĝ:"G",Ğ:"G",Ġ:"G",Ģ:"G",ĝ:"g",ğ:"g",ġ:"g",ģ:"g",Ĥ:"H",Ħ:"H",ĥ:"h",ħ:"h",Ĩ:"I",Ī:"I",Ĭ:"I",Į:"I",İ:"I",ĩ:"i",ī:"i",ĭ:"i",į:"i",ı:"i",Ĵ:"J",ĵ:"j",Ķ:"K",ķ:"k",ĸ:"k",Ĺ:"L",Ļ:"L",Ľ:"L",Ŀ:"L",Ł:"L",ĺ:"l",ļ:"l",ľ:"l",ŀ:"l",ł:"l",Ń:"N",Ņ:"N",Ň:"N",Ŋ:"N",ń:"n",ņ:"n",ň:"n",ŋ:"n",Ō:"O",Ŏ:"O",Ő:"O",ō:"o",ŏ:"o",ő:"o",Ŕ:"R",Ŗ:"R",Ř:"R",ŕ:"r",ŗ:"r",ř:"r",Ś:"S",Ŝ:"S",Ş:"S",Š:"S",ś:"s",ŝ:"s",ş:"s",š:"s",Ţ:"T",Ť:"T",Ŧ:"T",ţ:"t",ť:"t",ŧ:"t",Ũ:"U",Ū:"U",Ŭ:"U",Ů:"U",Ű:"U",Ų:"U",ũ:"u",ū:"u",ŭ:"u",ů:"u",ű:"u",ų:"u",Ŵ:"W",ŵ:"w",Ŷ:"Y",ŷ:"y",Ÿ:"Y",Ź:"Z",Ż:"Z",Ž:"Z",ź:"z",ż:"z",ž:"z",IJ:"IJ",ij:"ij",Œ:"Oe",œ:"oe",ʼn:"'n",ſ:"s"});s.exports=_},93243:(s,i,u)=>{var _=u(56110),w=function(){try{var s=_(Object,"defineProperty");return s({},"",{}),s}catch(s){}}();s.exports=w},25911:(s,i,u)=>{var _=u(38859),w=u(14248),x=u(19219);s.exports=function equalArrays(s,i,u,j,L,B){var $=1&u,U=s.length,Y=i.length;if(U!=Y&&!($&&Y>U))return!1;var Z=B.get(s),ee=B.get(i);if(Z&&ee)return Z==i&&ee==s;var ie=-1,ae=!0,le=2&u?new _:void 0;for(B.set(s,i),B.set(i,s);++ie{var _=u(51873),w=u(37828),x=u(75288),j=u(25911),L=u(20317),B=u(84247),$=_?_.prototype:void 0,U=$?$.valueOf:void 0;s.exports=function equalByTag(s,i,u,_,$,Y,Z){switch(u){case"[object DataView]":if(s.byteLength!=i.byteLength||s.byteOffset!=i.byteOffset)return!1;s=s.buffer,i=i.buffer;case"[object ArrayBuffer]":return!(s.byteLength!=i.byteLength||!Y(new w(s),new w(i)));case"[object Boolean]":case"[object Date]":case"[object Number]":return x(+s,+i);case"[object Error]":return s.name==i.name&&s.message==i.message;case"[object RegExp]":case"[object String]":return s==i+"";case"[object Map]":var ee=L;case"[object Set]":var ie=1&_;if(ee||(ee=B),s.size!=i.size&&!ie)return!1;var ae=Z.get(s);if(ae)return ae==i;_|=2,Z.set(s,i);var le=j(ee(s),ee(i),_,$,Y,Z);return Z.delete(s),le;case"[object Symbol]":if(U)return U.call(s)==U.call(i)}return!1}},50689:(s,i,u)=>{var _=u(50002),w=Object.prototype.hasOwnProperty;s.exports=function equalObjects(s,i,u,x,j,L){var B=1&u,$=_(s),U=$.length;if(U!=_(i).length&&!B)return!1;for(var Y=U;Y--;){var Z=$[Y];if(!(B?Z in i:w.call(i,Z)))return!1}var ee=L.get(s),ie=L.get(i);if(ee&&ie)return ee==i&&ie==s;var ae=!0;L.set(s,i),L.set(i,s);for(var le=B;++Y{var _=u(35970),w=u(56757),x=u(32865);s.exports=function flatRest(s){return x(w(s,void 0,_),s+"")}},34840:(s,i,u)=>{var _="object"==typeof u.g&&u.g&&u.g.Object===Object&&u.g;s.exports=_},50002:(s,i,u)=>{var _=u(82199),w=u(4664),x=u(95950);s.exports=function getAllKeys(s){return _(s,x,w)}},83349:(s,i,u)=>{var _=u(82199),w=u(86375),x=u(37241);s.exports=function getAllKeysIn(s){return _(s,x,w)}},37381:(s,i,u)=>{var _=u(48152),w=u(63950),x=_?function(s){return _.get(s)}:w;s.exports=x},62284:(s,i,u)=>{var _=u(84629),w=Object.prototype.hasOwnProperty;s.exports=function getFuncName(s){for(var i=s.name+"",u=_[i],x=w.call(_,i)?u.length:0;x--;){var j=u[x],L=j.func;if(null==L||L==s)return j.name}return i}},11287:s=>{s.exports=function getHolder(s){return s.placeholder}},12651:(s,i,u)=>{var _=u(74218);s.exports=function getMapData(s,i){var u=s.__data__;return _(i)?u["string"==typeof i?"string":"hash"]:u.map}},10776:(s,i,u)=>{var _=u(30756),w=u(95950);s.exports=function getMatchData(s){for(var i=w(s),u=i.length;u--;){var x=i[u],j=s[x];i[u]=[x,j,_(j)]}return i}},56110:(s,i,u)=>{var _=u(45083),w=u(10392);s.exports=function getNative(s,i){var u=w(s,i);return _(u)?u:void 0}},28879:(s,i,u)=>{var _=u(74335)(Object.getPrototypeOf,Object);s.exports=_},659:(s,i,u)=>{var _=u(51873),w=Object.prototype,x=w.hasOwnProperty,j=w.toString,L=_?_.toStringTag:void 0;s.exports=function getRawTag(s){var i=x.call(s,L),u=s[L];try{s[L]=void 0;var _=!0}catch(s){}var w=j.call(s);return _&&(i?s[L]=u:delete s[L]),w}},4664:(s,i,u)=>{var _=u(79770),w=u(63345),x=Object.prototype.propertyIsEnumerable,j=Object.getOwnPropertySymbols,L=j?function(s){return null==s?[]:(s=Object(s),_(j(s),(function(i){return x.call(s,i)})))}:w;s.exports=L},86375:(s,i,u)=>{var _=u(14528),w=u(28879),x=u(4664),j=u(63345),L=Object.getOwnPropertySymbols?function(s){for(var i=[];s;)_(i,x(s)),s=w(s);return i}:j;s.exports=L},5861:(s,i,u)=>{var _=u(55580),w=u(68223),x=u(32804),j=u(76545),L=u(28303),B=u(72552),$=u(47473),U="[object Map]",Y="[object Promise]",Z="[object Set]",ee="[object WeakMap]",ie="[object DataView]",ae=$(_),le=$(w),ce=$(x),pe=$(j),de=$(L),fe=B;(_&&fe(new _(new ArrayBuffer(1)))!=ie||w&&fe(new w)!=U||x&&fe(x.resolve())!=Y||j&&fe(new j)!=Z||L&&fe(new L)!=ee)&&(fe=function(s){var i=B(s),u="[object Object]"==i?s.constructor:void 0,_=u?$(u):"";if(_)switch(_){case ae:return ie;case le:return U;case ce:return Y;case pe:return Z;case de:return ee}return i}),s.exports=fe},10392:s=>{s.exports=function getValue(s,i){return null==s?void 0:s[i]}},75251:s=>{var i=/\{\n\/\* \[wrapped with (.+)\] \*/,u=/,? & /;s.exports=function getWrapDetails(s){var _=s.match(i);return _?_[1].split(u):[]}},49326:(s,i,u)=>{var _=u(31769),w=u(72428),x=u(56449),j=u(30361),L=u(30294),B=u(77797);s.exports=function hasPath(s,i,u){for(var $=-1,U=(i=_(i,s)).length,Y=!1;++${var i=RegExp("[\\u200d\\ud800-\\udfff\\u0300-\\u036f\\ufe20-\\ufe2f\\u20d0-\\u20ff\\ufe0e\\ufe0f]");s.exports=function hasUnicode(s){return i.test(s)}},45434:s=>{var i=/[a-z][A-Z]|[A-Z]{2}[a-z]|[0-9][a-zA-Z]|[a-zA-Z][0-9]|[^a-zA-Z0-9 ]/;s.exports=function hasUnicodeWord(s){return i.test(s)}},22032:(s,i,u)=>{var _=u(81042);s.exports=function hashClear(){this.__data__=_?_(null):{},this.size=0}},63862:s=>{s.exports=function hashDelete(s){var i=this.has(s)&&delete this.__data__[s];return this.size-=i?1:0,i}},66721:(s,i,u)=>{var _=u(81042),w=Object.prototype.hasOwnProperty;s.exports=function hashGet(s){var i=this.__data__;if(_){var u=i[s];return"__lodash_hash_undefined__"===u?void 0:u}return w.call(i,s)?i[s]:void 0}},12749:(s,i,u)=>{var _=u(81042),w=Object.prototype.hasOwnProperty;s.exports=function hashHas(s){var i=this.__data__;return _?void 0!==i[s]:w.call(i,s)}},35749:(s,i,u)=>{var _=u(81042);s.exports=function hashSet(s,i){var u=this.__data__;return this.size+=this.has(s)?0:1,u[s]=_&&void 0===i?"__lodash_hash_undefined__":i,this}},76189:s=>{var i=Object.prototype.hasOwnProperty;s.exports=function initCloneArray(s){var u=s.length,_=new s.constructor(u);return u&&"string"==typeof s[0]&&i.call(s,"index")&&(_.index=s.index,_.input=s.input),_}},77199:(s,i,u)=>{var _=u(49653),w=u(76169),x=u(73201),j=u(93736),L=u(71961);s.exports=function initCloneByTag(s,i,u){var B=s.constructor;switch(i){case"[object ArrayBuffer]":return _(s);case"[object Boolean]":case"[object Date]":return new B(+s);case"[object DataView]":return w(s,u);case"[object Float32Array]":case"[object Float64Array]":case"[object Int8Array]":case"[object Int16Array]":case"[object Int32Array]":case"[object Uint8Array]":case"[object Uint8ClampedArray]":case"[object Uint16Array]":case"[object Uint32Array]":return L(s,u);case"[object Map]":case"[object Set]":return new B;case"[object Number]":case"[object String]":return new B(s);case"[object RegExp]":return x(s);case"[object Symbol]":return j(s)}}},35529:(s,i,u)=>{var _=u(39344),w=u(28879),x=u(55527);s.exports=function initCloneObject(s){return"function"!=typeof s.constructor||x(s)?{}:_(w(s))}},62060:s=>{var i=/\{(?:\n\/\* \[wrapped with .+\] \*\/)?\n?/;s.exports=function insertWrapDetails(s,u){var _=u.length;if(!_)return s;var w=_-1;return u[w]=(_>1?"& ":"")+u[w],u=u.join(_>2?", ":" "),s.replace(i,"{\n/* [wrapped with "+u+"] */\n")}},45891:(s,i,u)=>{var _=u(51873),w=u(72428),x=u(56449),j=_?_.isConcatSpreadable:void 0;s.exports=function isFlattenable(s){return x(s)||w(s)||!!(j&&s&&s[j])}},30361:s=>{var i=/^(?:0|[1-9]\d*)$/;s.exports=function isIndex(s,u){var _=typeof s;return!!(u=null==u?9007199254740991:u)&&("number"==_||"symbol"!=_&&i.test(s))&&s>-1&&s%1==0&&s{var _=u(75288),w=u(64894),x=u(30361),j=u(23805);s.exports=function isIterateeCall(s,i,u){if(!j(u))return!1;var L=typeof i;return!!("number"==L?w(u)&&x(i,u.length):"string"==L&&i in u)&&_(u[i],s)}},28586:(s,i,u)=>{var _=u(56449),w=u(44394),x=/\.|\[(?:[^[\]]*|(["'])(?:(?!\1)[^\\]|\\.)*?\1)\]/,j=/^\w*$/;s.exports=function isKey(s,i){if(_(s))return!1;var u=typeof s;return!("number"!=u&&"symbol"!=u&&"boolean"!=u&&null!=s&&!w(s))||(j.test(s)||!x.test(s)||null!=i&&s in Object(i))}},74218:s=>{s.exports=function isKeyable(s){var i=typeof s;return"string"==i||"number"==i||"symbol"==i||"boolean"==i?"__proto__"!==s:null===s}},85087:(s,i,u)=>{var _=u(30980),w=u(37381),x=u(62284),j=u(53758);s.exports=function isLaziable(s){var i=x(s),u=j[i];if("function"!=typeof u||!(i in _.prototype))return!1;if(s===u)return!0;var L=w(u);return!!L&&s===L[0]}},87296:(s,i,u)=>{var _,w=u(55481),x=(_=/[^.]+$/.exec(w&&w.keys&&w.keys.IE_PROTO||""))?"Symbol(src)_1."+_:"";s.exports=function isMasked(s){return!!x&&x in s}},55527:s=>{var i=Object.prototype;s.exports=function isPrototype(s){var u=s&&s.constructor;return s===("function"==typeof u&&u.prototype||i)}},30756:(s,i,u)=>{var _=u(23805);s.exports=function isStrictComparable(s){return s==s&&!_(s)}},63702:s=>{s.exports=function listCacheClear(){this.__data__=[],this.size=0}},70080:(s,i,u)=>{var _=u(26025),w=Array.prototype.splice;s.exports=function listCacheDelete(s){var i=this.__data__,u=_(i,s);return!(u<0)&&(u==i.length-1?i.pop():w.call(i,u,1),--this.size,!0)}},24739:(s,i,u)=>{var _=u(26025);s.exports=function listCacheGet(s){var i=this.__data__,u=_(i,s);return u<0?void 0:i[u][1]}},48655:(s,i,u)=>{var _=u(26025);s.exports=function listCacheHas(s){return _(this.__data__,s)>-1}},31175:(s,i,u)=>{var _=u(26025);s.exports=function listCacheSet(s,i){var u=this.__data__,w=_(u,s);return w<0?(++this.size,u.push([s,i])):u[w][1]=i,this}},63040:(s,i,u)=>{var _=u(21549),w=u(80079),x=u(68223);s.exports=function mapCacheClear(){this.size=0,this.__data__={hash:new _,map:new(x||w),string:new _}}},17670:(s,i,u)=>{var _=u(12651);s.exports=function mapCacheDelete(s){var i=_(this,s).delete(s);return this.size-=i?1:0,i}},90289:(s,i,u)=>{var _=u(12651);s.exports=function mapCacheGet(s){return _(this,s).get(s)}},4509:(s,i,u)=>{var _=u(12651);s.exports=function mapCacheHas(s){return _(this,s).has(s)}},72949:(s,i,u)=>{var _=u(12651);s.exports=function mapCacheSet(s,i){var u=_(this,s),w=u.size;return u.set(s,i),this.size+=u.size==w?0:1,this}},20317:s=>{s.exports=function mapToArray(s){var i=-1,u=Array(s.size);return s.forEach((function(s,_){u[++i]=[_,s]})),u}},67197:s=>{s.exports=function matchesStrictComparable(s,i){return function(u){return null!=u&&(u[s]===i&&(void 0!==i||s in Object(u)))}}},62224:(s,i,u)=>{var _=u(50104);s.exports=function memoizeCapped(s){var i=_(s,(function(s){return 500===u.size&&u.clear(),s})),u=i.cache;return i}},3209:(s,i,u)=>{var _=u(91596),w=u(53320),x=u(36306),j="__lodash_placeholder__",L=128,B=Math.min;s.exports=function mergeData(s,i){var u=s[1],$=i[1],U=u|$,Y=U<131,Z=$==L&&8==u||$==L&&256==u&&s[7].length<=i[8]||384==$&&i[7].length<=i[8]&&8==u;if(!Y&&!Z)return s;1&$&&(s[2]=i[2],U|=1&u?0:4);var ee=i[3];if(ee){var ie=s[3];s[3]=ie?_(ie,ee,i[4]):ee,s[4]=ie?x(s[3],j):i[4]}return(ee=i[5])&&(ie=s[5],s[5]=ie?w(ie,ee,i[6]):ee,s[6]=ie?x(s[5],j):i[6]),(ee=i[7])&&(s[7]=ee),$&L&&(s[8]=null==s[8]?i[8]:B(s[8],i[8])),null==s[9]&&(s[9]=i[9]),s[0]=i[0],s[1]=U,s}},48152:(s,i,u)=>{var _=u(28303),w=_&&new _;s.exports=w},81042:(s,i,u)=>{var _=u(56110)(Object,"create");s.exports=_},3650:(s,i,u)=>{var _=u(74335)(Object.keys,Object);s.exports=_},90181:s=>{s.exports=function nativeKeysIn(s){var i=[];if(null!=s)for(var u in Object(s))i.push(u);return i}},86009:(s,i,u)=>{s=u.nmd(s);var _=u(34840),w=i&&!i.nodeType&&i,x=w&&s&&!s.nodeType&&s,j=x&&x.exports===w&&_.process,L=function(){try{var s=x&&x.require&&x.require("util").types;return s||j&&j.binding&&j.binding("util")}catch(s){}}();s.exports=L},59350:s=>{var i=Object.prototype.toString;s.exports=function objectToString(s){return i.call(s)}},74335:s=>{s.exports=function overArg(s,i){return function(u){return s(i(u))}}},56757:(s,i,u)=>{var _=u(91033),w=Math.max;s.exports=function overRest(s,i,u){return i=w(void 0===i?s.length-1:i,0),function(){for(var x=arguments,j=-1,L=w(x.length-i,0),B=Array(L);++j{var _=u(47422),w=u(25160);s.exports=function parent(s,i){return i.length<2?s:_(s,w(i,0,-1))}},84629:s=>{s.exports={}},68294:(s,i,u)=>{var _=u(23007),w=u(30361),x=Math.min;s.exports=function reorder(s,i){for(var u=s.length,j=x(i.length,u),L=_(s);j--;){var B=i[j];s[j]=w(B,u)?L[B]:void 0}return s}},36306:s=>{var i="__lodash_placeholder__";s.exports=function replaceHolders(s,u){for(var _=-1,w=s.length,x=0,j=[];++_{var _=u(34840),w="object"==typeof self&&self&&self.Object===Object&&self,x=_||w||Function("return this")();s.exports=x},14974:s=>{s.exports=function safeGet(s,i){if(("constructor"!==i||"function"!=typeof s[i])&&"__proto__"!=i)return s[i]}},31380:s=>{s.exports=function setCacheAdd(s){return this.__data__.set(s,"__lodash_hash_undefined__"),this}},51459:s=>{s.exports=function setCacheHas(s){return this.__data__.has(s)}},54641:(s,i,u)=>{var _=u(68882),w=u(51811)(_);s.exports=w},84247:s=>{s.exports=function setToArray(s){var i=-1,u=Array(s.size);return s.forEach((function(s){u[++i]=s})),u}},32865:(s,i,u)=>{var _=u(19570),w=u(51811)(_);s.exports=w},70981:(s,i,u)=>{var _=u(75251),w=u(62060),x=u(32865),j=u(75948);s.exports=function setWrapToString(s,i,u){var L=i+"";return x(s,w(L,j(_(L),u)))}},51811:s=>{var i=Date.now;s.exports=function shortOut(s){var u=0,_=0;return function(){var w=i(),x=16-(w-_);if(_=w,x>0){if(++u>=800)return arguments[0]}else u=0;return s.apply(void 0,arguments)}}},51420:(s,i,u)=>{var _=u(80079);s.exports=function stackClear(){this.__data__=new _,this.size=0}},90938:s=>{s.exports=function stackDelete(s){var i=this.__data__,u=i.delete(s);return this.size=i.size,u}},63605:s=>{s.exports=function stackGet(s){return this.__data__.get(s)}},29817:s=>{s.exports=function stackHas(s){return this.__data__.has(s)}},80945:(s,i,u)=>{var _=u(80079),w=u(68223),x=u(53661);s.exports=function stackSet(s,i){var u=this.__data__;if(u instanceof _){var j=u.__data__;if(!w||j.length<199)return j.push([s,i]),this.size=++u.size,this;u=this.__data__=new x(j)}return u.set(s,i),this.size=u.size,this}},76959:s=>{s.exports=function strictIndexOf(s,i,u){for(var _=u-1,w=s.length;++_{var _=u(61074),w=u(49698),x=u(42054);s.exports=function stringToArray(s){return w(s)?x(s):_(s)}},61802:(s,i,u)=>{var _=u(62224),w=/[^.[\]]+|\[(?:(-?\d+(?:\.\d+)?)|(["'])((?:(?!\2)[^\\]|\\.)*?)\2)\]|(?=(?:\.|\[\])(?:\.|\[\]|$))/g,x=/\\(\\)?/g,j=_((function(s){var i=[];return 46===s.charCodeAt(0)&&i.push(""),s.replace(w,(function(s,u,_,w){i.push(_?w.replace(x,"$1"):u||s)})),i}));s.exports=j},77797:(s,i,u)=>{var _=u(44394);s.exports=function toKey(s){if("string"==typeof s||_(s))return s;var i=s+"";return"0"==i&&1/s==-Infinity?"-0":i}},47473:s=>{var i=Function.prototype.toString;s.exports=function toSource(s){if(null!=s){try{return i.call(s)}catch(s){}try{return s+""}catch(s){}}return""}},31800:s=>{var i=/\s/;s.exports=function trimmedEndIndex(s){for(var u=s.length;u--&&i.test(s.charAt(u)););return u}},42054:s=>{var i="\\ud800-\\udfff",u="["+i+"]",_="[\\u0300-\\u036f\\ufe20-\\ufe2f\\u20d0-\\u20ff]",w="\\ud83c[\\udffb-\\udfff]",x="[^"+i+"]",j="(?:\\ud83c[\\udde6-\\uddff]){2}",L="[\\ud800-\\udbff][\\udc00-\\udfff]",B="(?:"+_+"|"+w+")"+"?",$="[\\ufe0e\\ufe0f]?",U=$+B+("(?:\\u200d(?:"+[x,j,L].join("|")+")"+$+B+")*"),Y="(?:"+[x+_+"?",_,j,L,u].join("|")+")",Z=RegExp(w+"(?="+w+")|"+Y+U,"g");s.exports=function unicodeToArray(s){return s.match(Z)||[]}},22225:s=>{var i="\\ud800-\\udfff",u="\\u2700-\\u27bf",_="a-z\\xdf-\\xf6\\xf8-\\xff",w="A-Z\\xc0-\\xd6\\xd8-\\xde",x="\\xac\\xb1\\xd7\\xf7\\x00-\\x2f\\x3a-\\x40\\x5b-\\x60\\x7b-\\xbf\\u2000-\\u206f \\t\\x0b\\f\\xa0\\ufeff\\n\\r\\u2028\\u2029\\u1680\\u180e\\u2000\\u2001\\u2002\\u2003\\u2004\\u2005\\u2006\\u2007\\u2008\\u2009\\u200a\\u202f\\u205f\\u3000",j="["+x+"]",L="\\d+",B="["+u+"]",$="["+_+"]",U="[^"+i+x+L+u+_+w+"]",Y="(?:\\ud83c[\\udde6-\\uddff]){2}",Z="[\\ud800-\\udbff][\\udc00-\\udfff]",ee="["+w+"]",ie="(?:"+$+"|"+U+")",ae="(?:"+ee+"|"+U+")",le="(?:['’](?:d|ll|m|re|s|t|ve))?",ce="(?:['’](?:D|LL|M|RE|S|T|VE))?",pe="(?:[\\u0300-\\u036f\\ufe20-\\ufe2f\\u20d0-\\u20ff]|\\ud83c[\\udffb-\\udfff])?",de="[\\ufe0e\\ufe0f]?",fe=de+pe+("(?:\\u200d(?:"+["[^"+i+"]",Y,Z].join("|")+")"+de+pe+")*"),ye="(?:"+[B,Y,Z].join("|")+")"+fe,be=RegExp([ee+"?"+$+"+"+le+"(?="+[j,ee,"$"].join("|")+")",ae+"+"+ce+"(?="+[j,ee+ie,"$"].join("|")+")",ee+"?"+ie+"+"+le,ee+"+"+ce,"\\d*(?:1ST|2ND|3RD|(?![123])\\dTH)(?=\\b|[a-z_])","\\d*(?:1st|2nd|3rd|(?![123])\\dth)(?=\\b|[A-Z_])",L,ye].join("|"),"g");s.exports=function unicodeWords(s){return s.match(be)||[]}},75948:(s,i,u)=>{var _=u(83729),w=u(15325),x=[["ary",128],["bind",1],["bindKey",2],["curry",8],["curryRight",16],["flip",512],["partial",32],["partialRight",64],["rearg",256]];s.exports=function updateWrapDetails(s,i){return _(x,(function(u){var _="_."+u[0];i&u[1]&&!w(s,_)&&s.push(_)})),s.sort()}},80257:(s,i,u)=>{var _=u(30980),w=u(56017),x=u(23007);s.exports=function wrapperClone(s){if(s instanceof _)return s.clone();var i=new w(s.__wrapped__,s.__chain__);return i.__actions__=x(s.__actions__),i.__index__=s.__index__,i.__values__=s.__values__,i}},64626:(s,i,u)=>{var _=u(66977);s.exports=function ary(s,i,u){return i=u?void 0:i,i=s&&null==i?s.length:i,_(s,128,void 0,void 0,void 0,void 0,i)}},84058:(s,i,u)=>{var _=u(14792),w=u(45539)((function(s,i,u){return i=i.toLowerCase(),s+(u?_(i):i)}));s.exports=w},14792:(s,i,u)=>{var _=u(13222),w=u(55808);s.exports=function capitalize(s){return w(_(s).toLowerCase())}},32629:(s,i,u)=>{var _=u(9999);s.exports=function clone(s){return _(s,4)}},37334:s=>{s.exports=function constant(s){return function(){return s}}},49747:(s,i,u)=>{var _=u(66977);function curry(s,i,u){var w=_(s,8,void 0,void 0,void 0,void 0,void 0,i=u?void 0:i);return w.placeholder=curry.placeholder,w}curry.placeholder={},s.exports=curry},38221:(s,i,u)=>{var _=u(23805),w=u(10124),x=u(99374),j=Math.max,L=Math.min;s.exports=function debounce(s,i,u){var B,$,U,Y,Z,ee,ie=0,ae=!1,le=!1,ce=!0;if("function"!=typeof s)throw new TypeError("Expected a function");function invokeFunc(i){var u=B,_=$;return B=$=void 0,ie=i,Y=s.apply(_,u)}function shouldInvoke(s){var u=s-ee;return void 0===ee||u>=i||u<0||le&&s-ie>=U}function timerExpired(){var s=w();if(shouldInvoke(s))return trailingEdge(s);Z=setTimeout(timerExpired,function remainingWait(s){var u=i-(s-ee);return le?L(u,U-(s-ie)):u}(s))}function trailingEdge(s){return Z=void 0,ce&&B?invokeFunc(s):(B=$=void 0,Y)}function debounced(){var s=w(),u=shouldInvoke(s);if(B=arguments,$=this,ee=s,u){if(void 0===Z)return function leadingEdge(s){return ie=s,Z=setTimeout(timerExpired,i),ae?invokeFunc(s):Y}(ee);if(le)return clearTimeout(Z),Z=setTimeout(timerExpired,i),invokeFunc(ee)}return void 0===Z&&(Z=setTimeout(timerExpired,i)),Y}return i=x(i)||0,_(u)&&(ae=!!u.leading,U=(le="maxWait"in u)?j(x(u.maxWait)||0,i):U,ce="trailing"in u?!!u.trailing:ce),debounced.cancel=function cancel(){void 0!==Z&&clearTimeout(Z),ie=0,B=ee=$=Z=void 0},debounced.flush=function flush(){return void 0===Z?Y:trailingEdge(w())},debounced}},50828:(s,i,u)=>{var _=u(24647),w=u(13222),x=/[\xc0-\xd6\xd8-\xf6\xf8-\xff\u0100-\u017f]/g,j=RegExp("[\\u0300-\\u036f\\ufe20-\\ufe2f\\u20d0-\\u20ff]","g");s.exports=function deburr(s){return(s=w(s))&&s.replace(x,_).replace(j,"")}},75288:s=>{s.exports=function eq(s,i){return s===i||s!=s&&i!=i}},60680:(s,i,u)=>{var _=u(13222),w=/[\\^$.*+?()[\]{}|]/g,x=RegExp(w.source);s.exports=function escapeRegExp(s){return(s=_(s))&&x.test(s)?s.replace(w,"\\$&"):s}},7309:(s,i,u)=>{var _=u(62006)(u(24713));s.exports=_},24713:(s,i,u)=>{var _=u(2523),w=u(15389),x=u(61489),j=Math.max;s.exports=function findIndex(s,i,u){var L=null==s?0:s.length;if(!L)return-1;var B=null==u?0:x(u);return B<0&&(B=j(L+B,0)),_(s,w(i,3),B)}},35970:(s,i,u)=>{var _=u(83120);s.exports=function flatten(s){return(null==s?0:s.length)?_(s,1):[]}},73424:(s,i,u)=>{var _=u(16962),w=u(2874),x=Array.prototype.push;function baseAry(s,i){return 2==i?function(i,u){return s(i,u)}:function(i){return s(i)}}function cloneArray(s){for(var i=s?s.length:0,u=Array(i);i--;)u[i]=s[i];return u}function wrapImmutable(s,i){return function(){var u=arguments.length;if(u){for(var _=Array(u);u--;)_[u]=arguments[u];var w=_[0]=i.apply(void 0,_);return s.apply(void 0,_),w}}}s.exports=function baseConvert(s,i,u,j){var L="function"==typeof i,B=i===Object(i);if(B&&(j=u,u=i,i=void 0),null==u)throw new TypeError;j||(j={});var $={cap:!("cap"in j)||j.cap,curry:!("curry"in j)||j.curry,fixed:!("fixed"in j)||j.fixed,immutable:!("immutable"in j)||j.immutable,rearg:!("rearg"in j)||j.rearg},U=L?u:w,Y="curry"in j&&j.curry,Z="fixed"in j&&j.fixed,ee="rearg"in j&&j.rearg,ie=L?u.runInContext():void 0,ae=L?u:{ary:s.ary,assign:s.assign,clone:s.clone,curry:s.curry,forEach:s.forEach,isArray:s.isArray,isError:s.isError,isFunction:s.isFunction,isWeakMap:s.isWeakMap,iteratee:s.iteratee,keys:s.keys,rearg:s.rearg,toInteger:s.toInteger,toPath:s.toPath},le=ae.ary,ce=ae.assign,pe=ae.clone,de=ae.curry,fe=ae.forEach,ye=ae.isArray,be=ae.isError,_e=ae.isFunction,we=ae.isWeakMap,Se=ae.keys,xe=ae.rearg,Pe=ae.toInteger,Te=ae.toPath,Re=Se(_.aryMethod),qe={castArray:function(s){return function(){var i=arguments[0];return ye(i)?s(cloneArray(i)):s.apply(void 0,arguments)}},iteratee:function(s){return function(){var i=arguments[1],u=s(arguments[0],i),_=u.length;return $.cap&&"number"==typeof i?(i=i>2?i-2:1,_&&_<=i?u:baseAry(u,i)):u}},mixin:function(s){return function(i){var u=this;if(!_e(u))return s(u,Object(i));var _=[];return fe(Se(i),(function(s){_e(i[s])&&_.push([s,u.prototype[s]])})),s(u,Object(i)),fe(_,(function(s){var i=s[1];_e(i)?u.prototype[s[0]]=i:delete u.prototype[s[0]]})),u}},nthArg:function(s){return function(i){var u=i<0?1:Pe(i)+1;return de(s(i),u)}},rearg:function(s){return function(i,u){var _=u?u.length:0;return de(s(i,u),_)}},runInContext:function(i){return function(u){return baseConvert(s,i(u),j)}}};function castCap(s,i){if($.cap){var u=_.iterateeRearg[s];if(u)return function iterateeRearg(s,i){return overArg(s,(function(s){var u=i.length;return function baseArity(s,i){return 2==i?function(i,u){return s.apply(void 0,arguments)}:function(i){return s.apply(void 0,arguments)}}(xe(baseAry(s,u),i),u)}))}(i,u);var w=!L&&_.iterateeAry[s];if(w)return function iterateeAry(s,i){return overArg(s,(function(s){return"function"==typeof s?baseAry(s,i):s}))}(i,w)}return i}function castFixed(s,i,u){if($.fixed&&(Z||!_.skipFixed[s])){var w=_.methodSpread[s],j=w&&w.start;return void 0===j?le(i,u):function flatSpread(s,i){return function(){for(var u=arguments.length,_=u-1,w=Array(u);u--;)w[u]=arguments[u];var j=w[i],L=w.slice(0,i);return j&&x.apply(L,j),i!=_&&x.apply(L,w.slice(i+1)),s.apply(this,L)}}(i,j)}return i}function castRearg(s,i,u){return $.rearg&&u>1&&(ee||!_.skipRearg[s])?xe(i,_.methodRearg[s]||_.aryRearg[u]):i}function cloneByPath(s,i){for(var u=-1,_=(i=Te(i)).length,w=_-1,x=pe(Object(s)),j=x;null!=j&&++u<_;){var L=i[u],B=j[L];null==B||_e(B)||be(B)||we(B)||(j[L]=pe(u==w?B:Object(B))),j=j[L]}return x}function createConverter(s,i){var u=_.aliasToReal[s]||s,w=_.remap[u]||u,x=j;return function(s){var _=L?ie:ae,j=L?ie[w]:i,B=ce(ce({},x),s);return baseConvert(_,u,j,B)}}function overArg(s,i){return function(){var u=arguments.length;if(!u)return s();for(var _=Array(u);u--;)_[u]=arguments[u];var w=$.rearg?0:u-1;return _[w]=i(_[w]),s.apply(void 0,_)}}function wrap(s,i,u){var w,x=_.aliasToReal[s]||s,j=i,L=qe[x];return L?j=L(i):$.immutable&&(_.mutate.array[x]?j=wrapImmutable(i,cloneArray):_.mutate.object[x]?j=wrapImmutable(i,function createCloner(s){return function(i){return s({},i)}}(i)):_.mutate.set[x]&&(j=wrapImmutable(i,cloneByPath))),fe(Re,(function(s){return fe(_.aryMethod[s],(function(i){if(x==i){var u=_.methodSpread[x],L=u&&u.afterRearg;return w=L?castFixed(x,castRearg(x,j,s),s):castRearg(x,castFixed(x,j,s),s),w=function castCurry(s,i,u){return Y||$.curry&&u>1?de(i,u):i}(0,w=castCap(x,w),s),!1}})),!w})),w||(w=j),w==i&&(w=Y?de(w,1):function(){return i.apply(this,arguments)}),w.convert=createConverter(x,i),w.placeholder=i.placeholder=u,w}if(!B)return wrap(i,u,U);var $e=u,ze=[];return fe(Re,(function(s){fe(_.aryMethod[s],(function(s){var i=$e[_.remap[s]||s];i&&ze.push([s,wrap(s,i,$e)])}))})),fe(Se($e),(function(s){var i=$e[s];if("function"==typeof i){for(var u=ze.length;u--;)if(ze[u][0]==s)return;i.convert=createConverter(s,i),ze.push([s,i])}})),fe(ze,(function(s){$e[s[0]]=s[1]})),$e.convert=function convertLib(s){return $e.runInContext.convert(s)(void 0)},$e.placeholder=$e,fe(Se($e),(function(s){fe(_.realToAlias[s]||[],(function(i){$e[i]=$e[s]}))})),$e}},16962:(s,i)=>{i.aliasToReal={each:"forEach",eachRight:"forEachRight",entries:"toPairs",entriesIn:"toPairsIn",extend:"assignIn",extendAll:"assignInAll",extendAllWith:"assignInAllWith",extendWith:"assignInWith",first:"head",conforms:"conformsTo",matches:"isMatch",property:"get",__:"placeholder",F:"stubFalse",T:"stubTrue",all:"every",allPass:"overEvery",always:"constant",any:"some",anyPass:"overSome",apply:"spread",assoc:"set",assocPath:"set",complement:"negate",compose:"flowRight",contains:"includes",dissoc:"unset",dissocPath:"unset",dropLast:"dropRight",dropLastWhile:"dropRightWhile",equals:"isEqual",identical:"eq",indexBy:"keyBy",init:"initial",invertObj:"invert",juxt:"over",omitAll:"omit",nAry:"ary",path:"get",pathEq:"matchesProperty",pathOr:"getOr",paths:"at",pickAll:"pick",pipe:"flow",pluck:"map",prop:"get",propEq:"matchesProperty",propOr:"getOr",props:"at",symmetricDifference:"xor",symmetricDifferenceBy:"xorBy",symmetricDifferenceWith:"xorWith",takeLast:"takeRight",takeLastWhile:"takeRightWhile",unapply:"rest",unnest:"flatten",useWith:"overArgs",where:"conformsTo",whereEq:"isMatch",zipObj:"zipObject"},i.aryMethod={1:["assignAll","assignInAll","attempt","castArray","ceil","create","curry","curryRight","defaultsAll","defaultsDeepAll","floor","flow","flowRight","fromPairs","invert","iteratee","memoize","method","mergeAll","methodOf","mixin","nthArg","over","overEvery","overSome","rest","reverse","round","runInContext","spread","template","trim","trimEnd","trimStart","uniqueId","words","zipAll"],2:["add","after","ary","assign","assignAllWith","assignIn","assignInAllWith","at","before","bind","bindAll","bindKey","chunk","cloneDeepWith","cloneWith","concat","conformsTo","countBy","curryN","curryRightN","debounce","defaults","defaultsDeep","defaultTo","delay","difference","divide","drop","dropRight","dropRightWhile","dropWhile","endsWith","eq","every","filter","find","findIndex","findKey","findLast","findLastIndex","findLastKey","flatMap","flatMapDeep","flattenDepth","forEach","forEachRight","forIn","forInRight","forOwn","forOwnRight","get","groupBy","gt","gte","has","hasIn","includes","indexOf","intersection","invertBy","invoke","invokeMap","isEqual","isMatch","join","keyBy","lastIndexOf","lt","lte","map","mapKeys","mapValues","matchesProperty","maxBy","meanBy","merge","mergeAllWith","minBy","multiply","nth","omit","omitBy","overArgs","pad","padEnd","padStart","parseInt","partial","partialRight","partition","pick","pickBy","propertyOf","pull","pullAll","pullAt","random","range","rangeRight","rearg","reject","remove","repeat","restFrom","result","sampleSize","some","sortBy","sortedIndex","sortedIndexOf","sortedLastIndex","sortedLastIndexOf","sortedUniqBy","split","spreadFrom","startsWith","subtract","sumBy","take","takeRight","takeRightWhile","takeWhile","tap","throttle","thru","times","trimChars","trimCharsEnd","trimCharsStart","truncate","union","uniqBy","uniqWith","unset","unzipWith","without","wrap","xor","zip","zipObject","zipObjectDeep"],3:["assignInWith","assignWith","clamp","differenceBy","differenceWith","findFrom","findIndexFrom","findLastFrom","findLastIndexFrom","getOr","includesFrom","indexOfFrom","inRange","intersectionBy","intersectionWith","invokeArgs","invokeArgsMap","isEqualWith","isMatchWith","flatMapDepth","lastIndexOfFrom","mergeWith","orderBy","padChars","padCharsEnd","padCharsStart","pullAllBy","pullAllWith","rangeStep","rangeStepRight","reduce","reduceRight","replace","set","slice","sortedIndexBy","sortedLastIndexBy","transform","unionBy","unionWith","update","xorBy","xorWith","zipWith"],4:["fill","setWith","updateWith"]},i.aryRearg={2:[1,0],3:[2,0,1],4:[3,2,0,1]},i.iterateeAry={dropRightWhile:1,dropWhile:1,every:1,filter:1,find:1,findFrom:1,findIndex:1,findIndexFrom:1,findKey:1,findLast:1,findLastFrom:1,findLastIndex:1,findLastIndexFrom:1,findLastKey:1,flatMap:1,flatMapDeep:1,flatMapDepth:1,forEach:1,forEachRight:1,forIn:1,forInRight:1,forOwn:1,forOwnRight:1,map:1,mapKeys:1,mapValues:1,partition:1,reduce:2,reduceRight:2,reject:1,remove:1,some:1,takeRightWhile:1,takeWhile:1,times:1,transform:2},i.iterateeRearg={mapKeys:[1],reduceRight:[1,0]},i.methodRearg={assignInAllWith:[1,0],assignInWith:[1,2,0],assignAllWith:[1,0],assignWith:[1,2,0],differenceBy:[1,2,0],differenceWith:[1,2,0],getOr:[2,1,0],intersectionBy:[1,2,0],intersectionWith:[1,2,0],isEqualWith:[1,2,0],isMatchWith:[2,1,0],mergeAllWith:[1,0],mergeWith:[1,2,0],padChars:[2,1,0],padCharsEnd:[2,1,0],padCharsStart:[2,1,0],pullAllBy:[2,1,0],pullAllWith:[2,1,0],rangeStep:[1,2,0],rangeStepRight:[1,2,0],setWith:[3,1,2,0],sortedIndexBy:[2,1,0],sortedLastIndexBy:[2,1,0],unionBy:[1,2,0],unionWith:[1,2,0],updateWith:[3,1,2,0],xorBy:[1,2,0],xorWith:[1,2,0],zipWith:[1,2,0]},i.methodSpread={assignAll:{start:0},assignAllWith:{start:0},assignInAll:{start:0},assignInAllWith:{start:0},defaultsAll:{start:0},defaultsDeepAll:{start:0},invokeArgs:{start:2},invokeArgsMap:{start:2},mergeAll:{start:0},mergeAllWith:{start:0},partial:{start:1},partialRight:{start:1},without:{start:1},zipAll:{start:0}},i.mutate={array:{fill:!0,pull:!0,pullAll:!0,pullAllBy:!0,pullAllWith:!0,pullAt:!0,remove:!0,reverse:!0},object:{assign:!0,assignAll:!0,assignAllWith:!0,assignIn:!0,assignInAll:!0,assignInAllWith:!0,assignInWith:!0,assignWith:!0,defaults:!0,defaultsAll:!0,defaultsDeep:!0,defaultsDeepAll:!0,merge:!0,mergeAll:!0,mergeAllWith:!0,mergeWith:!0},set:{set:!0,setWith:!0,unset:!0,update:!0,updateWith:!0}},i.realToAlias=function(){var s=Object.prototype.hasOwnProperty,u=i.aliasToReal,_={};for(var w in u){var x=u[w];s.call(_,x)?_[x].push(w):_[x]=[w]}return _}(),i.remap={assignAll:"assign",assignAllWith:"assignWith",assignInAll:"assignIn",assignInAllWith:"assignInWith",curryN:"curry",curryRightN:"curryRight",defaultsAll:"defaults",defaultsDeepAll:"defaultsDeep",findFrom:"find",findIndexFrom:"findIndex",findLastFrom:"findLast",findLastIndexFrom:"findLastIndex",getOr:"get",includesFrom:"includes",indexOfFrom:"indexOf",invokeArgs:"invoke",invokeArgsMap:"invokeMap",lastIndexOfFrom:"lastIndexOf",mergeAll:"merge",mergeAllWith:"mergeWith",padChars:"pad",padCharsEnd:"padEnd",padCharsStart:"padStart",propertyOf:"get",rangeStep:"range",rangeStepRight:"rangeRight",restFrom:"rest",spreadFrom:"spread",trimChars:"trim",trimCharsEnd:"trimEnd",trimCharsStart:"trimStart",zipAll:"zip"},i.skipFixed={castArray:!0,flow:!0,flowRight:!0,iteratee:!0,mixin:!0,rearg:!0,runInContext:!0},i.skipRearg={add:!0,assign:!0,assignIn:!0,bind:!0,bindKey:!0,concat:!0,difference:!0,divide:!0,eq:!0,gt:!0,gte:!0,isEqual:!0,lt:!0,lte:!0,matchesProperty:!0,merge:!0,multiply:!0,overArgs:!0,partial:!0,partialRight:!0,propertyOf:!0,random:!0,range:!0,rangeRight:!0,subtract:!0,zip:!0,zipObject:!0,zipObjectDeep:!0}},47934:(s,i,u)=>{s.exports={ary:u(64626),assign:u(74733),clone:u(32629),curry:u(49747),forEach:u(83729),isArray:u(56449),isError:u(23546),isFunction:u(1882),isWeakMap:u(47886),iteratee:u(33855),keys:u(88984),rearg:u(84195),toInteger:u(61489),toPath:u(42072)}},56367:(s,i,u)=>{s.exports=u(77731)},79920:(s,i,u)=>{var _=u(73424),w=u(47934);s.exports=function convert(s,i,u){return _(w,s,i,u)}},2874:s=>{s.exports={}},77731:(s,i,u)=>{var _=u(79920)("set",u(63560));_.placeholder=u(2874),s.exports=_},58156:(s,i,u)=>{var _=u(47422);s.exports=function get(s,i,u){var w=null==s?void 0:_(s,i);return void 0===w?u:w}},61448:(s,i,u)=>{var _=u(20426),w=u(49326);s.exports=function has(s,i){return null!=s&&w(s,i,_)}},80631:(s,i,u)=>{var _=u(28077),w=u(49326);s.exports=function hasIn(s,i){return null!=s&&w(s,i,_)}},83488:s=>{s.exports=function identity(s){return s}},72428:(s,i,u)=>{var _=u(27534),w=u(40346),x=Object.prototype,j=x.hasOwnProperty,L=x.propertyIsEnumerable,B=_(function(){return arguments}())?_:function(s){return w(s)&&j.call(s,"callee")&&!L.call(s,"callee")};s.exports=B},56449:s=>{var i=Array.isArray;s.exports=i},64894:(s,i,u)=>{var _=u(1882),w=u(30294);s.exports=function isArrayLike(s){return null!=s&&w(s.length)&&!_(s)}},83693:(s,i,u)=>{var _=u(64894),w=u(40346);s.exports=function isArrayLikeObject(s){return w(s)&&_(s)}},53812:(s,i,u)=>{var _=u(72552),w=u(40346);s.exports=function isBoolean(s){return!0===s||!1===s||w(s)&&"[object Boolean]"==_(s)}},3656:(s,i,u)=>{s=u.nmd(s);var _=u(9325),w=u(89935),x=i&&!i.nodeType&&i,j=x&&s&&!s.nodeType&&s,L=j&&j.exports===x?_.Buffer:void 0,B=(L?L.isBuffer:void 0)||w;s.exports=B},62193:(s,i,u)=>{var _=u(88984),w=u(5861),x=u(72428),j=u(56449),L=u(64894),B=u(3656),$=u(55527),U=u(37167),Y=Object.prototype.hasOwnProperty;s.exports=function isEmpty(s){if(null==s)return!0;if(L(s)&&(j(s)||"string"==typeof s||"function"==typeof s.splice||B(s)||U(s)||x(s)))return!s.length;var i=w(s);if("[object Map]"==i||"[object Set]"==i)return!s.size;if($(s))return!_(s).length;for(var u in s)if(Y.call(s,u))return!1;return!0}},2404:(s,i,u)=>{var _=u(60270);s.exports=function isEqual(s,i){return _(s,i)}},23546:(s,i,u)=>{var _=u(72552),w=u(40346),x=u(11331);s.exports=function isError(s){if(!w(s))return!1;var i=_(s);return"[object Error]"==i||"[object DOMException]"==i||"string"==typeof s.message&&"string"==typeof s.name&&!x(s)}},1882:(s,i,u)=>{var _=u(72552),w=u(23805);s.exports=function isFunction(s){if(!w(s))return!1;var i=_(s);return"[object Function]"==i||"[object GeneratorFunction]"==i||"[object AsyncFunction]"==i||"[object Proxy]"==i}},30294:s=>{s.exports=function isLength(s){return"number"==typeof s&&s>-1&&s%1==0&&s<=9007199254740991}},87730:(s,i,u)=>{var _=u(29172),w=u(27301),x=u(86009),j=x&&x.isMap,L=j?w(j):_;s.exports=L},5187:s=>{s.exports=function isNull(s){return null===s}},98023:(s,i,u)=>{var _=u(72552),w=u(40346);s.exports=function isNumber(s){return"number"==typeof s||w(s)&&"[object Number]"==_(s)}},23805:s=>{s.exports=function isObject(s){var i=typeof s;return null!=s&&("object"==i||"function"==i)}},40346:s=>{s.exports=function isObjectLike(s){return null!=s&&"object"==typeof s}},11331:(s,i,u)=>{var _=u(72552),w=u(28879),x=u(40346),j=Function.prototype,L=Object.prototype,B=j.toString,$=L.hasOwnProperty,U=B.call(Object);s.exports=function isPlainObject(s){if(!x(s)||"[object Object]"!=_(s))return!1;var i=w(s);if(null===i)return!0;var u=$.call(i,"constructor")&&i.constructor;return"function"==typeof u&&u instanceof u&&B.call(u)==U}},38440:(s,i,u)=>{var _=u(16038),w=u(27301),x=u(86009),j=x&&x.isSet,L=j?w(j):_;s.exports=L},85015:(s,i,u)=>{var _=u(72552),w=u(56449),x=u(40346);s.exports=function isString(s){return"string"==typeof s||!w(s)&&x(s)&&"[object String]"==_(s)}},44394:(s,i,u)=>{var _=u(72552),w=u(40346);s.exports=function isSymbol(s){return"symbol"==typeof s||w(s)&&"[object Symbol]"==_(s)}},37167:(s,i,u)=>{var _=u(4901),w=u(27301),x=u(86009),j=x&&x.isTypedArray,L=j?w(j):_;s.exports=L},47886:(s,i,u)=>{var _=u(5861),w=u(40346);s.exports=function isWeakMap(s){return w(s)&&"[object WeakMap]"==_(s)}},33855:(s,i,u)=>{var _=u(9999),w=u(15389);s.exports=function iteratee(s){return w("function"==typeof s?s:_(s,1))}},95950:(s,i,u)=>{var _=u(70695),w=u(88984),x=u(64894);s.exports=function keys(s){return x(s)?_(s):w(s)}},37241:(s,i,u)=>{var _=u(70695),w=u(72903),x=u(64894);s.exports=function keysIn(s){return x(s)?_(s,!0):w(s)}},68090:s=>{s.exports=function last(s){var i=null==s?0:s.length;return i?s[i-1]:void 0}},50104:(s,i,u)=>{var _=u(53661);function memoize(s,i){if("function"!=typeof s||null!=i&&"function"!=typeof i)throw new TypeError("Expected a function");var memoized=function(){var u=arguments,_=i?i.apply(this,u):u[0],w=memoized.cache;if(w.has(_))return w.get(_);var x=s.apply(this,u);return memoized.cache=w.set(_,x)||w,x};return memoized.cache=new(memoize.Cache||_),memoized}memoize.Cache=_,s.exports=memoize},55364:(s,i,u)=>{var _=u(85250),w=u(20999)((function(s,i,u){_(s,i,u)}));s.exports=w},6048:s=>{s.exports=function negate(s){if("function"!=typeof s)throw new TypeError("Expected a function");return function(){var i=arguments;switch(i.length){case 0:return!s.call(this);case 1:return!s.call(this,i[0]);case 2:return!s.call(this,i[0],i[1]);case 3:return!s.call(this,i[0],i[1],i[2])}return!s.apply(this,i)}}},63950:s=>{s.exports=function noop(){}},10124:(s,i,u)=>{var _=u(9325);s.exports=function(){return _.Date.now()}},90179:(s,i,u)=>{var _=u(34932),w=u(9999),x=u(19931),j=u(31769),L=u(21791),B=u(53138),$=u(38816),U=u(83349),Y=$((function(s,i){var u={};if(null==s)return u;var $=!1;i=_(i,(function(i){return i=j(i,s),$||($=i.length>1),i})),L(s,U(s),u),$&&(u=w(u,7,B));for(var Y=i.length;Y--;)x(u,i[Y]);return u}));s.exports=Y},50583:(s,i,u)=>{var _=u(47237),w=u(17255),x=u(28586),j=u(77797);s.exports=function property(s){return x(s)?_(j(s)):w(s)}},84195:(s,i,u)=>{var _=u(66977),w=u(38816),x=w((function(s,i){return _(s,256,void 0,void 0,void 0,i)}));s.exports=x},40860:(s,i,u)=>{var _=u(40882),w=u(80909),x=u(15389),j=u(85558),L=u(56449);s.exports=function reduce(s,i,u){var B=L(s)?_:j,$=arguments.length<3;return B(s,x(i,4),u,$,w)}},63560:(s,i,u)=>{var _=u(73170);s.exports=function set(s,i,u){return null==s?s:_(s,i,u)}},42426:(s,i,u)=>{var _=u(14248),w=u(15389),x=u(90916),j=u(56449),L=u(36800);s.exports=function some(s,i,u){var B=j(s)?_:x;return u&&L(s,i,u)&&(i=void 0),B(s,w(i,3))}},63345:s=>{s.exports=function stubArray(){return[]}},89935:s=>{s.exports=function stubFalse(){return!1}},17400:(s,i,u)=>{var _=u(99374),w=1/0;s.exports=function toFinite(s){return s?(s=_(s))===w||s===-1/0?17976931348623157e292*(s<0?-1:1):s==s?s:0:0===s?s:0}},61489:(s,i,u)=>{var _=u(17400);s.exports=function toInteger(s){var i=_(s),u=i%1;return i==i?u?i-u:i:0}},80218:(s,i,u)=>{var _=u(13222);s.exports=function toLower(s){return _(s).toLowerCase()}},99374:(s,i,u)=>{var _=u(54128),w=u(23805),x=u(44394),j=/^[-+]0x[0-9a-f]+$/i,L=/^0b[01]+$/i,B=/^0o[0-7]+$/i,$=parseInt;s.exports=function toNumber(s){if("number"==typeof s)return s;if(x(s))return NaN;if(w(s)){var i="function"==typeof s.valueOf?s.valueOf():s;s=w(i)?i+"":i}if("string"!=typeof s)return 0===s?s:+s;s=_(s);var u=L.test(s);return u||B.test(s)?$(s.slice(2),u?2:8):j.test(s)?NaN:+s}},42072:(s,i,u)=>{var _=u(34932),w=u(23007),x=u(56449),j=u(44394),L=u(61802),B=u(77797),$=u(13222);s.exports=function toPath(s){return x(s)?_(s,B):j(s)?[s]:w(L($(s)))}},69884:(s,i,u)=>{var _=u(21791),w=u(37241);s.exports=function toPlainObject(s){return _(s,w(s))}},13222:(s,i,u)=>{var _=u(77556);s.exports=function toString(s){return null==s?"":_(s)}},55808:(s,i,u)=>{var _=u(12507)("toUpperCase");s.exports=_},66645:(s,i,u)=>{var _=u(1733),w=u(45434),x=u(13222),j=u(22225);s.exports=function words(s,i,u){return s=x(s),void 0===(i=u?void 0:i)?w(s)?j(s):_(s):s.match(i)||[]}},53758:(s,i,u)=>{var _=u(30980),w=u(56017),x=u(94033),j=u(56449),L=u(40346),B=u(80257),$=Object.prototype.hasOwnProperty;function lodash(s){if(L(s)&&!j(s)&&!(s instanceof _)){if(s instanceof w)return s;if($.call(s,"__wrapped__"))return B(s)}return new w(s)}lodash.prototype=x.prototype,lodash.prototype.constructor=lodash,s.exports=lodash},47248:(s,i,u)=>{var _=u(16547),w=u(51234);s.exports=function zipObject(s,i){return w(s||[],i||[],_)}},43768:(s,i,u)=>{"use strict";var _=u(45981),w=u(85587);i.highlight=highlight,i.highlightAuto=function highlightAuto(s,i){var u,j,L,B,$=i||{},U=$.subset||_.listLanguages(),Y=$.prefix,Z=U.length,ee=-1;null==Y&&(Y=x);if("string"!=typeof s)throw w("Expected `string` for value, got `%s`",s);j={relevance:0,language:null,value:[]},u={relevance:0,language:null,value:[]};for(;++eej.relevance&&(j=L),L.relevance>u.relevance&&(j=u,u=L));j.language&&(u.secondBest=j);return u},i.registerLanguage=function registerLanguage(s,i){_.registerLanguage(s,i)},i.listLanguages=function listLanguages(){return _.listLanguages()},i.registerAlias=function registerAlias(s,i){var u,w=s;i&&((w={})[s]=i);for(u in w)_.registerAliases(w[u],{languageName:u})},Emitter.prototype.addText=function text(s){var i,u,_=this.stack;if(""===s)return;i=_[_.length-1],(u=i.children[i.children.length-1])&&"text"===u.type?u.value+=s:i.children.push({type:"text",value:s})},Emitter.prototype.addKeyword=function addKeyword(s,i){this.openNode(i),this.addText(s),this.closeNode()},Emitter.prototype.addSublanguage=function addSublanguage(s,i){var u=this.stack,_=u[u.length-1],w=s.rootNode.children,x=i?{type:"element",tagName:"span",properties:{className:[i]},children:w}:w;_.children=_.children.concat(x)},Emitter.prototype.openNode=function open(s){var i=this.stack,u=this.options.classPrefix+s,_=i[i.length-1],w={type:"element",tagName:"span",properties:{className:[u]},children:[]};_.children.push(w),i.push(w)},Emitter.prototype.closeNode=function close(){this.stack.pop()},Emitter.prototype.closeAllNodes=noop,Emitter.prototype.finalize=noop,Emitter.prototype.toHTML=function toHtmlNoop(){return""};var x="hljs-";function highlight(s,i,u){var j,L=_.configure({}),B=(u||{}).prefix;if("string"!=typeof s)throw w("Expected `string` for name, got `%s`",s);if(!_.getLanguage(s))throw w("Unknown language: `%s` is not registered",s);if("string"!=typeof i)throw w("Expected `string` for value, got `%s`",i);if(null==B&&(B=x),_.configure({__emitter:Emitter,classPrefix:B}),j=_.highlight(i,{language:s,ignoreIllegals:!0}),_.configure(L||{}),j.errorRaised)throw j.errorRaised;return{relevance:j.relevance,language:j.language,value:j.emitter.rootNode.children}}function Emitter(s){this.options=s,this.rootNode={children:[]},this.stack=[this.rootNode]}function noop(){}},92340:(s,i,u)=>{const _=u(6048);function coerceElementMatchingCallback(s){return"string"==typeof s?i=>i.element===s:s.constructor&&s.extend?i=>i instanceof s:s}class ArraySlice{constructor(s){this.elements=s||[]}toValue(){return this.elements.map((s=>s.toValue()))}map(s,i){return this.elements.map(s,i)}flatMap(s,i){return this.map(s,i).reduce(((s,i)=>s.concat(i)),[])}compactMap(s,i){const u=[];return this.forEach((_=>{const w=s.bind(i)(_);w&&u.push(w)})),u}filter(s,i){return s=coerceElementMatchingCallback(s),new ArraySlice(this.elements.filter(s,i))}reject(s,i){return s=coerceElementMatchingCallback(s),new ArraySlice(this.elements.filter(_(s),i))}find(s,i){return s=coerceElementMatchingCallback(s),this.elements.find(s,i)}forEach(s,i){this.elements.forEach(s,i)}reduce(s,i){return this.elements.reduce(s,i)}includes(s){return this.elements.some((i=>i.equals(s)))}shift(){return this.elements.shift()}unshift(s){this.elements.unshift(this.refract(s))}push(s){return this.elements.push(this.refract(s)),this}add(s){this.push(s)}get(s){return this.elements[s]}getValue(s){const i=this.elements[s];if(i)return i.toValue()}get length(){return this.elements.length}get isEmpty(){return 0===this.elements.length}get first(){return this.elements[0]}}"undefined"!=typeof Symbol&&(ArraySlice.prototype[Symbol.iterator]=function symbol(){return this.elements[Symbol.iterator]()}),s.exports=ArraySlice},55973:s=>{class KeyValuePair{constructor(s,i){this.key=s,this.value=i}clone(){const s=new KeyValuePair;return this.key&&(s.key=this.key.clone()),this.value&&(s.value=this.value.clone()),s}}s.exports=KeyValuePair},3110:(s,i,u)=>{const _=u(5187),w=u(85015),x=u(98023),j=u(53812),L=u(23805),B=u(85105),$=u(86804);class Namespace{constructor(s){this.elementMap={},this.elementDetection=[],this.Element=$.Element,this.KeyValuePair=$.KeyValuePair,s&&s.noDefault||this.useDefault(),this._attributeElementKeys=[],this._attributeElementArrayKeys=[]}use(s){return s.namespace&&s.namespace({base:this}),s.load&&s.load({base:this}),this}useDefault(){return this.register("null",$.NullElement).register("string",$.StringElement).register("number",$.NumberElement).register("boolean",$.BooleanElement).register("array",$.ArrayElement).register("object",$.ObjectElement).register("member",$.MemberElement).register("ref",$.RefElement).register("link",$.LinkElement),this.detect(_,$.NullElement,!1).detect(w,$.StringElement,!1).detect(x,$.NumberElement,!1).detect(j,$.BooleanElement,!1).detect(Array.isArray,$.ArrayElement,!1).detect(L,$.ObjectElement,!1),this}register(s,i){return this._elements=void 0,this.elementMap[s]=i,this}unregister(s){return this._elements=void 0,delete this.elementMap[s],this}detect(s,i,u){return void 0===u||u?this.elementDetection.unshift([s,i]):this.elementDetection.push([s,i]),this}toElement(s){if(s instanceof this.Element)return s;let i;for(let u=0;u{const i=s[0].toUpperCase()+s.substr(1);this._elements[i]=this.elementMap[s]}))),this._elements}get serialiser(){return new B(this)}}B.prototype.Namespace=Namespace,s.exports=Namespace},10866:(s,i,u)=>{const _=u(6048),w=u(92340);class ObjectSlice extends w{map(s,i){return this.elements.map((u=>s.bind(i)(u.value,u.key,u)))}filter(s,i){return new ObjectSlice(this.elements.filter((u=>s.bind(i)(u.value,u.key,u))))}reject(s,i){return this.filter(_(s.bind(i)))}forEach(s,i){return this.elements.forEach(((u,_)=>{s.bind(i)(u.value,u.key,u,_)}))}keys(){return this.map(((s,i)=>i.toValue()))}values(){return this.map((s=>s.toValue()))}}s.exports=ObjectSlice},86804:(s,i,u)=>{const _=u(10316),w=u(41067),x=u(71167),j=u(40239),L=u(12242),B=u(6233),$=u(87726),U=u(61045),Y=u(86303),Z=u(14540),ee=u(92340),ie=u(10866),ae=u(55973);function refract(s){if(s instanceof _)return s;if("string"==typeof s)return new x(s);if("number"==typeof s)return new j(s);if("boolean"==typeof s)return new L(s);if(null===s)return new w;if(Array.isArray(s))return new B(s.map(refract));if("object"==typeof s){return new U(s)}return s}_.prototype.ObjectElement=U,_.prototype.RefElement=Z,_.prototype.MemberElement=$,_.prototype.refract=refract,ee.prototype.refract=refract,s.exports={Element:_,NullElement:w,StringElement:x,NumberElement:j,BooleanElement:L,ArrayElement:B,MemberElement:$,ObjectElement:U,LinkElement:Y,RefElement:Z,refract,ArraySlice:ee,ObjectSlice:ie,KeyValuePair:ae}},86303:(s,i,u)=>{const _=u(10316);s.exports=class LinkElement extends _{constructor(s,i,u){super(s||[],i,u),this.element="link"}get relation(){return this.attributes.get("relation")}set relation(s){this.attributes.set("relation",s)}get href(){return this.attributes.get("href")}set href(s){this.attributes.set("href",s)}}},14540:(s,i,u)=>{const _=u(10316);s.exports=class RefElement extends _{constructor(s,i,u){super(s||[],i,u),this.element="ref",this.path||(this.path="element")}get path(){return this.attributes.get("path")}set path(s){this.attributes.set("path",s)}}},34035:(s,i,u)=>{const _=u(3110),w=u(86804);i.g$=_,i.KeyValuePair=u(55973),i.G6=w.ArraySlice,i.ot=w.ObjectSlice,i.Hg=w.Element,i.Om=w.StringElement,i.kT=w.NumberElement,i.bd=w.BooleanElement,i.Os=w.NullElement,i.wE=w.ArrayElement,i.Sh=w.ObjectElement,i.Pr=w.MemberElement,i.sI=w.RefElement,i.Ft=w.LinkElement,i.e=w.refract,u(85105),u(75147)},6233:(s,i,u)=>{const _=u(6048),w=u(10316),x=u(92340);class ArrayElement extends w{constructor(s,i,u){super(s||[],i,u),this.element="array"}primitive(){return"array"}get(s){return this.content[s]}getValue(s){const i=this.get(s);if(i)return i.toValue()}getIndex(s){return this.content[s]}set(s,i){return this.content[s]=this.refract(i),this}remove(s){const i=this.content.splice(s,1);return i.length?i[0]:null}map(s,i){return this.content.map(s,i)}flatMap(s,i){return this.map(s,i).reduce(((s,i)=>s.concat(i)),[])}compactMap(s,i){const u=[];return this.forEach((_=>{const w=s.bind(i)(_);w&&u.push(w)})),u}filter(s,i){return new x(this.content.filter(s,i))}reject(s,i){return this.filter(_(s),i)}reduce(s,i){let u,_;void 0!==i?(u=0,_=this.refract(i)):(u=1,_="object"===this.primitive()?this.first.value:this.first);for(let i=u;i{s.bind(i)(u,this.refract(_))}))}shift(){return this.content.shift()}unshift(s){this.content.unshift(this.refract(s))}push(s){return this.content.push(this.refract(s)),this}add(s){this.push(s)}findElements(s,i){const u=i||{},_=!!u.recursive,w=void 0===u.results?[]:u.results;return this.forEach(((i,u,x)=>{_&&void 0!==i.findElements&&i.findElements(s,{results:w,recursive:_}),s(i,u,x)&&w.push(i)})),w}find(s){return new x(this.findElements(s,{recursive:!0}))}findByElement(s){return this.find((i=>i.element===s))}findByClass(s){return this.find((i=>i.classes.includes(s)))}getById(s){return this.find((i=>i.id.toValue()===s)).first}includes(s){return this.content.some((i=>i.equals(s)))}contains(s){return this.includes(s)}empty(){return new this.constructor([])}"fantasy-land/empty"(){return this.empty()}concat(s){return new this.constructor(this.content.concat(s.content))}"fantasy-land/concat"(s){return this.concat(s)}"fantasy-land/map"(s){return new this.constructor(this.map(s))}"fantasy-land/chain"(s){return this.map((i=>s(i)),this).reduce(((s,i)=>s.concat(i)),this.empty())}"fantasy-land/filter"(s){return new this.constructor(this.content.filter(s))}"fantasy-land/reduce"(s,i){return this.content.reduce(s,i)}get length(){return this.content.length}get isEmpty(){return 0===this.content.length}get first(){return this.getIndex(0)}get second(){return this.getIndex(1)}get last(){return this.getIndex(this.length-1)}}ArrayElement.empty=function empty(){return new this},ArrayElement["fantasy-land/empty"]=ArrayElement.empty,"undefined"!=typeof Symbol&&(ArrayElement.prototype[Symbol.iterator]=function symbol(){return this.content[Symbol.iterator]()}),s.exports=ArrayElement},12242:(s,i,u)=>{const _=u(10316);s.exports=class BooleanElement extends _{constructor(s,i,u){super(s,i,u),this.element="boolean"}primitive(){return"boolean"}}},10316:(s,i,u)=>{const _=u(2404),w=u(55973),x=u(92340);class Element{constructor(s,i,u){i&&(this.meta=i),u&&(this.attributes=u),this.content=s}freeze(){Object.isFrozen(this)||(this._meta&&(this.meta.parent=this,this.meta.freeze()),this._attributes&&(this.attributes.parent=this,this.attributes.freeze()),this.children.forEach((s=>{s.parent=this,s.freeze()}),this),this.content&&Array.isArray(this.content)&&Object.freeze(this.content),Object.freeze(this))}primitive(){}clone(){const s=new this.constructor;return s.element=this.element,this.meta.length&&(s._meta=this.meta.clone()),this.attributes.length&&(s._attributes=this.attributes.clone()),this.content?this.content.clone?s.content=this.content.clone():Array.isArray(this.content)?s.content=this.content.map((s=>s.clone())):s.content=this.content:s.content=this.content,s}toValue(){return this.content instanceof Element?this.content.toValue():this.content instanceof w?{key:this.content.key.toValue(),value:this.content.value?this.content.value.toValue():void 0}:this.content&&this.content.map?this.content.map((s=>s.toValue()),this):this.content}toRef(s){if(""===this.id.toValue())throw Error("Cannot create reference to an element that does not contain an ID");const i=new this.RefElement(this.id.toValue());return s&&(i.path=s),i}findRecursive(...s){if(arguments.length>1&&!this.isFrozen)throw new Error("Cannot find recursive with multiple element names without first freezing the element. Call `element.freeze()`");const i=s.pop();let u=new x;const append=(s,i)=>(s.push(i),s),checkElement=(s,u)=>{u.element===i&&s.push(u);const _=u.findRecursive(i);return _&&_.reduce(append,s),u.content instanceof w&&(u.content.key&&checkElement(s,u.content.key),u.content.value&&checkElement(s,u.content.value)),s};return this.content&&(this.content.element&&checkElement(u,this.content),Array.isArray(this.content)&&this.content.reduce(checkElement,u)),s.isEmpty||(u=u.filter((i=>{let u=i.parents.map((s=>s.element));for(const i in s){const _=s[i],w=u.indexOf(_);if(-1===w)return!1;u=u.splice(0,w)}return!0}))),u}set(s){return this.content=s,this}equals(s){return _(this.toValue(),s)}getMetaProperty(s,i){if(!this.meta.hasKey(s)){if(this.isFrozen){const s=this.refract(i);return s.freeze(),s}this.meta.set(s,i)}return this.meta.get(s)}setMetaProperty(s,i){this.meta.set(s,i)}get element(){return this._storedElement||"element"}set element(s){this._storedElement=s}get content(){return this._content}set content(s){if(s instanceof Element)this._content=s;else if(s instanceof x)this.content=s.elements;else if("string"==typeof s||"number"==typeof s||"boolean"==typeof s||"null"===s||null==s)this._content=s;else if(s instanceof w)this._content=s;else if(Array.isArray(s))this._content=s.map(this.refract);else{if("object"!=typeof s)throw new Error("Cannot set content to given value");this._content=Object.keys(s).map((i=>new this.MemberElement(i,s[i])))}}get meta(){if(!this._meta){if(this.isFrozen){const s=new this.ObjectElement;return s.freeze(),s}this._meta=new this.ObjectElement}return this._meta}set meta(s){s instanceof this.ObjectElement?this._meta=s:this.meta.set(s||{})}get attributes(){if(!this._attributes){if(this.isFrozen){const s=new this.ObjectElement;return s.freeze(),s}this._attributes=new this.ObjectElement}return this._attributes}set attributes(s){s instanceof this.ObjectElement?this._attributes=s:this.attributes.set(s||{})}get id(){return this.getMetaProperty("id","")}set id(s){this.setMetaProperty("id",s)}get classes(){return this.getMetaProperty("classes",[])}set classes(s){this.setMetaProperty("classes",s)}get title(){return this.getMetaProperty("title","")}set title(s){this.setMetaProperty("title",s)}get description(){return this.getMetaProperty("description","")}set description(s){this.setMetaProperty("description",s)}get links(){return this.getMetaProperty("links",[])}set links(s){this.setMetaProperty("links",s)}get isFrozen(){return Object.isFrozen(this)}get parents(){let{parent:s}=this;const i=new x;for(;s;)i.push(s),s=s.parent;return i}get children(){if(Array.isArray(this.content))return new x(this.content);if(this.content instanceof w){const s=new x([this.content.key]);return this.content.value&&s.push(this.content.value),s}return this.content instanceof Element?new x([this.content]):new x}get recursiveChildren(){const s=new x;return this.children.forEach((i=>{s.push(i),i.recursiveChildren.forEach((i=>{s.push(i)}))})),s}}s.exports=Element},87726:(s,i,u)=>{const _=u(55973),w=u(10316);s.exports=class MemberElement extends w{constructor(s,i,u,w){super(new _,u,w),this.element="member",this.key=s,this.value=i}get key(){return this.content.key}set key(s){this.content.key=this.refract(s)}get value(){return this.content.value}set value(s){this.content.value=this.refract(s)}}},41067:(s,i,u)=>{const _=u(10316);s.exports=class NullElement extends _{constructor(s,i,u){super(s||null,i,u),this.element="null"}primitive(){return"null"}set(){return new Error("Cannot set the value of null")}}},40239:(s,i,u)=>{const _=u(10316);s.exports=class NumberElement extends _{constructor(s,i,u){super(s,i,u),this.element="number"}primitive(){return"number"}}},61045:(s,i,u)=>{const _=u(6048),w=u(23805),x=u(6233),j=u(87726),L=u(10866);s.exports=class ObjectElement extends x{constructor(s,i,u){super(s||[],i,u),this.element="object"}primitive(){return"object"}toValue(){return this.content.reduce(((s,i)=>(s[i.key.toValue()]=i.value?i.value.toValue():void 0,s)),{})}get(s){const i=this.getMember(s);if(i)return i.value}getMember(s){if(void 0!==s)return this.content.find((i=>i.key.toValue()===s))}remove(s){let i=null;return this.content=this.content.filter((u=>u.key.toValue()!==s||(i=u,!1))),i}getKey(s){const i=this.getMember(s);if(i)return i.key}set(s,i){if(w(s))return Object.keys(s).forEach((i=>{this.set(i,s[i])})),this;const u=s,_=this.getMember(u);return _?_.value=i:this.content.push(new j(u,i)),this}keys(){return this.content.map((s=>s.key.toValue()))}values(){return this.content.map((s=>s.value.toValue()))}hasKey(s){return this.content.some((i=>i.key.equals(s)))}items(){return this.content.map((s=>[s.key.toValue(),s.value.toValue()]))}map(s,i){return this.content.map((u=>s.bind(i)(u.value,u.key,u)))}compactMap(s,i){const u=[];return this.forEach(((_,w,x)=>{const j=s.bind(i)(_,w,x);j&&u.push(j)})),u}filter(s,i){return new L(this.content).filter(s,i)}reject(s,i){return this.filter(_(s),i)}forEach(s,i){return this.content.forEach((u=>s.bind(i)(u.value,u.key,u)))}}},71167:(s,i,u)=>{const _=u(10316);s.exports=class StringElement extends _{constructor(s,i,u){super(s,i,u),this.element="string"}primitive(){return"string"}get length(){return this.content.length}}},75147:(s,i,u)=>{const _=u(85105);s.exports=class JSON06Serialiser extends _{serialise(s){if(!(s instanceof this.namespace.elements.Element))throw new TypeError(`Given element \`${s}\` is not an Element instance`);let i;s._attributes&&s.attributes.get("variable")&&(i=s.attributes.get("variable"));const u={element:s.element};s._meta&&s._meta.length>0&&(u.meta=this.serialiseObject(s.meta));const _="enum"===s.element||-1!==s.attributes.keys().indexOf("enumerations");if(_){const i=this.enumSerialiseAttributes(s);i&&(u.attributes=i)}else if(s._attributes&&s._attributes.length>0){let{attributes:_}=s;_.get("metadata")&&(_=_.clone(),_.set("meta",_.get("metadata")),_.remove("metadata")),"member"===s.element&&i&&(_=_.clone(),_.remove("variable")),_.length>0&&(u.attributes=this.serialiseObject(_))}if(_)u.content=this.enumSerialiseContent(s,u);else if(this[`${s.element}SerialiseContent`])u.content=this[`${s.element}SerialiseContent`](s,u);else if(void 0!==s.content){let _;i&&s.content.key?(_=s.content.clone(),_.key.attributes.set("variable",i),_=this.serialiseContent(_)):_=this.serialiseContent(s.content),this.shouldSerialiseContent(s,_)&&(u.content=_)}else this.shouldSerialiseContent(s,s.content)&&s instanceof this.namespace.elements.Array&&(u.content=[]);return u}shouldSerialiseContent(s,i){return"parseResult"===s.element||"httpRequest"===s.element||"httpResponse"===s.element||"category"===s.element||"link"===s.element||void 0!==i&&(!Array.isArray(i)||0!==i.length)}refSerialiseContent(s,i){return delete i.attributes,{href:s.toValue(),path:s.path.toValue()}}sourceMapSerialiseContent(s){return s.toValue()}dataStructureSerialiseContent(s){return[this.serialiseContent(s.content)]}enumSerialiseAttributes(s){const i=s.attributes.clone(),u=i.remove("enumerations")||new this.namespace.elements.Array([]),_=i.get("default");let w=i.get("samples")||new this.namespace.elements.Array([]);if(_&&_.content&&(_.content.attributes&&_.content.attributes.remove("typeAttributes"),i.set("default",new this.namespace.elements.Array([_.content]))),w.forEach((s=>{s.content&&s.content.element&&s.content.attributes.remove("typeAttributes")})),s.content&&0!==u.length&&w.unshift(s.content),w=w.map((s=>s instanceof this.namespace.elements.Array?[s]:new this.namespace.elements.Array([s.content]))),w.length&&i.set("samples",w),i.length>0)return this.serialiseObject(i)}enumSerialiseContent(s){if(s._attributes){const i=s.attributes.get("enumerations");if(i&&i.length>0)return i.content.map((s=>{const i=s.clone();return i.attributes.remove("typeAttributes"),this.serialise(i)}))}if(s.content){const i=s.content.clone();return i.attributes.remove("typeAttributes"),[this.serialise(i)]}return[]}deserialise(s){if("string"==typeof s)return new this.namespace.elements.String(s);if("number"==typeof s)return new this.namespace.elements.Number(s);if("boolean"==typeof s)return new this.namespace.elements.Boolean(s);if(null===s)return new this.namespace.elements.Null;if(Array.isArray(s))return new this.namespace.elements.Array(s.map(this.deserialise,this));const i=this.namespace.getElementClass(s.element),u=new i;u.element!==s.element&&(u.element=s.element),s.meta&&this.deserialiseObject(s.meta,u.meta),s.attributes&&this.deserialiseObject(s.attributes,u.attributes);const _=this.deserialiseContent(s.content);if(void 0===_&&null!==u.content||(u.content=_),"enum"===u.element){u.content&&u.attributes.set("enumerations",u.content);let s=u.attributes.get("samples");if(u.attributes.remove("samples"),s){const _=s;s=new this.namespace.elements.Array,_.forEach((_=>{_.forEach((_=>{const w=new i(_);w.element=u.element,s.push(w)}))}));const w=s.shift();u.content=w?w.content:void 0,u.attributes.set("samples",s)}else u.content=void 0;let _=u.attributes.get("default");if(_&&_.length>0){_=_.get(0);const s=new i(_);s.element=u.element,u.attributes.set("default",s)}}else if("dataStructure"===u.element&&Array.isArray(u.content))[u.content]=u.content;else if("category"===u.element){const s=u.attributes.get("meta");s&&(u.attributes.set("metadata",s),u.attributes.remove("meta"))}else"member"===u.element&&u.key&&u.key._attributes&&u.key._attributes.getValue("variable")&&(u.attributes.set("variable",u.key.attributes.get("variable")),u.key.attributes.remove("variable"));return u}serialiseContent(s){if(s instanceof this.namespace.elements.Element)return this.serialise(s);if(s instanceof this.namespace.KeyValuePair){const i={key:this.serialise(s.key)};return s.value&&(i.value=this.serialise(s.value)),i}return s&&s.map?s.map(this.serialise,this):s}deserialiseContent(s){if(s){if(s.element)return this.deserialise(s);if(s.key){const i=new this.namespace.KeyValuePair(this.deserialise(s.key));return s.value&&(i.value=this.deserialise(s.value)),i}if(s.map)return s.map(this.deserialise,this)}return s}shouldRefract(s){return!!(s._attributes&&s.attributes.keys().length||s._meta&&s.meta.keys().length)||"enum"!==s.element&&(s.element!==s.primitive()||"member"===s.element)}convertKeyToRefract(s,i){return this.shouldRefract(i)?this.serialise(i):"enum"===i.element?this.serialiseEnum(i):"array"===i.element?i.map((i=>this.shouldRefract(i)||"default"===s?this.serialise(i):"array"===i.element||"object"===i.element||"enum"===i.element?i.children.map((s=>this.serialise(s))):i.toValue())):"object"===i.element?(i.content||[]).map(this.serialise,this):i.toValue()}serialiseEnum(s){return s.children.map((s=>this.serialise(s)))}serialiseObject(s){const i={};return s.forEach(((s,u)=>{if(s){const _=u.toValue();i[_]=this.convertKeyToRefract(_,s)}})),i}deserialiseObject(s,i){Object.keys(s).forEach((u=>{i.set(u,this.deserialise(s[u]))}))}}},85105:s=>{s.exports=class JSONSerialiser{constructor(s){this.namespace=s||new this.Namespace}serialise(s){if(!(s instanceof this.namespace.elements.Element))throw new TypeError(`Given element \`${s}\` is not an Element instance`);const i={element:s.element};s._meta&&s._meta.length>0&&(i.meta=this.serialiseObject(s.meta)),s._attributes&&s._attributes.length>0&&(i.attributes=this.serialiseObject(s.attributes));const u=this.serialiseContent(s.content);return void 0!==u&&(i.content=u),i}deserialise(s){if(!s.element)throw new Error("Given value is not an object containing an element name");const i=new(this.namespace.getElementClass(s.element));i.element!==s.element&&(i.element=s.element),s.meta&&this.deserialiseObject(s.meta,i.meta),s.attributes&&this.deserialiseObject(s.attributes,i.attributes);const u=this.deserialiseContent(s.content);return void 0===u&&null!==i.content||(i.content=u),i}serialiseContent(s){if(s instanceof this.namespace.elements.Element)return this.serialise(s);if(s instanceof this.namespace.KeyValuePair){const i={key:this.serialise(s.key)};return s.value&&(i.value=this.serialise(s.value)),i}if(s&&s.map){if(0===s.length)return;return s.map(this.serialise,this)}return s}deserialiseContent(s){if(s){if(s.element)return this.deserialise(s);if(s.key){const i=new this.namespace.KeyValuePair(this.deserialise(s.key));return s.value&&(i.value=this.deserialise(s.value)),i}if(s.map)return s.map(this.deserialise,this)}return s}serialiseObject(s){const i={};if(s.forEach(((s,u)=>{s&&(i[u.toValue()]=this.serialise(s))})),0!==Object.keys(i).length)return i}deserialiseObject(s,i){Object.keys(s).forEach((u=>{i.set(u,this.deserialise(s[u]))}))}}},58859:(s,i,u)=>{var _="function"==typeof Map&&Map.prototype,w=Object.getOwnPropertyDescriptor&&_?Object.getOwnPropertyDescriptor(Map.prototype,"size"):null,x=_&&w&&"function"==typeof w.get?w.get:null,j=_&&Map.prototype.forEach,L="function"==typeof Set&&Set.prototype,B=Object.getOwnPropertyDescriptor&&L?Object.getOwnPropertyDescriptor(Set.prototype,"size"):null,$=L&&B&&"function"==typeof B.get?B.get:null,U=L&&Set.prototype.forEach,Y="function"==typeof WeakMap&&WeakMap.prototype?WeakMap.prototype.has:null,Z="function"==typeof WeakSet&&WeakSet.prototype?WeakSet.prototype.has:null,ee="function"==typeof WeakRef&&WeakRef.prototype?WeakRef.prototype.deref:null,ie=Boolean.prototype.valueOf,ae=Object.prototype.toString,le=Function.prototype.toString,ce=String.prototype.match,pe=String.prototype.slice,de=String.prototype.replace,fe=String.prototype.toUpperCase,ye=String.prototype.toLowerCase,be=RegExp.prototype.test,_e=Array.prototype.concat,we=Array.prototype.join,Se=Array.prototype.slice,xe=Math.floor,Pe="function"==typeof BigInt?BigInt.prototype.valueOf:null,Te=Object.getOwnPropertySymbols,Re="function"==typeof Symbol&&"symbol"==typeof Symbol.iterator?Symbol.prototype.toString:null,qe="function"==typeof Symbol&&"object"==typeof Symbol.iterator,$e="function"==typeof Symbol&&Symbol.toStringTag&&(typeof Symbol.toStringTag===qe||"symbol")?Symbol.toStringTag:null,ze=Object.prototype.propertyIsEnumerable,We=("function"==typeof Reflect?Reflect.getPrototypeOf:Object.getPrototypeOf)||([].__proto__===Array.prototype?function(s){return s.__proto__}:null);function addNumericSeparator(s,i){if(s===1/0||s===-1/0||s!=s||s&&s>-1e3&&s<1e3||be.call(/e/,i))return i;var u=/[0-9](?=(?:[0-9]{3})+(?![0-9]))/g;if("number"==typeof s){var _=s<0?-xe(-s):xe(s);if(_!==s){var w=String(_),x=pe.call(i,w.length+1);return de.call(w,u,"$&_")+"."+de.call(de.call(x,/([0-9]{3})/g,"$&_"),/_$/,"")}}return de.call(i,u,"$&_")}var He=u(42634),Ye=He.custom,Xe=isSymbol(Ye)?Ye:null;function wrapQuotes(s,i,u){var _="double"===(u.quoteStyle||i)?'"':"'";return _+s+_}function quote(s){return de.call(String(s),/"/g,""")}function isArray(s){return!("[object Array]"!==toStr(s)||$e&&"object"==typeof s&&$e in s)}function isRegExp(s){return!("[object RegExp]"!==toStr(s)||$e&&"object"==typeof s&&$e in s)}function isSymbol(s){if(qe)return s&&"object"==typeof s&&s instanceof Symbol;if("symbol"==typeof s)return!0;if(!s||"object"!=typeof s||!Re)return!1;try{return Re.call(s),!0}catch(s){}return!1}s.exports=function inspect_(s,i,_,w){var L=i||{};if(has(L,"quoteStyle")&&"single"!==L.quoteStyle&&"double"!==L.quoteStyle)throw new TypeError('option "quoteStyle" must be "single" or "double"');if(has(L,"maxStringLength")&&("number"==typeof L.maxStringLength?L.maxStringLength<0&&L.maxStringLength!==1/0:null!==L.maxStringLength))throw new TypeError('option "maxStringLength", if provided, must be a positive integer, Infinity, or `null`');var B=!has(L,"customInspect")||L.customInspect;if("boolean"!=typeof B&&"symbol"!==B)throw new TypeError("option \"customInspect\", if provided, must be `true`, `false`, or `'symbol'`");if(has(L,"indent")&&null!==L.indent&&"\t"!==L.indent&&!(parseInt(L.indent,10)===L.indent&&L.indent>0))throw new TypeError('option "indent" must be "\\t", an integer > 0, or `null`');if(has(L,"numericSeparator")&&"boolean"!=typeof L.numericSeparator)throw new TypeError('option "numericSeparator", if provided, must be `true` or `false`');var ae=L.numericSeparator;if(void 0===s)return"undefined";if(null===s)return"null";if("boolean"==typeof s)return s?"true":"false";if("string"==typeof s)return inspectString(s,L);if("number"==typeof s){if(0===s)return 1/0/s>0?"0":"-0";var fe=String(s);return ae?addNumericSeparator(s,fe):fe}if("bigint"==typeof s){var be=String(s)+"n";return ae?addNumericSeparator(s,be):be}var xe=void 0===L.depth?5:L.depth;if(void 0===_&&(_=0),_>=xe&&xe>0&&"object"==typeof s)return isArray(s)?"[Array]":"[Object]";var Te=function getIndent(s,i){var u;if("\t"===s.indent)u="\t";else{if(!("number"==typeof s.indent&&s.indent>0))return null;u=we.call(Array(s.indent+1)," ")}return{base:u,prev:we.call(Array(i+1),u)}}(L,_);if(void 0===w)w=[];else if(indexOf(w,s)>=0)return"[Circular]";function inspect(s,i,u){if(i&&(w=Se.call(w)).push(i),u){var x={depth:L.depth};return has(L,"quoteStyle")&&(x.quoteStyle=L.quoteStyle),inspect_(s,x,_+1,w)}return inspect_(s,L,_+1,w)}if("function"==typeof s&&!isRegExp(s)){var Ye=function nameOf(s){if(s.name)return s.name;var i=ce.call(le.call(s),/^function\s*([\w$]+)/);if(i)return i[1];return null}(s),Qe=arrObjKeys(s,inspect);return"[Function"+(Ye?": "+Ye:" (anonymous)")+"]"+(Qe.length>0?" { "+we.call(Qe,", ")+" }":"")}if(isSymbol(s)){var et=qe?de.call(String(s),/^(Symbol\(.*\))_[^)]*$/,"$1"):Re.call(s);return"object"!=typeof s||qe?et:markBoxed(et)}if(function isElement(s){if(!s||"object"!=typeof s)return!1;if("undefined"!=typeof HTMLElement&&s instanceof HTMLElement)return!0;return"string"==typeof s.nodeName&&"function"==typeof s.getAttribute}(s)){for(var tt="<"+ye.call(String(s.nodeName)),rt=s.attributes||[],nt=0;nt"}if(isArray(s)){if(0===s.length)return"[]";var ot=arrObjKeys(s,inspect);return Te&&!function singleLineValues(s){for(var i=0;i=0)return!1;return!0}(ot)?"["+indentedJoin(ot,Te)+"]":"[ "+we.call(ot,", ")+" ]"}if(function isError(s){return!("[object Error]"!==toStr(s)||$e&&"object"==typeof s&&$e in s)}(s)){var st=arrObjKeys(s,inspect);return"cause"in Error.prototype||!("cause"in s)||ze.call(s,"cause")?0===st.length?"["+String(s)+"]":"{ ["+String(s)+"] "+we.call(st,", ")+" }":"{ ["+String(s)+"] "+we.call(_e.call("[cause]: "+inspect(s.cause),st),", ")+" }"}if("object"==typeof s&&B){if(Xe&&"function"==typeof s[Xe]&&He)return He(s,{depth:xe-_});if("symbol"!==B&&"function"==typeof s.inspect)return s.inspect()}if(function isMap(s){if(!x||!s||"object"!=typeof s)return!1;try{x.call(s);try{$.call(s)}catch(s){return!0}return s instanceof Map}catch(s){}return!1}(s)){var it=[];return j&&j.call(s,(function(i,u){it.push(inspect(u,s,!0)+" => "+inspect(i,s))})),collectionOf("Map",x.call(s),it,Te)}if(function isSet(s){if(!$||!s||"object"!=typeof s)return!1;try{$.call(s);try{x.call(s)}catch(s){return!0}return s instanceof Set}catch(s){}return!1}(s)){var at=[];return U&&U.call(s,(function(i){at.push(inspect(i,s))})),collectionOf("Set",$.call(s),at,Te)}if(function isWeakMap(s){if(!Y||!s||"object"!=typeof s)return!1;try{Y.call(s,Y);try{Z.call(s,Z)}catch(s){return!0}return s instanceof WeakMap}catch(s){}return!1}(s))return weakCollectionOf("WeakMap");if(function isWeakSet(s){if(!Z||!s||"object"!=typeof s)return!1;try{Z.call(s,Z);try{Y.call(s,Y)}catch(s){return!0}return s instanceof WeakSet}catch(s){}return!1}(s))return weakCollectionOf("WeakSet");if(function isWeakRef(s){if(!ee||!s||"object"!=typeof s)return!1;try{return ee.call(s),!0}catch(s){}return!1}(s))return weakCollectionOf("WeakRef");if(function isNumber(s){return!("[object Number]"!==toStr(s)||$e&&"object"==typeof s&&$e in s)}(s))return markBoxed(inspect(Number(s)));if(function isBigInt(s){if(!s||"object"!=typeof s||!Pe)return!1;try{return Pe.call(s),!0}catch(s){}return!1}(s))return markBoxed(inspect(Pe.call(s)));if(function isBoolean(s){return!("[object Boolean]"!==toStr(s)||$e&&"object"==typeof s&&$e in s)}(s))return markBoxed(ie.call(s));if(function isString(s){return!("[object String]"!==toStr(s)||$e&&"object"==typeof s&&$e in s)}(s))return markBoxed(inspect(String(s)));if("undefined"!=typeof window&&s===window)return"{ [object Window] }";if(s===u.g)return"{ [object globalThis] }";if(!function isDate(s){return!("[object Date]"!==toStr(s)||$e&&"object"==typeof s&&$e in s)}(s)&&!isRegExp(s)){var lt=arrObjKeys(s,inspect),ct=We?We(s)===Object.prototype:s instanceof Object||s.constructor===Object,ut=s instanceof Object?"":"null prototype",pt=!ct&&$e&&Object(s)===s&&$e in s?pe.call(toStr(s),8,-1):ut?"Object":"",ht=(ct||"function"!=typeof s.constructor?"":s.constructor.name?s.constructor.name+" ":"")+(pt||ut?"["+we.call(_e.call([],pt||[],ut||[]),": ")+"] ":"");return 0===lt.length?ht+"{}":Te?ht+"{"+indentedJoin(lt,Te)+"}":ht+"{ "+we.call(lt,", ")+" }"}return String(s)};var Qe=Object.prototype.hasOwnProperty||function(s){return s in this};function has(s,i){return Qe.call(s,i)}function toStr(s){return ae.call(s)}function indexOf(s,i){if(s.indexOf)return s.indexOf(i);for(var u=0,_=s.length;u<_;u++)if(s[u]===i)return u;return-1}function inspectString(s,i){if(s.length>i.maxStringLength){var u=s.length-i.maxStringLength,_="... "+u+" more character"+(u>1?"s":"");return inspectString(pe.call(s,0,i.maxStringLength),i)+_}return wrapQuotes(de.call(de.call(s,/(['\\])/g,"\\$1"),/[\x00-\x1f]/g,lowbyte),"single",i)}function lowbyte(s){var i=s.charCodeAt(0),u={8:"b",9:"t",10:"n",12:"f",13:"r"}[i];return u?"\\"+u:"\\x"+(i<16?"0":"")+fe.call(i.toString(16))}function markBoxed(s){return"Object("+s+")"}function weakCollectionOf(s){return s+" { ? }"}function collectionOf(s,i,u,_){return s+" ("+i+") {"+(_?indentedJoin(u,_):we.call(u,", "))+"}"}function indentedJoin(s,i){if(0===s.length)return"";var u="\n"+i.prev+i.base;return u+we.call(s,","+u)+"\n"+i.prev}function arrObjKeys(s,i){var u=isArray(s),_=[];if(u){_.length=s.length;for(var w=0;w{var i,u,_=s.exports={};function defaultSetTimout(){throw new Error("setTimeout has not been defined")}function defaultClearTimeout(){throw new Error("clearTimeout has not been defined")}function runTimeout(s){if(i===setTimeout)return setTimeout(s,0);if((i===defaultSetTimout||!i)&&setTimeout)return i=setTimeout,setTimeout(s,0);try{return i(s,0)}catch(u){try{return i.call(null,s,0)}catch(u){return i.call(this,s,0)}}}!function(){try{i="function"==typeof setTimeout?setTimeout:defaultSetTimout}catch(s){i=defaultSetTimout}try{u="function"==typeof clearTimeout?clearTimeout:defaultClearTimeout}catch(s){u=defaultClearTimeout}}();var w,x=[],j=!1,L=-1;function cleanUpNextTick(){j&&w&&(j=!1,w.length?x=w.concat(x):L=-1,x.length&&drainQueue())}function drainQueue(){if(!j){var s=runTimeout(cleanUpNextTick);j=!0;for(var i=x.length;i;){for(w=x,x=[];++L1)for(var u=1;u{"use strict";var _=u(6925);function emptyFunction(){}function emptyFunctionWithReset(){}emptyFunctionWithReset.resetWarningCache=emptyFunction,s.exports=function(){function shim(s,i,u,w,x,j){if(j!==_){var L=new Error("Calling PropTypes validators directly is not supported by the `prop-types` package. Use PropTypes.checkPropTypes() to call them. Read more at http://fb.me/use-check-prop-types");throw L.name="Invariant Violation",L}}function getShim(){return shim}shim.isRequired=shim;var s={array:shim,bigint:shim,bool:shim,func:shim,number:shim,object:shim,string:shim,symbol:shim,any:shim,arrayOf:getShim,element:shim,elementType:shim,instanceOf:getShim,node:shim,objectOf:getShim,oneOf:getShim,oneOfType:getShim,shape:getShim,exact:getShim,checkPropTypes:emptyFunctionWithReset,resetWarningCache:emptyFunction};return s.PropTypes=s,s}},5556:(s,i,u)=>{s.exports=u(2694)()},6925:s=>{"use strict";s.exports="SECRET_DO_NOT_PASS_THIS_OR_YOU_WILL_BE_FIRED"},74765:s=>{"use strict";var i=String.prototype.replace,u=/%20/g,_="RFC1738",w="RFC3986";s.exports={default:w,formatters:{RFC1738:function(s){return i.call(s,u,"+")},RFC3986:function(s){return String(s)}},RFC1738:_,RFC3986:w}},55373:(s,i,u)=>{"use strict";var _=u(98636),w=u(62642),x=u(74765);s.exports={formats:x,parse:w,stringify:_}},62642:(s,i,u)=>{"use strict";var _=u(37720),w=Object.prototype.hasOwnProperty,x=Array.isArray,j={allowDots:!1,allowPrototypes:!1,allowSparse:!1,arrayLimit:20,charset:"utf-8",charsetSentinel:!1,comma:!1,decoder:_.decode,delimiter:"&",depth:5,ignoreQueryPrefix:!1,interpretNumericEntities:!1,parameterLimit:1e3,parseArrays:!0,plainObjects:!1,strictNullHandling:!1},interpretNumericEntities=function(s){return s.replace(/&#(\d+);/g,(function(s,i){return String.fromCharCode(parseInt(i,10))}))},parseArrayValue=function(s,i){return s&&"string"==typeof s&&i.comma&&s.indexOf(",")>-1?s.split(","):s},L=function parseQueryStringKeys(s,i,u,_){if(s){var x=u.allowDots?s.replace(/\.([^.[]+)/g,"[$1]"):s,j=/(\[[^[\]]*])/g,L=u.depth>0&&/(\[[^[\]]*])/.exec(x),B=L?x.slice(0,L.index):x,$=[];if(B){if(!u.plainObjects&&w.call(Object.prototype,B)&&!u.allowPrototypes)return;$.push(B)}for(var U=0;u.depth>0&&null!==(L=j.exec(x))&&U=0;--x){var j,L=s[x];if("[]"===L&&u.parseArrays)j=[].concat(w);else{j=u.plainObjects?Object.create(null):{};var B="["===L.charAt(0)&&"]"===L.charAt(L.length-1)?L.slice(1,-1):L,$=parseInt(B,10);u.parseArrays||""!==B?!isNaN($)&&L!==B&&String($)===B&&$>=0&&u.parseArrays&&$<=u.arrayLimit?(j=[])[$]=w:"__proto__"!==B&&(j[B]=w):j={0:w}}w=j}return w}($,i,u,_)}};s.exports=function(s,i){var u=function normalizeParseOptions(s){if(!s)return j;if(null!==s.decoder&&void 0!==s.decoder&&"function"!=typeof s.decoder)throw new TypeError("Decoder has to be a function.");if(void 0!==s.charset&&"utf-8"!==s.charset&&"iso-8859-1"!==s.charset)throw new TypeError("The charset option must be either utf-8, iso-8859-1, or undefined");var i=void 0===s.charset?j.charset:s.charset;return{allowDots:void 0===s.allowDots?j.allowDots:!!s.allowDots,allowPrototypes:"boolean"==typeof s.allowPrototypes?s.allowPrototypes:j.allowPrototypes,allowSparse:"boolean"==typeof s.allowSparse?s.allowSparse:j.allowSparse,arrayLimit:"number"==typeof s.arrayLimit?s.arrayLimit:j.arrayLimit,charset:i,charsetSentinel:"boolean"==typeof s.charsetSentinel?s.charsetSentinel:j.charsetSentinel,comma:"boolean"==typeof s.comma?s.comma:j.comma,decoder:"function"==typeof s.decoder?s.decoder:j.decoder,delimiter:"string"==typeof s.delimiter||_.isRegExp(s.delimiter)?s.delimiter:j.delimiter,depth:"number"==typeof s.depth||!1===s.depth?+s.depth:j.depth,ignoreQueryPrefix:!0===s.ignoreQueryPrefix,interpretNumericEntities:"boolean"==typeof s.interpretNumericEntities?s.interpretNumericEntities:j.interpretNumericEntities,parameterLimit:"number"==typeof s.parameterLimit?s.parameterLimit:j.parameterLimit,parseArrays:!1!==s.parseArrays,plainObjects:"boolean"==typeof s.plainObjects?s.plainObjects:j.plainObjects,strictNullHandling:"boolean"==typeof s.strictNullHandling?s.strictNullHandling:j.strictNullHandling}}(i);if(""===s||null==s)return u.plainObjects?Object.create(null):{};for(var B="string"==typeof s?function parseQueryStringValues(s,i){var u,L={},B=i.ignoreQueryPrefix?s.replace(/^\?/,""):s,$=i.parameterLimit===1/0?void 0:i.parameterLimit,U=B.split(i.delimiter,$),Y=-1,Z=i.charset;if(i.charsetSentinel)for(u=0;u-1&&(ie=x(ie)?[ie]:ie),w.call(L,ee)?L[ee]=_.combine(L[ee],ie):L[ee]=ie}return L}(s,u):s,$=u.plainObjects?Object.create(null):{},U=Object.keys(B),Y=0;Y{"use strict";var _=u(920),w=u(37720),x=u(74765),j=Object.prototype.hasOwnProperty,L={brackets:function brackets(s){return s+"[]"},comma:"comma",indices:function indices(s,i){return s+"["+i+"]"},repeat:function repeat(s){return s}},B=Array.isArray,$=String.prototype.split,U=Array.prototype.push,pushToArray=function(s,i){U.apply(s,B(i)?i:[i])},Y=Date.prototype.toISOString,Z=x.default,ee={addQueryPrefix:!1,allowDots:!1,charset:"utf-8",charsetSentinel:!1,delimiter:"&",encode:!0,encoder:w.encode,encodeValuesOnly:!1,format:Z,formatter:x.formatters[Z],indices:!1,serializeDate:function serializeDate(s){return Y.call(s)},skipNulls:!1,strictNullHandling:!1},ie={},ae=function stringify(s,i,u,x,j,L,U,Y,Z,ae,le,ce,pe,de,fe,ye){for(var be=s,_e=ye,we=0,Se=!1;void 0!==(_e=_e.get(ie))&&!Se;){var xe=_e.get(s);if(we+=1,void 0!==xe){if(xe===we)throw new RangeError("Cyclic object value");Se=!0}void 0===_e.get(ie)&&(we=0)}if("function"==typeof Y?be=Y(i,be):be instanceof Date?be=le(be):"comma"===u&&B(be)&&(be=w.maybeMap(be,(function(s){return s instanceof Date?le(s):s}))),null===be){if(j)return U&&!de?U(i,ee.encoder,fe,"key",ce):i;be=""}if(function isNonNullishPrimitive(s){return"string"==typeof s||"number"==typeof s||"boolean"==typeof s||"symbol"==typeof s||"bigint"==typeof s}(be)||w.isBuffer(be)){if(U){var Pe=de?i:U(i,ee.encoder,fe,"key",ce);if("comma"===u&&de){for(var Te=$.call(String(be),","),Re="",qe=0;qe0?be.join(",")||null:void 0}];else if(B(Y))$e=Y;else{var We=Object.keys(be);$e=Z?We.sort(Z):We}for(var He=x&&B(be)&&1===be.length?i+"[]":i,Ye=0;Ye<$e.length;++Ye){var Xe=$e[Ye],Qe="object"==typeof Xe&&void 0!==Xe.value?Xe.value:be[Xe];if(!L||null!==Qe){var et=B(be)?"function"==typeof u?u(He,Xe):He:He+(ae?"."+Xe:"["+Xe+"]");ye.set(s,we);var tt=_();tt.set(ie,ye),pushToArray(ze,stringify(Qe,et,u,x,j,L,U,Y,Z,ae,le,ce,pe,de,fe,tt))}}return ze};s.exports=function(s,i){var u,w=s,$=function normalizeStringifyOptions(s){if(!s)return ee;if(null!==s.encoder&&void 0!==s.encoder&&"function"!=typeof s.encoder)throw new TypeError("Encoder has to be a function.");var i=s.charset||ee.charset;if(void 0!==s.charset&&"utf-8"!==s.charset&&"iso-8859-1"!==s.charset)throw new TypeError("The charset option must be either utf-8, iso-8859-1, or undefined");var u=x.default;if(void 0!==s.format){if(!j.call(x.formatters,s.format))throw new TypeError("Unknown format option provided.");u=s.format}var _=x.formatters[u],w=ee.filter;return("function"==typeof s.filter||B(s.filter))&&(w=s.filter),{addQueryPrefix:"boolean"==typeof s.addQueryPrefix?s.addQueryPrefix:ee.addQueryPrefix,allowDots:void 0===s.allowDots?ee.allowDots:!!s.allowDots,charset:i,charsetSentinel:"boolean"==typeof s.charsetSentinel?s.charsetSentinel:ee.charsetSentinel,delimiter:void 0===s.delimiter?ee.delimiter:s.delimiter,encode:"boolean"==typeof s.encode?s.encode:ee.encode,encoder:"function"==typeof s.encoder?s.encoder:ee.encoder,encodeValuesOnly:"boolean"==typeof s.encodeValuesOnly?s.encodeValuesOnly:ee.encodeValuesOnly,filter:w,format:u,formatter:_,serializeDate:"function"==typeof s.serializeDate?s.serializeDate:ee.serializeDate,skipNulls:"boolean"==typeof s.skipNulls?s.skipNulls:ee.skipNulls,sort:"function"==typeof s.sort?s.sort:null,strictNullHandling:"boolean"==typeof s.strictNullHandling?s.strictNullHandling:ee.strictNullHandling}}(i);"function"==typeof $.filter?w=(0,$.filter)("",w):B($.filter)&&(u=$.filter);var U,Y=[];if("object"!=typeof w||null===w)return"";U=i&&i.arrayFormat in L?i.arrayFormat:i&&"indices"in i?i.indices?"indices":"repeat":"indices";var Z=L[U];if(i&&"commaRoundTrip"in i&&"boolean"!=typeof i.commaRoundTrip)throw new TypeError("`commaRoundTrip` must be a boolean, or absent");var ie="comma"===Z&&i&&i.commaRoundTrip;u||(u=Object.keys(w)),$.sort&&u.sort($.sort);for(var le=_(),ce=0;ce0?fe+de:""}},37720:(s,i,u)=>{"use strict";var _=u(74765),w=Object.prototype.hasOwnProperty,x=Array.isArray,j=function(){for(var s=[],i=0;i<256;++i)s.push("%"+((i<16?"0":"")+i.toString(16)).toUpperCase());return s}(),L=function arrayToObject(s,i){for(var u=i&&i.plainObjects?Object.create(null):{},_=0;_1;){var i=s.pop(),u=i.obj[i.prop];if(x(u)){for(var _=[],w=0;w=48&&U<=57||U>=65&&U<=90||U>=97&&U<=122||x===_.RFC1738&&(40===U||41===U)?B+=L.charAt($):U<128?B+=j[U]:U<2048?B+=j[192|U>>6]+j[128|63&U]:U<55296||U>=57344?B+=j[224|U>>12]+j[128|U>>6&63]+j[128|63&U]:($+=1,U=65536+((1023&U)<<10|1023&L.charCodeAt($)),B+=j[240|U>>18]+j[128|U>>12&63]+j[128|U>>6&63]+j[128|63&U])}return B},isBuffer:function isBuffer(s){return!(!s||"object"!=typeof s)&&!!(s.constructor&&s.constructor.isBuffer&&s.constructor.isBuffer(s))},isRegExp:function isRegExp(s){return"[object RegExp]"===Object.prototype.toString.call(s)},maybeMap:function maybeMap(s,i){if(x(s)){for(var u=[],_=0;_{"use strict";var u=Object.prototype.hasOwnProperty;function decode(s){try{return decodeURIComponent(s.replace(/\+/g," "))}catch(s){return null}}function encode(s){try{return encodeURIComponent(s)}catch(s){return null}}i.stringify=function querystringify(s,i){i=i||"";var _,w,x=[];for(w in"string"!=typeof i&&(i="?"),s)if(u.call(s,w)){if((_=s[w])||null!=_&&!isNaN(_)||(_=""),w=encode(w),_=encode(_),null===w||null===_)continue;x.push(w+"="+_)}return x.length?i+x.join("&"):""},i.parse=function querystring(s){for(var i,u=/([^=?#&]+)=?([^&]*)/g,_={};i=u.exec(s);){var w=decode(i[1]),x=decode(i[2]);null===w||null===x||w in _||(_[w]=x)}return _}},41859:(s,i,u)=>{const _=u(27096),w=u(78004),x=_.types;s.exports=class RandExp{constructor(s,i){if(this._setDefaults(s),s instanceof RegExp)this.ignoreCase=s.ignoreCase,this.multiline=s.multiline,s=s.source;else{if("string"!=typeof s)throw new Error("Expected a regexp or string");this.ignoreCase=i&&-1!==i.indexOf("i"),this.multiline=i&&-1!==i.indexOf("m")}this.tokens=_(s)}_setDefaults(s){this.max=null!=s.max?s.max:null!=RandExp.prototype.max?RandExp.prototype.max:100,this.defaultRange=s.defaultRange?s.defaultRange:this.defaultRange.clone(),s.randInt&&(this.randInt=s.randInt)}gen(){return this._gen(this.tokens,[])}_gen(s,i){var u,_,w,j,L;switch(s.type){case x.ROOT:case x.GROUP:if(s.followedBy||s.notFollowedBy)return"";for(s.remember&&void 0===s.groupNumber&&(s.groupNumber=i.push(null)-1),_="",j=0,L=(u=s.options?this._randSelect(s.options):s.stack).length;j{"use strict";var _=u(65606),w=65536,x=4294967295;var j=u(92861).Buffer,L=u.g.crypto||u.g.msCrypto;L&&L.getRandomValues?s.exports=function randomBytes(s,i){if(s>x)throw new RangeError("requested too many random bytes");var u=j.allocUnsafe(s);if(s>0)if(s>w)for(var B=0;B{"use strict";function _typeof(s){return _typeof="function"==typeof Symbol&&"symbol"==typeof Symbol.iterator?function(s){return typeof s}:function(s){return s&&"function"==typeof Symbol&&s.constructor===Symbol&&s!==Symbol.prototype?"symbol":typeof s},_typeof(s)}Object.defineProperty(i,"__esModule",{value:!0}),i.CopyToClipboard=void 0;var _=_interopRequireDefault(u(96540)),w=_interopRequireDefault(u(17965)),x=["text","onCopy","options","children"];function _interopRequireDefault(s){return s&&s.__esModule?s:{default:s}}function ownKeys(s,i){var u=Object.keys(s);if(Object.getOwnPropertySymbols){var _=Object.getOwnPropertySymbols(s);i&&(_=_.filter((function(i){return Object.getOwnPropertyDescriptor(s,i).enumerable}))),u.push.apply(u,_)}return u}function _objectSpread(s){for(var i=1;i=0||(w[u]=s[u]);return w}(s,i);if(Object.getOwnPropertySymbols){var x=Object.getOwnPropertySymbols(s);for(_=0;_=0||Object.prototype.propertyIsEnumerable.call(s,u)&&(w[u]=s[u])}return w}function _defineProperties(s,i){for(var u=0;u{"use strict";var _=u(25264).CopyToClipboard;_.CopyToClipboard=_,s.exports=_},81214:(s,i,u)=>{"use strict";function _typeof(s){return _typeof="function"==typeof Symbol&&"symbol"==typeof Symbol.iterator?function(s){return typeof s}:function(s){return s&&"function"==typeof Symbol&&s.constructor===Symbol&&s!==Symbol.prototype?"symbol":typeof s},_typeof(s)}Object.defineProperty(i,"__esModule",{value:!0}),i.DebounceInput=void 0;var _=_interopRequireDefault(u(96540)),w=_interopRequireDefault(u(20181)),x=["element","onChange","value","minLength","debounceTimeout","forceNotifyByEnter","forceNotifyOnBlur","onKeyDown","onBlur","inputRef"];function _interopRequireDefault(s){return s&&s.__esModule?s:{default:s}}function _objectWithoutProperties(s,i){if(null==s)return{};var u,_,w=function _objectWithoutPropertiesLoose(s,i){if(null==s)return{};var u,_,w={},x=Object.keys(s);for(_=0;_=0||(w[u]=s[u]);return w}(s,i);if(Object.getOwnPropertySymbols){var x=Object.getOwnPropertySymbols(s);for(_=0;_=0||Object.prototype.propertyIsEnumerable.call(s,u)&&(w[u]=s[u])}return w}function ownKeys(s,i){var u=Object.keys(s);if(Object.getOwnPropertySymbols){var _=Object.getOwnPropertySymbols(s);i&&(_=_.filter((function(i){return Object.getOwnPropertyDescriptor(s,i).enumerable}))),u.push.apply(u,_)}return u}function _objectSpread(s){for(var i=1;i=_?u.notify(s):i.length>w.length&&u.notify(_objectSpread(_objectSpread({},s),{},{target:_objectSpread(_objectSpread({},s.target),{},{value:""})}))}))})),_defineProperty(_assertThisInitialized(u),"onKeyDown",(function(s){"Enter"===s.key&&u.forceNotify(s);var i=u.props.onKeyDown;i&&(s.persist(),i(s))})),_defineProperty(_assertThisInitialized(u),"onBlur",(function(s){u.forceNotify(s);var i=u.props.onBlur;i&&(s.persist(),i(s))})),_defineProperty(_assertThisInitialized(u),"createNotifier",(function(s){if(s<0)u.notify=function(){return null};else if(0===s)u.notify=u.doNotify;else{var i=(0,w.default)((function(s){u.isDebouncing=!1,u.doNotify(s)}),s);u.notify=function(s){u.isDebouncing=!0,i(s)},u.flush=function(){return i.flush()},u.cancel=function(){u.isDebouncing=!1,i.cancel()}}})),_defineProperty(_assertThisInitialized(u),"doNotify",(function(){u.props.onChange.apply(void 0,arguments)})),_defineProperty(_assertThisInitialized(u),"forceNotify",(function(s){var i=u.props.debounceTimeout;if(u.isDebouncing||!(i>0)){u.cancel&&u.cancel();var _=u.state.value,w=u.props.minLength;_.length>=w?u.doNotify(s):u.doNotify(_objectSpread(_objectSpread({},s),{},{target:_objectSpread(_objectSpread({},s.target),{},{value:_})}))}})),u.isDebouncing=!1,u.state={value:void 0===s.value||null===s.value?"":s.value};var _=u.props.debounceTimeout;return u.createNotifier(_),u}return function _createClass(s,i,u){return i&&_defineProperties(s.prototype,i),u&&_defineProperties(s,u),Object.defineProperty(s,"prototype",{writable:!1}),s}(DebounceInput,[{key:"componentDidUpdate",value:function componentDidUpdate(s){if(!this.isDebouncing){var i=this.props,u=i.value,_=i.debounceTimeout,w=s.debounceTimeout,x=s.value,j=this.state.value;void 0!==u&&x!==u&&j!==u&&this.setState({value:u}),_!==w&&this.createNotifier(_)}}},{key:"componentWillUnmount",value:function componentWillUnmount(){this.flush&&this.flush()}},{key:"render",value:function render(){var s,i,u=this.props,w=u.element,j=(u.onChange,u.value,u.minLength,u.debounceTimeout,u.forceNotifyByEnter),L=u.forceNotifyOnBlur,B=u.onKeyDown,$=u.onBlur,U=u.inputRef,Y=_objectWithoutProperties(u,x),Z=this.state.value;s=j?{onKeyDown:this.onKeyDown}:B?{onKeyDown:B}:{},i=L?{onBlur:this.onBlur}:$?{onBlur:$}:{};var ee=U?{ref:U}:{};return _.default.createElement(w,_objectSpread(_objectSpread(_objectSpread(_objectSpread({},Y),{},{onChange:this.onChange,value:Z},s),i),ee))}}]),DebounceInput}(_.default.PureComponent);i.DebounceInput=j,_defineProperty(j,"defaultProps",{element:"input",type:"text",onKeyDown:void 0,onBlur:void 0,value:void 0,minLength:0,debounceTimeout:100,forceNotifyByEnter:!0,forceNotifyOnBlur:!0,inputRef:void 0})},24677:(s,i,u)=>{"use strict";var _=u(81214).DebounceInput;_.DebounceInput=_,s.exports=_},22551:(s,i,u)=>{"use strict";var _=u(96540),w=u(69982);function p(s){for(var i="https://reactjs.org/docs/error-decoder.html?invariant="+s,u=1;u
")}value(){return this.buffer}span(s){this.buffer+=``}}class TokenTree{constructor(){this.rootNode={children:[]},this.stack=[this.rootNode]}get top(){return this.stack[this.stack.length-1]}get root(){return this.rootNode}add(s){this.top.children.push(s)}openNode(s){const o={kind:s,children:[]};this.add(o),this.stack.push(o)}closeNode(){if(this.stack.length>1)return this.stack.pop()}closeAllNodes(){for(;this.closeNode(););}toJSON(){return JSON.stringify(this.rootNode,null,4)}walk(s){return this.constructor._walk(s,this.rootNode)}static _walk(s,o){return"string"==typeof o?s.addText(o):o.children&&(s.openNode(o),o.children.forEach((o=>this._walk(s,o))),s.closeNode(o)),s}static _collapse(s){"string"!=typeof s&&s.children&&(s.children.every((s=>"string"==typeof s))?s.children=[s.children.join("")]:s.children.forEach((s=>{TokenTree._collapse(s)})))}}class TokenTreeEmitter extends TokenTree{constructor(s){super(),this.options=s}addKeyword(s,o){""!==s&&(this.openNode(o),this.addText(s),this.closeNode())}addText(s){""!==s&&this.add(s)}addSublanguage(s,o){const i=s.root;i.kind=o,i.sublanguage=!0,this.add(i)}toHTML(){return new HTMLRenderer(this,this.options).value()}finalize(){return!0}}function source(s){return s?"string"==typeof s?s:s.source:null}const u=/\[(?:[^\\\]]|\\.)*\]|\(\??|\\([1-9][0-9]*)|\\./;const _="[a-zA-Z]\\w*",w="[a-zA-Z_]\\w*",x="\\b\\d+(\\.\\d+)?",C="(-?)(\\b0[xX][a-fA-F0-9]+|(\\b\\d+(\\.\\d*)?|\\.\\d+)([eE][-+]?\\d+)?)",j="\\b(0b[01]+)",L={begin:"\\\\[\\s\\S]",relevance:0},B={className:"string",begin:"'",end:"'",illegal:"\\n",contains:[L]},$={className:"string",begin:'"',end:'"',illegal:"\\n",contains:[L]},V={begin:/\b(a|an|the|are|I'm|isn't|don't|doesn't|won't|but|just|should|pretty|simply|enough|gonna|going|wtf|so|such|will|you|your|they|like|more)\b/},COMMENT=function(s,o,i={}){const u=inherit({className:"comment",begin:s,end:o,contains:[]},i);return u.contains.push(V),u.contains.push({className:"doctag",begin:"(?:TODO|FIXME|NOTE|BUG|OPTIMIZE|HACK|XXX):",relevance:0}),u},U=COMMENT("//","$"),z=COMMENT("/\\*","\\*/"),Y=COMMENT("#","$"),Z={className:"number",begin:x,relevance:0},ee={className:"number",begin:C,relevance:0},ie={className:"number",begin:j,relevance:0},ae={className:"number",begin:x+"(%|em|ex|ch|rem|vw|vh|vmin|vmax|cm|mm|in|pt|pc|px|deg|grad|rad|turn|s|ms|Hz|kHz|dpi|dpcm|dppx)?",relevance:0},le={begin:/(?=\/[^/\n]*\/)/,contains:[{className:"regexp",begin:/\//,end:/\/[gimuy]*/,illegal:/\n/,contains:[L,{begin:/\[/,end:/\]/,relevance:0,contains:[L]}]}]},ce={className:"title",begin:_,relevance:0},pe={className:"title",begin:w,relevance:0},de={begin:"\\.\\s*"+w,relevance:0};var fe=Object.freeze({__proto__:null,MATCH_NOTHING_RE:/\b\B/,IDENT_RE:_,UNDERSCORE_IDENT_RE:w,NUMBER_RE:x,C_NUMBER_RE:C,BINARY_NUMBER_RE:j,RE_STARTERS_RE:"!|!=|!==|%|%=|&|&&|&=|\\*|\\*=|\\+|\\+=|,|-|-=|/=|/|:|;|<<|<<=|<=|<|===|==|=|>>>=|>>=|>=|>>>|>>|>|\\?|\\[|\\{|\\(|\\^|\\^=|\\||\\|=|\\|\\||~",SHEBANG:(s={})=>{const o=/^#![ ]*\//;return s.binary&&(s.begin=function concat(...s){return s.map((s=>source(s))).join("")}(o,/.*\b/,s.binary,/\b.*/)),inherit({className:"meta",begin:o,end:/$/,relevance:0,"on:begin":(s,o)=>{0!==s.index&&o.ignoreMatch()}},s)},BACKSLASH_ESCAPE:L,APOS_STRING_MODE:B,QUOTE_STRING_MODE:$,PHRASAL_WORDS_MODE:V,COMMENT,C_LINE_COMMENT_MODE:U,C_BLOCK_COMMENT_MODE:z,HASH_COMMENT_MODE:Y,NUMBER_MODE:Z,C_NUMBER_MODE:ee,BINARY_NUMBER_MODE:ie,CSS_NUMBER_MODE:ae,REGEXP_MODE:le,TITLE_MODE:ce,UNDERSCORE_TITLE_MODE:pe,METHOD_GUARD:de,END_SAME_AS_BEGIN:function(s){return Object.assign(s,{"on:begin":(s,o)=>{o.data._beginMatch=s[1]},"on:end":(s,o)=>{o.data._beginMatch!==s[1]&&o.ignoreMatch()}})}});function skipIfhasPrecedingDot(s,o){"."===s.input[s.index-1]&&o.ignoreMatch()}function beginKeywords(s,o){o&&s.beginKeywords&&(s.begin="\\b("+s.beginKeywords.split(" ").join("|")+")(?!\\.)(?=\\b|\\s)",s.__beforeBegin=skipIfhasPrecedingDot,s.keywords=s.keywords||s.beginKeywords,delete s.beginKeywords,void 0===s.relevance&&(s.relevance=0))}function compileIllegal(s,o){Array.isArray(s.illegal)&&(s.illegal=function either(...s){return"("+s.map((s=>source(s))).join("|")+")"}(...s.illegal))}function compileMatch(s,o){if(s.match){if(s.begin||s.end)throw new Error("begin & end are not supported with match");s.begin=s.match,delete s.match}}function compileRelevance(s,o){void 0===s.relevance&&(s.relevance=1)}const ye=["of","and","for","in","not","or","if","then","parent","list","value"];function compileKeywords(s,o,i="keyword"){const u={};return"string"==typeof s?compileList(i,s.split(" ")):Array.isArray(s)?compileList(i,s):Object.keys(s).forEach((function(i){Object.assign(u,compileKeywords(s[i],o,i))})),u;function compileList(s,i){o&&(i=i.map((s=>s.toLowerCase()))),i.forEach((function(o){const i=o.split("|");u[i[0]]=[s,scoreForKeyword(i[0],i[1])]}))}}function scoreForKeyword(s,o){return o?Number(o):function commonKeyword(s){return ye.includes(s.toLowerCase())}(s)?0:1}function compileLanguage(s,{plugins:o}){function langRe(o,i){return new RegExp(source(o),"m"+(s.case_insensitive?"i":"")+(i?"g":""))}class MultiRegex{constructor(){this.matchIndexes={},this.regexes=[],this.matchAt=1,this.position=0}addRule(s,o){o.position=this.position++,this.matchIndexes[this.matchAt]=o,this.regexes.push([o,s]),this.matchAt+=function countMatchGroups(s){return new RegExp(s.toString()+"|").exec("").length-1}(s)+1}compile(){0===this.regexes.length&&(this.exec=()=>null);const s=this.regexes.map((s=>s[1]));this.matcherRe=langRe(function join(s,o="|"){let i=0;return s.map((s=>{i+=1;const o=i;let _=source(s),w="";for(;_.length>0;){const s=u.exec(_);if(!s){w+=_;break}w+=_.substring(0,s.index),_=_.substring(s.index+s[0].length),"\\"===s[0][0]&&s[1]?w+="\\"+String(Number(s[1])+o):(w+=s[0],"("===s[0]&&i++)}return w})).map((s=>`(${s})`)).join(o)}(s),!0),this.lastIndex=0}exec(s){this.matcherRe.lastIndex=this.lastIndex;const o=this.matcherRe.exec(s);if(!o)return null;const i=o.findIndex(((s,o)=>o>0&&void 0!==s)),u=this.matchIndexes[i];return o.splice(0,i),Object.assign(o,u)}}class ResumableMultiRegex{constructor(){this.rules=[],this.multiRegexes=[],this.count=0,this.lastIndex=0,this.regexIndex=0}getMatcher(s){if(this.multiRegexes[s])return this.multiRegexes[s];const o=new MultiRegex;return this.rules.slice(s).forEach((([s,i])=>o.addRule(s,i))),o.compile(),this.multiRegexes[s]=o,o}resumingScanAtSamePosition(){return 0!==this.regexIndex}considerAll(){this.regexIndex=0}addRule(s,o){this.rules.push([s,o]),"begin"===o.type&&this.count++}exec(s){const o=this.getMatcher(this.regexIndex);o.lastIndex=this.lastIndex;let i=o.exec(s);if(this.resumingScanAtSamePosition())if(i&&i.index===this.lastIndex);else{const o=this.getMatcher(0);o.lastIndex=this.lastIndex+1,i=o.exec(s)}return i&&(this.regexIndex+=i.position+1,this.regexIndex===this.count&&this.considerAll()),i}}if(s.compilerExtensions||(s.compilerExtensions=[]),s.contains&&s.contains.includes("self"))throw new Error("ERR: contains `self` is not supported at the top-level of a language. See documentation.");return s.classNameAliases=inherit(s.classNameAliases||{}),function compileMode(o,i){const u=o;if(o.isCompiled)return u;[compileMatch].forEach((s=>s(o,i))),s.compilerExtensions.forEach((s=>s(o,i))),o.__beforeBegin=null,[beginKeywords,compileIllegal,compileRelevance].forEach((s=>s(o,i))),o.isCompiled=!0;let _=null;if("object"==typeof o.keywords&&(_=o.keywords.$pattern,delete o.keywords.$pattern),o.keywords&&(o.keywords=compileKeywords(o.keywords,s.case_insensitive)),o.lexemes&&_)throw new Error("ERR: Prefer `keywords.$pattern` to `mode.lexemes`, BOTH are not allowed. (see mode reference) ");return _=_||o.lexemes||/\w+/,u.keywordPatternRe=langRe(_,!0),i&&(o.begin||(o.begin=/\B|\b/),u.beginRe=langRe(o.begin),o.endSameAsBegin&&(o.end=o.begin),o.end||o.endsWithParent||(o.end=/\B|\b/),o.end&&(u.endRe=langRe(o.end)),u.terminatorEnd=source(o.end)||"",o.endsWithParent&&i.terminatorEnd&&(u.terminatorEnd+=(o.end?"|":"")+i.terminatorEnd)),o.illegal&&(u.illegalRe=langRe(o.illegal)),o.contains||(o.contains=[]),o.contains=[].concat(...o.contains.map((function(s){return function expandOrCloneMode(s){s.variants&&!s.cachedVariants&&(s.cachedVariants=s.variants.map((function(o){return inherit(s,{variants:null},o)})));if(s.cachedVariants)return s.cachedVariants;if(dependencyOnParent(s))return inherit(s,{starts:s.starts?inherit(s.starts):null});if(Object.isFrozen(s))return inherit(s);return s}("self"===s?o:s)}))),o.contains.forEach((function(s){compileMode(s,u)})),o.starts&&compileMode(o.starts,i),u.matcher=function buildModeRegex(s){const o=new ResumableMultiRegex;return s.contains.forEach((s=>o.addRule(s.begin,{rule:s,type:"begin"}))),s.terminatorEnd&&o.addRule(s.terminatorEnd,{type:"end"}),s.illegal&&o.addRule(s.illegal,{type:"illegal"}),o}(u),u}(s)}function dependencyOnParent(s){return!!s&&(s.endsWithParent||dependencyOnParent(s.starts))}function BuildVuePlugin(s){const o={props:["language","code","autodetect"],data:function(){return{detectedLanguage:"",unknownLanguage:!1}},computed:{className(){return this.unknownLanguage?"":"hljs "+this.detectedLanguage},highlighted(){if(!this.autoDetect&&!s.getLanguage(this.language))return console.warn(`The language "${this.language}" you specified could not be found.`),this.unknownLanguage=!0,escapeHTML(this.code);let o={};return this.autoDetect?(o=s.highlightAuto(this.code),this.detectedLanguage=o.language):(o=s.highlight(this.language,this.code,this.ignoreIllegals),this.detectedLanguage=this.language),o.value},autoDetect(){return!this.language||function hasValueOrEmptyAttribute(s){return Boolean(s||""===s)}(this.autodetect)},ignoreIllegals:()=>!0},render(s){return s("pre",{},[s("code",{class:this.className,domProps:{innerHTML:this.highlighted}})])}};return{Component:o,VuePlugin:{install(s){s.component("highlightjs",o)}}}}const be={"after:highlightElement":({el:s,result:o,text:i})=>{const u=nodeStream(s);if(!u.length)return;const _=document.createElement("div");_.innerHTML=o.value,o.value=function mergeStreams(s,o,i){let u=0,_="";const w=[];function selectStream(){return s.length&&o.length?s[0].offset!==o[0].offset?s[0].offset"}function close(s){_+=""}function render(s){("start"===s.event?open:close)(s.node)}for(;s.length||o.length;){let o=selectStream();if(_+=escapeHTML(i.substring(u,o[0].offset)),u=o[0].offset,o===s){w.reverse().forEach(close);do{render(o.splice(0,1)[0]),o=selectStream()}while(o===s&&o.length&&o[0].offset===u);w.reverse().forEach(open)}else"start"===o[0].event?w.push(o[0].node):w.pop(),render(o.splice(0,1)[0])}return _+escapeHTML(i.substr(u))}(u,nodeStream(_),i)}};function tag(s){return s.nodeName.toLowerCase()}function nodeStream(s){const o=[];return function _nodeStream(s,i){for(let u=s.firstChild;u;u=u.nextSibling)3===u.nodeType?i+=u.nodeValue.length:1===u.nodeType&&(o.push({event:"start",offset:i,node:u}),i=_nodeStream(u,i),tag(u).match(/br|hr|img|input/)||o.push({event:"stop",offset:i,node:u}));return i}(s,0),o}const _e={},error=s=>{console.error(s)},warn=(s,...o)=>{console.log(`WARN: ${s}`,...o)},deprecated=(s,o)=>{_e[`${s}/${o}`]||(console.log(`Deprecated as of ${s}. ${o}`),_e[`${s}/${o}`]=!0)},we=escapeHTML,Se=inherit,xe=Symbol("nomatch");var Pe=function(s){const i=Object.create(null),u=Object.create(null),_=[];let w=!0;const x=/(^(<[^>]+>|\t|)+|\n)/gm,C="Could not find the language '{}', did you forget to load/include a language module?",j={disableAutodetect:!0,name:"Plain text",contains:[]};let L={noHighlightRe:/^(no-?highlight)$/i,languageDetectRe:/\blang(?:uage)?-([\w-]+)\b/i,classPrefix:"hljs-",tabReplace:null,useBR:!1,languages:null,__emitter:TokenTreeEmitter};function shouldNotHighlight(s){return L.noHighlightRe.test(s)}function highlight(s,o,i,u){let _="",w="";"object"==typeof o?(_=s,i=o.ignoreIllegals,w=o.language,u=void 0):(deprecated("10.7.0","highlight(lang, code, ...args) has been deprecated."),deprecated("10.7.0","Please use highlight(code, options) instead.\nhttps://github.com/highlightjs/highlight.js/issues/2277"),w=s,_=o);const x={code:_,language:w};fire("before:highlight",x);const C=x.result?x.result:_highlight(x.language,x.code,i,u);return C.code=x.code,fire("after:highlight",C),C}function _highlight(s,o,u,x){function keywordData(s,o){const i=B.case_insensitive?o[0].toLowerCase():o[0];return Object.prototype.hasOwnProperty.call(s.keywords,i)&&s.keywords[i]}function processBuffer(){null!=U.subLanguage?function processSubLanguage(){if(""===Z)return;let s=null;if("string"==typeof U.subLanguage){if(!i[U.subLanguage])return void Y.addText(Z);s=_highlight(U.subLanguage,Z,!0,z[U.subLanguage]),z[U.subLanguage]=s.top}else s=highlightAuto(Z,U.subLanguage.length?U.subLanguage:null);U.relevance>0&&(ee+=s.relevance),Y.addSublanguage(s.emitter,s.language)}():function processKeywords(){if(!U.keywords)return void Y.addText(Z);let s=0;U.keywordPatternRe.lastIndex=0;let o=U.keywordPatternRe.exec(Z),i="";for(;o;){i+=Z.substring(s,o.index);const u=keywordData(U,o);if(u){const[s,_]=u;if(Y.addText(i),i="",ee+=_,s.startsWith("_"))i+=o[0];else{const i=B.classNameAliases[s]||s;Y.addKeyword(o[0],i)}}else i+=o[0];s=U.keywordPatternRe.lastIndex,o=U.keywordPatternRe.exec(Z)}i+=Z.substr(s),Y.addText(i)}(),Z=""}function startNewMode(s){return s.className&&Y.openNode(B.classNameAliases[s.className]||s.className),U=Object.create(s,{parent:{value:U}}),U}function endOfMode(s,o,i){let u=function startsWith(s,o){const i=s&&s.exec(o);return i&&0===i.index}(s.endRe,i);if(u){if(s["on:end"]){const i=new Response(s);s["on:end"](o,i),i.isMatchIgnored&&(u=!1)}if(u){for(;s.endsParent&&s.parent;)s=s.parent;return s}}if(s.endsWithParent)return endOfMode(s.parent,o,i)}function doIgnore(s){return 0===U.matcher.regexIndex?(Z+=s[0],1):(le=!0,0)}function doBeginMatch(s){const o=s[0],i=s.rule,u=new Response(i),_=[i.__beforeBegin,i["on:begin"]];for(const i of _)if(i&&(i(s,u),u.isMatchIgnored))return doIgnore(o);return i&&i.endSameAsBegin&&(i.endRe=function escape(s){return new RegExp(s.replace(/[-/\\^$*+?.()|[\]{}]/g,"\\$&"),"m")}(o)),i.skip?Z+=o:(i.excludeBegin&&(Z+=o),processBuffer(),i.returnBegin||i.excludeBegin||(Z=o)),startNewMode(i),i.returnBegin?0:o.length}function doEndMatch(s){const i=s[0],u=o.substr(s.index),_=endOfMode(U,s,u);if(!_)return xe;const w=U;w.skip?Z+=i:(w.returnEnd||w.excludeEnd||(Z+=i),processBuffer(),w.excludeEnd&&(Z=i));do{U.className&&Y.closeNode(),U.skip||U.subLanguage||(ee+=U.relevance),U=U.parent}while(U!==_.parent);return _.starts&&(_.endSameAsBegin&&(_.starts.endRe=_.endRe),startNewMode(_.starts)),w.returnEnd?0:i.length}let j={};function processLexeme(i,_){const x=_&&_[0];if(Z+=i,null==x)return processBuffer(),0;if("begin"===j.type&&"end"===_.type&&j.index===_.index&&""===x){if(Z+=o.slice(_.index,_.index+1),!w){const o=new Error("0 width match regex");throw o.languageName=s,o.badRule=j.rule,o}return 1}if(j=_,"begin"===_.type)return doBeginMatch(_);if("illegal"===_.type&&!u){const s=new Error('Illegal lexeme "'+x+'" for mode "'+(U.className||"")+'"');throw s.mode=U,s}if("end"===_.type){const s=doEndMatch(_);if(s!==xe)return s}if("illegal"===_.type&&""===x)return 1;if(ae>1e5&&ae>3*_.index){throw new Error("potential infinite loop, way more iterations than matches")}return Z+=x,x.length}const B=getLanguage(s);if(!B)throw error(C.replace("{}",s)),new Error('Unknown language: "'+s+'"');const $=compileLanguage(B,{plugins:_});let V="",U=x||$;const z={},Y=new L.__emitter(L);!function processContinuations(){const s=[];for(let o=U;o!==B;o=o.parent)o.className&&s.unshift(o.className);s.forEach((s=>Y.openNode(s)))}();let Z="",ee=0,ie=0,ae=0,le=!1;try{for(U.matcher.considerAll();;){ae++,le?le=!1:U.matcher.considerAll(),U.matcher.lastIndex=ie;const s=U.matcher.exec(o);if(!s)break;const i=processLexeme(o.substring(ie,s.index),s);ie=s.index+i}return processLexeme(o.substr(ie)),Y.closeAllNodes(),Y.finalize(),V=Y.toHTML(),{relevance:Math.floor(ee),value:V,language:s,illegal:!1,emitter:Y,top:U}}catch(i){if(i.message&&i.message.includes("Illegal"))return{illegal:!0,illegalBy:{msg:i.message,context:o.slice(ie-100,ie+100),mode:i.mode},sofar:V,relevance:0,value:we(o),emitter:Y};if(w)return{illegal:!1,relevance:0,value:we(o),emitter:Y,language:s,top:U,errorRaised:i};throw i}}function highlightAuto(s,o){o=o||L.languages||Object.keys(i);const u=function justTextHighlightResult(s){const o={relevance:0,emitter:new L.__emitter(L),value:we(s),illegal:!1,top:j};return o.emitter.addText(s),o}(s),_=o.filter(getLanguage).filter(autoDetection).map((o=>_highlight(o,s,!1)));_.unshift(u);const w=_.sort(((s,o)=>{if(s.relevance!==o.relevance)return o.relevance-s.relevance;if(s.language&&o.language){if(getLanguage(s.language).supersetOf===o.language)return 1;if(getLanguage(o.language).supersetOf===s.language)return-1}return 0})),[x,C]=w,B=x;return B.second_best=C,B}const B={"before:highlightElement":({el:s})=>{L.useBR&&(s.innerHTML=s.innerHTML.replace(/\n/g,"").replace(//g,"\n"))},"after:highlightElement":({result:s})=>{L.useBR&&(s.value=s.value.replace(/\n/g,"
"))}},$=/^(<[^>]+>|\t)+/gm,V={"after:highlightElement":({result:s})=>{L.tabReplace&&(s.value=s.value.replace($,(s=>s.replace(/\t/g,L.tabReplace))))}};function highlightElement(s){let o=null;const i=function blockLanguage(s){let o=s.className+" ";o+=s.parentNode?s.parentNode.className:"";const i=L.languageDetectRe.exec(o);if(i){const o=getLanguage(i[1]);return o||(warn(C.replace("{}",i[1])),warn("Falling back to no-highlight mode for this block.",s)),o?i[1]:"no-highlight"}return o.split(/\s+/).find((s=>shouldNotHighlight(s)||getLanguage(s)))}(s);if(shouldNotHighlight(i))return;fire("before:highlightElement",{el:s,language:i}),o=s;const _=o.textContent,w=i?highlight(_,{language:i,ignoreIllegals:!0}):highlightAuto(_);fire("after:highlightElement",{el:s,result:w,text:_}),s.innerHTML=w.value,function updateClassName(s,o,i){const _=o?u[o]:i;s.classList.add("hljs"),_&&s.classList.add(_)}(s,i,w.language),s.result={language:w.language,re:w.relevance,relavance:w.relevance},w.second_best&&(s.second_best={language:w.second_best.language,re:w.second_best.relevance,relavance:w.second_best.relevance})}const initHighlighting=()=>{if(initHighlighting.called)return;initHighlighting.called=!0,deprecated("10.6.0","initHighlighting() is deprecated. Use highlightAll() instead.");document.querySelectorAll("pre code").forEach(highlightElement)};let U=!1;function highlightAll(){if("loading"===document.readyState)return void(U=!0);document.querySelectorAll("pre code").forEach(highlightElement)}function getLanguage(s){return s=(s||"").toLowerCase(),i[s]||i[u[s]]}function registerAliases(s,{languageName:o}){"string"==typeof s&&(s=[s]),s.forEach((s=>{u[s.toLowerCase()]=o}))}function autoDetection(s){const o=getLanguage(s);return o&&!o.disableAutodetect}function fire(s,o){const i=s;_.forEach((function(s){s[i]&&s[i](o)}))}"undefined"!=typeof window&&window.addEventListener&&window.addEventListener("DOMContentLoaded",(function boot(){U&&highlightAll()}),!1),Object.assign(s,{highlight,highlightAuto,highlightAll,fixMarkup:function deprecateFixMarkup(s){return deprecated("10.2.0","fixMarkup will be removed entirely in v11.0"),deprecated("10.2.0","Please see https://github.com/highlightjs/highlight.js/issues/2534"),function fixMarkup(s){return L.tabReplace||L.useBR?s.replace(x,(s=>"\n"===s?L.useBR?"
":s:L.tabReplace?s.replace(/\t/g,L.tabReplace):s)):s}(s)},highlightElement,highlightBlock:function deprecateHighlightBlock(s){return deprecated("10.7.0","highlightBlock will be removed entirely in v12.0"),deprecated("10.7.0","Please use highlightElement now."),highlightElement(s)},configure:function configure(s){s.useBR&&(deprecated("10.3.0","'useBR' will be removed entirely in v11.0"),deprecated("10.3.0","Please see https://github.com/highlightjs/highlight.js/issues/2559")),L=Se(L,s)},initHighlighting,initHighlightingOnLoad:function initHighlightingOnLoad(){deprecated("10.6.0","initHighlightingOnLoad() is deprecated. Use highlightAll() instead."),U=!0},registerLanguage:function registerLanguage(o,u){let _=null;try{_=u(s)}catch(s){if(error("Language definition for '{}' could not be registered.".replace("{}",o)),!w)throw s;error(s),_=j}_.name||(_.name=o),i[o]=_,_.rawDefinition=u.bind(null,s),_.aliases&®isterAliases(_.aliases,{languageName:o})},unregisterLanguage:function unregisterLanguage(s){delete i[s];for(const o of Object.keys(u))u[o]===s&&delete u[o]},listLanguages:function listLanguages(){return Object.keys(i)},getLanguage,registerAliases,requireLanguage:function requireLanguage(s){deprecated("10.4.0","requireLanguage will be removed entirely in v11."),deprecated("10.4.0","Please see https://github.com/highlightjs/highlight.js/pull/2844");const o=getLanguage(s);if(o)return o;throw new Error("The '{}' language is required, but not loaded.".replace("{}",s))},autoDetection,inherit:Se,addPlugin:function addPlugin(s){!function upgradePluginAPI(s){s["before:highlightBlock"]&&!s["before:highlightElement"]&&(s["before:highlightElement"]=o=>{s["before:highlightBlock"](Object.assign({block:o.el},o))}),s["after:highlightBlock"]&&!s["after:highlightElement"]&&(s["after:highlightElement"]=o=>{s["after:highlightBlock"](Object.assign({block:o.el},o))})}(s),_.push(s)},vuePlugin:BuildVuePlugin(s).VuePlugin}),s.debugMode=function(){w=!1},s.safeMode=function(){w=!0},s.versionString="10.7.3";for(const s in fe)"object"==typeof fe[s]&&o(fe[s]);return Object.assign(s,fe),s.addPlugin(B),s.addPlugin(be),s.addPlugin(V),s}({});s.exports=Pe},35344:s=>{function concat(...s){return s.map((s=>function source(s){return s?"string"==typeof s?s:s.source:null}(s))).join("")}s.exports=function bash(s){const o={},i={begin:/\$\{/,end:/\}/,contains:["self",{begin:/:-/,contains:[o]}]};Object.assign(o,{className:"variable",variants:[{begin:concat(/\$[\w\d#@][\w\d_]*/,"(?![\\w\\d])(?![$])")},i]});const u={className:"subst",begin:/\$\(/,end:/\)/,contains:[s.BACKSLASH_ESCAPE]},_={begin:/<<-?\s*(?=\w+)/,starts:{contains:[s.END_SAME_AS_BEGIN({begin:/(\w+)/,end:/(\w+)/,className:"string"})]}},w={className:"string",begin:/"/,end:/"/,contains:[s.BACKSLASH_ESCAPE,o,u]};u.contains.push(w);const x={begin:/\$\(\(/,end:/\)\)/,contains:[{begin:/\d+#[0-9a-f]+/,className:"number"},s.NUMBER_MODE,o]},C=s.SHEBANG({binary:`(${["fish","bash","zsh","sh","csh","ksh","tcsh","dash","scsh"].join("|")})`,relevance:10}),j={className:"function",begin:/\w[\w\d_]*\s*\(\s*\)\s*\{/,returnBegin:!0,contains:[s.inherit(s.TITLE_MODE,{begin:/\w[\w\d_]*/})],relevance:0};return{name:"Bash",aliases:["sh","zsh"],keywords:{$pattern:/\b[a-z._-]+\b/,keyword:"if then else elif fi for while in do done case esac function",literal:"true false",built_in:"break cd continue eval exec exit export getopts hash pwd readonly return shift test times trap umask unset alias bind builtin caller command declare echo enable help let local logout mapfile printf read readarray source type typeset ulimit unalias set shopt autoload bg bindkey bye cap chdir clone comparguments compcall compctl compdescribe compfiles compgroups compquote comptags comptry compvalues dirs disable disown echotc echoti emulate fc fg float functions getcap getln history integer jobs kill limit log noglob popd print pushd pushln rehash sched setcap setopt stat suspend ttyctl unfunction unhash unlimit unsetopt vared wait whence where which zcompile zformat zftp zle zmodload zparseopts zprof zpty zregexparse zsocket zstyle ztcp"},contains:[C,s.SHEBANG(),j,x,s.HASH_COMMENT_MODE,_,w,{className:"",begin:/\\"/},{className:"string",begin:/'/,end:/'/},o]}}},73402:s=>{function concat(...s){return s.map((s=>function source(s){return s?"string"==typeof s?s:s.source:null}(s))).join("")}s.exports=function http(s){const o="HTTP/(2|1\\.[01])",i={className:"attribute",begin:concat("^",/[A-Za-z][A-Za-z0-9-]*/,"(?=\\:\\s)"),starts:{contains:[{className:"punctuation",begin:/: /,relevance:0,starts:{end:"$",relevance:0}}]}},u=[i,{begin:"\\n\\n",starts:{subLanguage:[],endsWithParent:!0}}];return{name:"HTTP",aliases:["https"],illegal:/\S/,contains:[{begin:"^(?="+o+" \\d{3})",end:/$/,contains:[{className:"meta",begin:o},{className:"number",begin:"\\b\\d{3}\\b"}],starts:{end:/\b\B/,illegal:/\S/,contains:u}},{begin:"(?=^[A-Z]+ (.*?) "+o+"$)",end:/$/,contains:[{className:"string",begin:" ",end:" ",excludeBegin:!0,excludeEnd:!0},{className:"meta",begin:o},{className:"keyword",begin:"[A-Z]+"}],starts:{end:/\b\B/,illegal:/\S/,contains:u}},s.inherit(i,{relevance:0})]}}},95089:s=>{const o="[A-Za-z$_][0-9A-Za-z$_]*",i=["as","in","of","if","for","while","finally","var","new","function","do","return","void","else","break","catch","instanceof","with","throw","case","default","try","switch","continue","typeof","delete","let","yield","const","class","debugger","async","await","static","import","from","export","extends"],u=["true","false","null","undefined","NaN","Infinity"],_=[].concat(["setInterval","setTimeout","clearInterval","clearTimeout","require","exports","eval","isFinite","isNaN","parseFloat","parseInt","decodeURI","decodeURIComponent","encodeURI","encodeURIComponent","escape","unescape"],["arguments","this","super","console","window","document","localStorage","module","global"],["Intl","DataView","Number","Math","Date","String","RegExp","Object","Function","Boolean","Error","Symbol","Set","Map","WeakSet","WeakMap","Proxy","Reflect","JSON","Promise","Float64Array","Int16Array","Int32Array","Int8Array","Uint16Array","Uint32Array","Float32Array","Array","Uint8Array","Uint8ClampedArray","ArrayBuffer","BigInt64Array","BigUint64Array","BigInt"],["EvalError","InternalError","RangeError","ReferenceError","SyntaxError","TypeError","URIError"]);function lookahead(s){return concat("(?=",s,")")}function concat(...s){return s.map((s=>function source(s){return s?"string"==typeof s?s:s.source:null}(s))).join("")}s.exports=function javascript(s){const w=o,x="<>",C="",j={begin:/<[A-Za-z0-9\\._:-]+/,end:/\/[A-Za-z0-9\\._:-]+>|\/>/,isTrulyOpeningTag:(s,o)=>{const i=s[0].length+s.index,u=s.input[i];"<"!==u?">"===u&&(((s,{after:o})=>{const i="",returnBegin:!0,end:"\\s*=>",contains:[{className:"params",variants:[{begin:s.UNDERSCORE_IDENT_RE,relevance:0},{className:null,begin:/\(\s*\)/,skip:!0},{begin:/\(/,end:/\)/,excludeBegin:!0,excludeEnd:!0,keywords:L,contains:ce}]}]},{begin:/,/,relevance:0},{className:"",begin:/\s/,end:/\s*/,skip:!0},{variants:[{begin:x,end:C},{begin:j.begin,"on:begin":j.isTrulyOpeningTag,end:j.end}],subLanguage:"xml",contains:[{begin:j.begin,end:j.end,skip:!0,contains:["self"]}]}],relevance:0},{className:"function",beginKeywords:"function",end:/[{;]/,excludeEnd:!0,keywords:L,contains:["self",s.inherit(s.TITLE_MODE,{begin:w}),pe],illegal:/%/},{beginKeywords:"while if switch catch for"},{className:"function",begin:s.UNDERSCORE_IDENT_RE+"\\([^()]*(\\([^()]*(\\([^()]*\\)[^()]*)*\\)[^()]*)*\\)\\s*\\{",returnBegin:!0,contains:[pe,s.inherit(s.TITLE_MODE,{begin:w})]},{variants:[{begin:"\\."+w},{begin:"\\$"+w}],relevance:0},{className:"class",beginKeywords:"class",end:/[{;=]/,excludeEnd:!0,illegal:/[:"[\]]/,contains:[{beginKeywords:"extends"},s.UNDERSCORE_TITLE_MODE]},{begin:/\b(?=constructor)/,end:/[{;]/,excludeEnd:!0,contains:[s.inherit(s.TITLE_MODE,{begin:w}),"self",pe]},{begin:"(get|set)\\s+(?="+w+"\\()",end:/\{/,keywords:"get set",contains:[s.inherit(s.TITLE_MODE,{begin:w}),{begin:/\(\)/},pe]},{begin:/\$[(.]/}]}}},65772:s=>{s.exports=function json(s){const o={literal:"true false null"},i=[s.C_LINE_COMMENT_MODE,s.C_BLOCK_COMMENT_MODE],u=[s.QUOTE_STRING_MODE,s.C_NUMBER_MODE],_={end:",",endsWithParent:!0,excludeEnd:!0,contains:u,keywords:o},w={begin:/\{/,end:/\}/,contains:[{className:"attr",begin:/"/,end:/"/,contains:[s.BACKSLASH_ESCAPE],illegal:"\\n"},s.inherit(_,{begin:/:/})].concat(i),illegal:"\\S"},x={begin:"\\[",end:"\\]",contains:[s.inherit(_)],illegal:"\\S"};return u.push(w,x),i.forEach((function(s){u.push(s)})),{name:"JSON",contains:u,keywords:o,illegal:"\\S"}}},26571:s=>{s.exports=function powershell(s){const o={$pattern:/-?[A-z\.\-]+\b/,keyword:"if else foreach return do while until elseif begin for trap data dynamicparam end break throw param continue finally in switch exit filter try process catch hidden static parameter",built_in:"ac asnp cat cd CFS chdir clc clear clhy cli clp cls clv cnsn compare copy cp cpi cpp curl cvpa dbp del diff dir dnsn ebp echo|0 epal epcsv epsn erase etsn exsn fc fhx fl ft fw gal gbp gc gcb gci gcm gcs gdr gerr ghy gi gin gjb gl gm gmo gp gps gpv group gsn gsnp gsv gtz gu gv gwmi h history icm iex ihy ii ipal ipcsv ipmo ipsn irm ise iwmi iwr kill lp ls man md measure mi mount move mp mv nal ndr ni nmo npssc nsn nv ogv oh popd ps pushd pwd r rbp rcjb rcsn rd rdr ren ri rjb rm rmdir rmo rni rnp rp rsn rsnp rujb rv rvpa rwmi sajb sal saps sasv sbp sc scb select set shcm si sl sleep sls sort sp spjb spps spsv start stz sujb sv swmi tee trcm type wget where wjb write"},i={begin:"`[\\s\\S]",relevance:0},u={className:"variable",variants:[{begin:/\$\B/},{className:"keyword",begin:/\$this/},{begin:/\$[\w\d][\w\d_:]*/}]},_={className:"string",variants:[{begin:/"/,end:/"/},{begin:/@"/,end:/^"@/}],contains:[i,u,{className:"variable",begin:/\$[A-z]/,end:/[^A-z]/}]},w={className:"string",variants:[{begin:/'/,end:/'/},{begin:/@'/,end:/^'@/}]},x=s.inherit(s.COMMENT(null,null),{variants:[{begin:/#/,end:/$/},{begin:/<#/,end:/#>/}],contains:[{className:"doctag",variants:[{begin:/\.(synopsis|description|example|inputs|outputs|notes|link|component|role|functionality)/},{begin:/\.(parameter|forwardhelptargetname|forwardhelpcategory|remotehelprunspace|externalhelp)\s+\S+/}]}]}),C={className:"built_in",variants:[{begin:"(".concat("Add|Clear|Close|Copy|Enter|Exit|Find|Format|Get|Hide|Join|Lock|Move|New|Open|Optimize|Pop|Push|Redo|Remove|Rename|Reset|Resize|Search|Select|Set|Show|Skip|Split|Step|Switch|Undo|Unlock|Watch|Backup|Checkpoint|Compare|Compress|Convert|ConvertFrom|ConvertTo|Dismount|Edit|Expand|Export|Group|Import|Initialize|Limit|Merge|Mount|Out|Publish|Restore|Save|Sync|Unpublish|Update|Approve|Assert|Build|Complete|Confirm|Deny|Deploy|Disable|Enable|Install|Invoke|Register|Request|Restart|Resume|Start|Stop|Submit|Suspend|Uninstall|Unregister|Wait|Debug|Measure|Ping|Repair|Resolve|Test|Trace|Connect|Disconnect|Read|Receive|Send|Write|Block|Grant|Protect|Revoke|Unblock|Unprotect|Use|ForEach|Sort|Tee|Where",")+(-)[\\w\\d]+")}]},j={className:"class",beginKeywords:"class enum",end:/\s*[{]/,excludeEnd:!0,relevance:0,contains:[s.TITLE_MODE]},L={className:"function",begin:/function\s+/,end:/\s*\{|$/,excludeEnd:!0,returnBegin:!0,relevance:0,contains:[{begin:"function",relevance:0,className:"keyword"},{className:"title",begin:/\w[\w\d]*((-)[\w\d]+)*/,relevance:0},{begin:/\(/,end:/\)/,className:"params",relevance:0,contains:[u]}]},B={begin:/using\s/,end:/$/,returnBegin:!0,contains:[_,w,{className:"keyword",begin:/(using|assembly|command|module|namespace|type)/}]},$={variants:[{className:"operator",begin:"(".concat("-and|-as|-band|-bnot|-bor|-bxor|-casesensitive|-ccontains|-ceq|-cge|-cgt|-cle|-clike|-clt|-cmatch|-cne|-cnotcontains|-cnotlike|-cnotmatch|-contains|-creplace|-csplit|-eq|-exact|-f|-file|-ge|-gt|-icontains|-ieq|-ige|-igt|-ile|-ilike|-ilt|-imatch|-in|-ine|-inotcontains|-inotlike|-inotmatch|-ireplace|-is|-isnot|-isplit|-join|-le|-like|-lt|-match|-ne|-not|-notcontains|-notin|-notlike|-notmatch|-or|-regex|-replace|-shl|-shr|-split|-wildcard|-xor",")\\b")},{className:"literal",begin:/(-)[\w\d]+/,relevance:0}]},V={className:"function",begin:/\[.*\]\s*[\w]+[ ]??\(/,end:/$/,returnBegin:!0,relevance:0,contains:[{className:"keyword",begin:"(".concat(o.keyword.toString().replace(/\s/g,"|"),")\\b"),endsParent:!0,relevance:0},s.inherit(s.TITLE_MODE,{endsParent:!0})]},U=[V,x,i,s.NUMBER_MODE,_,w,C,u,{className:"literal",begin:/\$(null|true|false)\b/},{className:"selector-tag",begin:/@\B/,relevance:0}],z={begin:/\[/,end:/\]/,excludeBegin:!0,excludeEnd:!0,relevance:0,contains:[].concat("self",U,{begin:"("+["string","char","byte","int","long","bool","decimal","single","double","DateTime","xml","array","hashtable","void"].join("|")+")",className:"built_in",relevance:0},{className:"type",begin:/[\.\w\d]+/,relevance:0})};return V.contains.unshift(z),{name:"PowerShell",aliases:["ps","ps1"],case_insensitive:!0,keywords:o,contains:U.concat(j,L,B,$,z)}}},17285:s=>{function source(s){return s?"string"==typeof s?s:s.source:null}function lookahead(s){return concat("(?=",s,")")}function concat(...s){return s.map((s=>source(s))).join("")}function either(...s){return"("+s.map((s=>source(s))).join("|")+")"}s.exports=function xml(s){const o=concat(/[A-Z_]/,function optional(s){return concat("(",s,")?")}(/[A-Z0-9_.-]*:/),/[A-Z0-9_.-]*/),i={className:"symbol",begin:/&[a-z]+;|&#[0-9]+;|&#x[a-f0-9]+;/},u={begin:/\s/,contains:[{className:"meta-keyword",begin:/#?[a-z_][a-z1-9_-]+/,illegal:/\n/}]},_=s.inherit(u,{begin:/\(/,end:/\)/}),w=s.inherit(s.APOS_STRING_MODE,{className:"meta-string"}),x=s.inherit(s.QUOTE_STRING_MODE,{className:"meta-string"}),C={endsWithParent:!0,illegal:/`]+/}]}]}]};return{name:"HTML, XML",aliases:["html","xhtml","rss","atom","xjb","xsd","xsl","plist","wsf","svg"],case_insensitive:!0,contains:[{className:"meta",begin://,relevance:10,contains:[u,x,w,_,{begin:/\[/,end:/\]/,contains:[{className:"meta",begin://,contains:[u,_,x,w]}]}]},s.COMMENT(//,{relevance:10}),{begin://,relevance:10},i,{className:"meta",begin:/<\?xml/,end:/\?>/,relevance:10},{className:"tag",begin:/)/,end:/>/,keywords:{name:"style"},contains:[C],starts:{end:/<\/style>/,returnEnd:!0,subLanguage:["css","xml"]}},{className:"tag",begin:/)/,end:/>/,keywords:{name:"script"},contains:[C],starts:{end:/<\/script>/,returnEnd:!0,subLanguage:["javascript","handlebars","xml"]}},{className:"tag",begin:/<>|<\/>/},{className:"tag",begin:concat(//,/>/,/\s/)))),end:/\/?>/,contains:[{className:"name",begin:o,relevance:0,starts:C}]},{className:"tag",begin:concat(/<\//,lookahead(concat(o,/>/))),contains:[{className:"name",begin:o,relevance:0},{begin:/>/,relevance:0,endsParent:!0}]}]}}},17533:s=>{s.exports=function yaml(s){var o="true false yes no null",i="[\\w#;/?:@&=+$,.~*'()[\\]]+",u={className:"string",relevance:0,variants:[{begin:/'/,end:/'/},{begin:/"/,end:/"/},{begin:/\S+/}],contains:[s.BACKSLASH_ESCAPE,{className:"template-variable",variants:[{begin:/\{\{/,end:/\}\}/},{begin:/%\{/,end:/\}/}]}]},_=s.inherit(u,{variants:[{begin:/'/,end:/'/},{begin:/"/,end:/"/},{begin:/[^\s,{}[\]]+/}]}),w={className:"number",begin:"\\b[0-9]{4}(-[0-9][0-9]){0,2}([Tt \\t][0-9][0-9]?(:[0-9][0-9]){2})?(\\.[0-9]*)?([ \\t])*(Z|[-+][0-9][0-9]?(:[0-9][0-9])?)?\\b"},x={end:",",endsWithParent:!0,excludeEnd:!0,keywords:o,relevance:0},C={begin:/\{/,end:/\}/,contains:[x],illegal:"\\n",relevance:0},j={begin:"\\[",end:"\\]",contains:[x],illegal:"\\n",relevance:0},L=[{className:"attr",variants:[{begin:"\\w[\\w :\\/.-]*:(?=[ \t]|$)"},{begin:'"\\w[\\w :\\/.-]*":(?=[ \t]|$)'},{begin:"'\\w[\\w :\\/.-]*':(?=[ \t]|$)"}]},{className:"meta",begin:"^---\\s*$",relevance:10},{className:"string",begin:"[\\|>]([1-9]?[+-])?[ ]*\\n( +)[^ ][^\\n]*\\n(\\2[^\\n]+\\n?)*"},{begin:"<%[%=-]?",end:"[%-]?%>",subLanguage:"ruby",excludeBegin:!0,excludeEnd:!0,relevance:0},{className:"type",begin:"!\\w+!"+i},{className:"type",begin:"!<"+i+">"},{className:"type",begin:"!"+i},{className:"type",begin:"!!"+i},{className:"meta",begin:"&"+s.UNDERSCORE_IDENT_RE+"$"},{className:"meta",begin:"\\*"+s.UNDERSCORE_IDENT_RE+"$"},{className:"bullet",begin:"-(?=[ ]|$)",relevance:0},s.HASH_COMMENT_MODE,{beginKeywords:o,keywords:{literal:o}},w,{className:"number",begin:s.C_NUMBER_RE+"\\b",relevance:0},C,j,u],B=[...L];return B.pop(),B.push(_),x.contains=B,{name:"YAML",case_insensitive:!0,aliases:["yml"],contains:L}}},251:(s,o)=>{o.read=function(s,o,i,u,_){var w,x,C=8*_-u-1,j=(1<>1,B=-7,$=i?_-1:0,V=i?-1:1,U=s[o+$];for($+=V,w=U&(1<<-B)-1,U>>=-B,B+=C;B>0;w=256*w+s[o+$],$+=V,B-=8);for(x=w&(1<<-B)-1,w>>=-B,B+=u;B>0;x=256*x+s[o+$],$+=V,B-=8);if(0===w)w=1-L;else{if(w===j)return x?NaN:1/0*(U?-1:1);x+=Math.pow(2,u),w-=L}return(U?-1:1)*x*Math.pow(2,w-u)},o.write=function(s,o,i,u,_,w){var x,C,j,L=8*w-_-1,B=(1<>1,V=23===_?Math.pow(2,-24)-Math.pow(2,-77):0,U=u?0:w-1,z=u?1:-1,Y=o<0||0===o&&1/o<0?1:0;for(o=Math.abs(o),isNaN(o)||o===1/0?(C=isNaN(o)?1:0,x=B):(x=Math.floor(Math.log(o)/Math.LN2),o*(j=Math.pow(2,-x))<1&&(x--,j*=2),(o+=x+$>=1?V/j:V*Math.pow(2,1-$))*j>=2&&(x++,j/=2),x+$>=B?(C=0,x=B):x+$>=1?(C=(o*j-1)*Math.pow(2,_),x+=$):(C=o*Math.pow(2,$-1)*Math.pow(2,_),x=0));_>=8;s[i+U]=255&C,U+=z,C/=256,_-=8);for(x=x<<_|C,L+=_;L>0;s[i+U]=255&x,U+=z,x/=256,L-=8);s[i+U-z]|=128*Y}},9404:function(s){s.exports=function(){"use strict";var s=Array.prototype.slice;function createClass(s,o){o&&(s.prototype=Object.create(o.prototype)),s.prototype.constructor=s}function Iterable(s){return isIterable(s)?s:Seq(s)}function KeyedIterable(s){return isKeyed(s)?s:KeyedSeq(s)}function IndexedIterable(s){return isIndexed(s)?s:IndexedSeq(s)}function SetIterable(s){return isIterable(s)&&!isAssociative(s)?s:SetSeq(s)}function isIterable(s){return!(!s||!s[o])}function isKeyed(s){return!(!s||!s[i])}function isIndexed(s){return!(!s||!s[u])}function isAssociative(s){return isKeyed(s)||isIndexed(s)}function isOrdered(s){return!(!s||!s[_])}createClass(KeyedIterable,Iterable),createClass(IndexedIterable,Iterable),createClass(SetIterable,Iterable),Iterable.isIterable=isIterable,Iterable.isKeyed=isKeyed,Iterable.isIndexed=isIndexed,Iterable.isAssociative=isAssociative,Iterable.isOrdered=isOrdered,Iterable.Keyed=KeyedIterable,Iterable.Indexed=IndexedIterable,Iterable.Set=SetIterable;var o="@@__IMMUTABLE_ITERABLE__@@",i="@@__IMMUTABLE_KEYED__@@",u="@@__IMMUTABLE_INDEXED__@@",_="@@__IMMUTABLE_ORDERED__@@",w="delete",x=5,C=1<>>0;if(""+i!==o||4294967295===i)return NaN;o=i}return o<0?ensureSize(s)+o:o}function returnTrue(){return!0}function wholeSlice(s,o,i){return(0===s||void 0!==i&&s<=-i)&&(void 0===o||void 0!==i&&o>=i)}function resolveBegin(s,o){return resolveIndex(s,o,0)}function resolveEnd(s,o){return resolveIndex(s,o,o)}function resolveIndex(s,o,i){return void 0===s?i:s<0?Math.max(0,o+s):void 0===o?s:Math.min(o,s)}var V=0,U=1,z=2,Y="function"==typeof Symbol&&Symbol.iterator,Z="@@iterator",ee=Y||Z;function Iterator(s){this.next=s}function iteratorValue(s,o,i,u){var _=0===s?o:1===s?i:[o,i];return u?u.value=_:u={value:_,done:!1},u}function iteratorDone(){return{value:void 0,done:!0}}function hasIterator(s){return!!getIteratorFn(s)}function isIterator(s){return s&&"function"==typeof s.next}function getIterator(s){var o=getIteratorFn(s);return o&&o.call(s)}function getIteratorFn(s){var o=s&&(Y&&s[Y]||s[Z]);if("function"==typeof o)return o}function isArrayLike(s){return s&&"number"==typeof s.length}function Seq(s){return null==s?emptySequence():isIterable(s)?s.toSeq():seqFromValue(s)}function KeyedSeq(s){return null==s?emptySequence().toKeyedSeq():isIterable(s)?isKeyed(s)?s.toSeq():s.fromEntrySeq():keyedSeqFromValue(s)}function IndexedSeq(s){return null==s?emptySequence():isIterable(s)?isKeyed(s)?s.entrySeq():s.toIndexedSeq():indexedSeqFromValue(s)}function SetSeq(s){return(null==s?emptySequence():isIterable(s)?isKeyed(s)?s.entrySeq():s:indexedSeqFromValue(s)).toSetSeq()}Iterator.prototype.toString=function(){return"[Iterator]"},Iterator.KEYS=V,Iterator.VALUES=U,Iterator.ENTRIES=z,Iterator.prototype.inspect=Iterator.prototype.toSource=function(){return this.toString()},Iterator.prototype[ee]=function(){return this},createClass(Seq,Iterable),Seq.of=function(){return Seq(arguments)},Seq.prototype.toSeq=function(){return this},Seq.prototype.toString=function(){return this.__toString("Seq {","}")},Seq.prototype.cacheResult=function(){return!this._cache&&this.__iterateUncached&&(this._cache=this.entrySeq().toArray(),this.size=this._cache.length),this},Seq.prototype.__iterate=function(s,o){return seqIterate(this,s,o,!0)},Seq.prototype.__iterator=function(s,o){return seqIterator(this,s,o,!0)},createClass(KeyedSeq,Seq),KeyedSeq.prototype.toKeyedSeq=function(){return this},createClass(IndexedSeq,Seq),IndexedSeq.of=function(){return IndexedSeq(arguments)},IndexedSeq.prototype.toIndexedSeq=function(){return this},IndexedSeq.prototype.toString=function(){return this.__toString("Seq [","]")},IndexedSeq.prototype.__iterate=function(s,o){return seqIterate(this,s,o,!1)},IndexedSeq.prototype.__iterator=function(s,o){return seqIterator(this,s,o,!1)},createClass(SetSeq,Seq),SetSeq.of=function(){return SetSeq(arguments)},SetSeq.prototype.toSetSeq=function(){return this},Seq.isSeq=isSeq,Seq.Keyed=KeyedSeq,Seq.Set=SetSeq,Seq.Indexed=IndexedSeq;var ie,ae,le,ce="@@__IMMUTABLE_SEQ__@@";function ArraySeq(s){this._array=s,this.size=s.length}function ObjectSeq(s){var o=Object.keys(s);this._object=s,this._keys=o,this.size=o.length}function IterableSeq(s){this._iterable=s,this.size=s.length||s.size}function IteratorSeq(s){this._iterator=s,this._iteratorCache=[]}function isSeq(s){return!(!s||!s[ce])}function emptySequence(){return ie||(ie=new ArraySeq([]))}function keyedSeqFromValue(s){var o=Array.isArray(s)?new ArraySeq(s).fromEntrySeq():isIterator(s)?new IteratorSeq(s).fromEntrySeq():hasIterator(s)?new IterableSeq(s).fromEntrySeq():"object"==typeof s?new ObjectSeq(s):void 0;if(!o)throw new TypeError("Expected Array or iterable object of [k, v] entries, or keyed object: "+s);return o}function indexedSeqFromValue(s){var o=maybeIndexedSeqFromValue(s);if(!o)throw new TypeError("Expected Array or iterable object of values: "+s);return o}function seqFromValue(s){var o=maybeIndexedSeqFromValue(s)||"object"==typeof s&&new ObjectSeq(s);if(!o)throw new TypeError("Expected Array or iterable object of values, or keyed object: "+s);return o}function maybeIndexedSeqFromValue(s){return isArrayLike(s)?new ArraySeq(s):isIterator(s)?new IteratorSeq(s):hasIterator(s)?new IterableSeq(s):void 0}function seqIterate(s,o,i,u){var _=s._cache;if(_){for(var w=_.length-1,x=0;x<=w;x++){var C=_[i?w-x:x];if(!1===o(C[1],u?C[0]:x,s))return x+1}return x}return s.__iterateUncached(o,i)}function seqIterator(s,o,i,u){var _=s._cache;if(_){var w=_.length-1,x=0;return new Iterator((function(){var s=_[i?w-x:x];return x++>w?iteratorDone():iteratorValue(o,u?s[0]:x-1,s[1])}))}return s.__iteratorUncached(o,i)}function fromJS(s,o){return o?fromJSWith(o,s,"",{"":s}):fromJSDefault(s)}function fromJSWith(s,o,i,u){return Array.isArray(o)?s.call(u,i,IndexedSeq(o).map((function(i,u){return fromJSWith(s,i,u,o)}))):isPlainObj(o)?s.call(u,i,KeyedSeq(o).map((function(i,u){return fromJSWith(s,i,u,o)}))):o}function fromJSDefault(s){return Array.isArray(s)?IndexedSeq(s).map(fromJSDefault).toList():isPlainObj(s)?KeyedSeq(s).map(fromJSDefault).toMap():s}function isPlainObj(s){return s&&(s.constructor===Object||void 0===s.constructor)}function is(s,o){if(s===o||s!=s&&o!=o)return!0;if(!s||!o)return!1;if("function"==typeof s.valueOf&&"function"==typeof o.valueOf){if((s=s.valueOf())===(o=o.valueOf())||s!=s&&o!=o)return!0;if(!s||!o)return!1}return!("function"!=typeof s.equals||"function"!=typeof o.equals||!s.equals(o))}function deepEqual(s,o){if(s===o)return!0;if(!isIterable(o)||void 0!==s.size&&void 0!==o.size&&s.size!==o.size||void 0!==s.__hash&&void 0!==o.__hash&&s.__hash!==o.__hash||isKeyed(s)!==isKeyed(o)||isIndexed(s)!==isIndexed(o)||isOrdered(s)!==isOrdered(o))return!1;if(0===s.size&&0===o.size)return!0;var i=!isAssociative(s);if(isOrdered(s)){var u=s.entries();return o.every((function(s,o){var _=u.next().value;return _&&is(_[1],s)&&(i||is(_[0],o))}))&&u.next().done}var _=!1;if(void 0===s.size)if(void 0===o.size)"function"==typeof s.cacheResult&&s.cacheResult();else{_=!0;var w=s;s=o,o=w}var x=!0,C=o.__iterate((function(o,u){if(i?!s.has(o):_?!is(o,s.get(u,L)):!is(s.get(u,L),o))return x=!1,!1}));return x&&s.size===C}function Repeat(s,o){if(!(this instanceof Repeat))return new Repeat(s,o);if(this._value=s,this.size=void 0===o?1/0:Math.max(0,o),0===this.size){if(ae)return ae;ae=this}}function invariant(s,o){if(!s)throw new Error(o)}function Range(s,o,i){if(!(this instanceof Range))return new Range(s,o,i);if(invariant(0!==i,"Cannot step a Range by 0"),s=s||0,void 0===o&&(o=1/0),i=void 0===i?1:Math.abs(i),ou?iteratorDone():iteratorValue(s,_,i[o?u-_++:_++])}))},createClass(ObjectSeq,KeyedSeq),ObjectSeq.prototype.get=function(s,o){return void 0===o||this.has(s)?this._object[s]:o},ObjectSeq.prototype.has=function(s){return this._object.hasOwnProperty(s)},ObjectSeq.prototype.__iterate=function(s,o){for(var i=this._object,u=this._keys,_=u.length-1,w=0;w<=_;w++){var x=u[o?_-w:w];if(!1===s(i[x],x,this))return w+1}return w},ObjectSeq.prototype.__iterator=function(s,o){var i=this._object,u=this._keys,_=u.length-1,w=0;return new Iterator((function(){var x=u[o?_-w:w];return w++>_?iteratorDone():iteratorValue(s,x,i[x])}))},ObjectSeq.prototype[_]=!0,createClass(IterableSeq,IndexedSeq),IterableSeq.prototype.__iterateUncached=function(s,o){if(o)return this.cacheResult().__iterate(s,o);var i=getIterator(this._iterable),u=0;if(isIterator(i))for(var _;!(_=i.next()).done&&!1!==s(_.value,u++,this););return u},IterableSeq.prototype.__iteratorUncached=function(s,o){if(o)return this.cacheResult().__iterator(s,o);var i=getIterator(this._iterable);if(!isIterator(i))return new Iterator(iteratorDone);var u=0;return new Iterator((function(){var o=i.next();return o.done?o:iteratorValue(s,u++,o.value)}))},createClass(IteratorSeq,IndexedSeq),IteratorSeq.prototype.__iterateUncached=function(s,o){if(o)return this.cacheResult().__iterate(s,o);for(var i,u=this._iterator,_=this._iteratorCache,w=0;w<_.length;)if(!1===s(_[w],w++,this))return w;for(;!(i=u.next()).done;){var x=i.value;if(_[w]=x,!1===s(x,w++,this))break}return w},IteratorSeq.prototype.__iteratorUncached=function(s,o){if(o)return this.cacheResult().__iterator(s,o);var i=this._iterator,u=this._iteratorCache,_=0;return new Iterator((function(){if(_>=u.length){var o=i.next();if(o.done)return o;u[_]=o.value}return iteratorValue(s,_,u[_++])}))},createClass(Repeat,IndexedSeq),Repeat.prototype.toString=function(){return 0===this.size?"Repeat []":"Repeat [ "+this._value+" "+this.size+" times ]"},Repeat.prototype.get=function(s,o){return this.has(s)?this._value:o},Repeat.prototype.includes=function(s){return is(this._value,s)},Repeat.prototype.slice=function(s,o){var i=this.size;return wholeSlice(s,o,i)?this:new Repeat(this._value,resolveEnd(o,i)-resolveBegin(s,i))},Repeat.prototype.reverse=function(){return this},Repeat.prototype.indexOf=function(s){return is(this._value,s)?0:-1},Repeat.prototype.lastIndexOf=function(s){return is(this._value,s)?this.size:-1},Repeat.prototype.__iterate=function(s,o){for(var i=0;i=0&&o=0&&ii?iteratorDone():iteratorValue(s,w++,x)}))},Range.prototype.equals=function(s){return s instanceof Range?this._start===s._start&&this._end===s._end&&this._step===s._step:deepEqual(this,s)},createClass(Collection,Iterable),createClass(KeyedCollection,Collection),createClass(IndexedCollection,Collection),createClass(SetCollection,Collection),Collection.Keyed=KeyedCollection,Collection.Indexed=IndexedCollection,Collection.Set=SetCollection;var pe="function"==typeof Math.imul&&-2===Math.imul(4294967295,2)?Math.imul:function imul(s,o){var i=65535&(s|=0),u=65535&(o|=0);return i*u+((s>>>16)*u+i*(o>>>16)<<16>>>0)|0};function smi(s){return s>>>1&1073741824|3221225471&s}function hash(s){if(!1===s||null==s)return 0;if("function"==typeof s.valueOf&&(!1===(s=s.valueOf())||null==s))return 0;if(!0===s)return 1;var o=typeof s;if("number"===o){if(s!=s||s===1/0)return 0;var i=0|s;for(i!==s&&(i^=4294967295*s);s>4294967295;)i^=s/=4294967295;return smi(i)}if("string"===o)return s.length>Se?cachedHashString(s):hashString(s);if("function"==typeof s.hashCode)return s.hashCode();if("object"===o)return hashJSObj(s);if("function"==typeof s.toString)return hashString(s.toString());throw new Error("Value type "+o+" cannot be hashed.")}function cachedHashString(s){var o=Te[s];return void 0===o&&(o=hashString(s),Pe===xe&&(Pe=0,Te={}),Pe++,Te[s]=o),o}function hashString(s){for(var o=0,i=0;i0)switch(s.nodeType){case 1:return s.uniqueID;case 9:return s.documentElement&&s.documentElement.uniqueID}}var ye,be="function"==typeof WeakMap;be&&(ye=new WeakMap);var _e=0,we="__immutablehash__";"function"==typeof Symbol&&(we=Symbol(we));var Se=16,xe=255,Pe=0,Te={};function assertNotInfinite(s){invariant(s!==1/0,"Cannot perform this action with an infinite size.")}function Map(s){return null==s?emptyMap():isMap(s)&&!isOrdered(s)?s:emptyMap().withMutations((function(o){var i=KeyedIterable(s);assertNotInfinite(i.size),i.forEach((function(s,i){return o.set(i,s)}))}))}function isMap(s){return!(!s||!s[qe])}createClass(Map,KeyedCollection),Map.of=function(){var o=s.call(arguments,0);return emptyMap().withMutations((function(s){for(var i=0;i=o.length)throw new Error("Missing value for key: "+o[i]);s.set(o[i],o[i+1])}}))},Map.prototype.toString=function(){return this.__toString("Map {","}")},Map.prototype.get=function(s,o){return this._root?this._root.get(0,void 0,s,o):o},Map.prototype.set=function(s,o){return updateMap(this,s,o)},Map.prototype.setIn=function(s,o){return this.updateIn(s,L,(function(){return o}))},Map.prototype.remove=function(s){return updateMap(this,s,L)},Map.prototype.deleteIn=function(s){return this.updateIn(s,(function(){return L}))},Map.prototype.update=function(s,o,i){return 1===arguments.length?s(this):this.updateIn([s],o,i)},Map.prototype.updateIn=function(s,o,i){i||(i=o,o=void 0);var u=updateInDeepMap(this,forceIterator(s),o,i);return u===L?void 0:u},Map.prototype.clear=function(){return 0===this.size?this:this.__ownerID?(this.size=0,this._root=null,this.__hash=void 0,this.__altered=!0,this):emptyMap()},Map.prototype.merge=function(){return mergeIntoMapWith(this,void 0,arguments)},Map.prototype.mergeWith=function(o){return mergeIntoMapWith(this,o,s.call(arguments,1))},Map.prototype.mergeIn=function(o){var i=s.call(arguments,1);return this.updateIn(o,emptyMap(),(function(s){return"function"==typeof s.merge?s.merge.apply(s,i):i[i.length-1]}))},Map.prototype.mergeDeep=function(){return mergeIntoMapWith(this,deepMerger,arguments)},Map.prototype.mergeDeepWith=function(o){var i=s.call(arguments,1);return mergeIntoMapWith(this,deepMergerWith(o),i)},Map.prototype.mergeDeepIn=function(o){var i=s.call(arguments,1);return this.updateIn(o,emptyMap(),(function(s){return"function"==typeof s.mergeDeep?s.mergeDeep.apply(s,i):i[i.length-1]}))},Map.prototype.sort=function(s){return OrderedMap(sortFactory(this,s))},Map.prototype.sortBy=function(s,o){return OrderedMap(sortFactory(this,o,s))},Map.prototype.withMutations=function(s){var o=this.asMutable();return s(o),o.wasAltered()?o.__ensureOwner(this.__ownerID):this},Map.prototype.asMutable=function(){return this.__ownerID?this:this.__ensureOwner(new OwnerID)},Map.prototype.asImmutable=function(){return this.__ensureOwner()},Map.prototype.wasAltered=function(){return this.__altered},Map.prototype.__iterator=function(s,o){return new MapIterator(this,s,o)},Map.prototype.__iterate=function(s,o){var i=this,u=0;return this._root&&this._root.iterate((function(o){return u++,s(o[1],o[0],i)}),o),u},Map.prototype.__ensureOwner=function(s){return s===this.__ownerID?this:s?makeMap(this.size,this._root,s,this.__hash):(this.__ownerID=s,this.__altered=!1,this)},Map.isMap=isMap;var Re,qe="@@__IMMUTABLE_MAP__@@",$e=Map.prototype;function ArrayMapNode(s,o){this.ownerID=s,this.entries=o}function BitmapIndexedNode(s,o,i){this.ownerID=s,this.bitmap=o,this.nodes=i}function HashArrayMapNode(s,o,i){this.ownerID=s,this.count=o,this.nodes=i}function HashCollisionNode(s,o,i){this.ownerID=s,this.keyHash=o,this.entries=i}function ValueNode(s,o,i){this.ownerID=s,this.keyHash=o,this.entry=i}function MapIterator(s,o,i){this._type=o,this._reverse=i,this._stack=s._root&&mapIteratorFrame(s._root)}function mapIteratorValue(s,o){return iteratorValue(s,o[0],o[1])}function mapIteratorFrame(s,o){return{node:s,index:0,__prev:o}}function makeMap(s,o,i,u){var _=Object.create($e);return _.size=s,_._root=o,_.__ownerID=i,_.__hash=u,_.__altered=!1,_}function emptyMap(){return Re||(Re=makeMap(0))}function updateMap(s,o,i){var u,_;if(s._root){var w=MakeRef(B),x=MakeRef($);if(u=updateNode(s._root,s.__ownerID,0,void 0,o,i,w,x),!x.value)return s;_=s.size+(w.value?i===L?-1:1:0)}else{if(i===L)return s;_=1,u=new ArrayMapNode(s.__ownerID,[[o,i]])}return s.__ownerID?(s.size=_,s._root=u,s.__hash=void 0,s.__altered=!0,s):u?makeMap(_,u):emptyMap()}function updateNode(s,o,i,u,_,w,x,C){return s?s.update(o,i,u,_,w,x,C):w===L?s:(SetRef(C),SetRef(x),new ValueNode(o,u,[_,w]))}function isLeafNode(s){return s.constructor===ValueNode||s.constructor===HashCollisionNode}function mergeIntoNode(s,o,i,u,_){if(s.keyHash===u)return new HashCollisionNode(o,u,[s.entry,_]);var w,C=(0===i?s.keyHash:s.keyHash>>>i)&j,L=(0===i?u:u>>>i)&j;return new BitmapIndexedNode(o,1<>>=1)x[j]=1&i?o[w++]:void 0;return x[u]=_,new HashArrayMapNode(s,w+1,x)}function mergeIntoMapWith(s,o,i){for(var u=[],_=0;_>1&1431655765))+(s>>2&858993459))+(s>>4)&252645135,s+=s>>8,127&(s+=s>>16)}function setIn(s,o,i,u){var _=u?s:arrCopy(s);return _[o]=i,_}function spliceIn(s,o,i,u){var _=s.length+1;if(u&&o+1===_)return s[o]=i,s;for(var w=new Array(_),x=0,C=0;C<_;C++)C===o?(w[C]=i,x=-1):w[C]=s[C+x];return w}function spliceOut(s,o,i){var u=s.length-1;if(i&&o===u)return s.pop(),s;for(var _=new Array(u),w=0,x=0;x=ze)return createNodes(s,j,u,_);var U=s&&s===this.ownerID,z=U?j:arrCopy(j);return V?C?B===$-1?z.pop():z[B]=z.pop():z[B]=[u,_]:z.push([u,_]),U?(this.entries=z,this):new ArrayMapNode(s,z)}},BitmapIndexedNode.prototype.get=function(s,o,i,u){void 0===o&&(o=hash(i));var _=1<<((0===s?o:o>>>s)&j),w=this.bitmap;return w&_?this.nodes[popCount(w&_-1)].get(s+x,o,i,u):u},BitmapIndexedNode.prototype.update=function(s,o,i,u,_,w,C){void 0===i&&(i=hash(u));var B=(0===o?i:i>>>o)&j,$=1<=We)return expandNodes(s,Y,V,B,ee);if(U&&!ee&&2===Y.length&&isLeafNode(Y[1^z]))return Y[1^z];if(U&&ee&&1===Y.length&&isLeafNode(ee))return ee;var ie=s&&s===this.ownerID,ae=U?ee?V:V^$:V|$,le=U?ee?setIn(Y,z,ee,ie):spliceOut(Y,z,ie):spliceIn(Y,z,ee,ie);return ie?(this.bitmap=ae,this.nodes=le,this):new BitmapIndexedNode(s,ae,le)},HashArrayMapNode.prototype.get=function(s,o,i,u){void 0===o&&(o=hash(i));var _=(0===s?o:o>>>s)&j,w=this.nodes[_];return w?w.get(s+x,o,i,u):u},HashArrayMapNode.prototype.update=function(s,o,i,u,_,w,C){void 0===i&&(i=hash(u));var B=(0===o?i:i>>>o)&j,$=_===L,V=this.nodes,U=V[B];if($&&!U)return this;var z=updateNode(U,s,o+x,i,u,_,w,C);if(z===U)return this;var Y=this.count;if(U){if(!z&&--Y0&&u=0&&s>>o&j;if(u>=this.array.length)return new VNode([],s);var _,w=0===u;if(o>0){var C=this.array[u];if((_=C&&C.removeBefore(s,o-x,i))===C&&w)return this}if(w&&!_)return this;var L=editableVNode(this,s);if(!w)for(var B=0;B>>o&j;if(_>=this.array.length)return this;if(o>0){var w=this.array[_];if((u=w&&w.removeAfter(s,o-x,i))===w&&_===this.array.length-1)return this}var C=editableVNode(this,s);return C.array.splice(_+1),u&&(C.array[_]=u),C};var Qe,et,tt={};function iterateList(s,o){var i=s._origin,u=s._capacity,_=getTailOffset(u),w=s._tail;return iterateNodeOrLeaf(s._root,s._level,0);function iterateNodeOrLeaf(s,o,i){return 0===o?iterateLeaf(s,i):iterateNode(s,o,i)}function iterateLeaf(s,x){var j=x===_?w&&w.array:s&&s.array,L=x>i?0:i-x,B=u-x;return B>C&&(B=C),function(){if(L===B)return tt;var s=o?--B:L++;return j&&j[s]}}function iterateNode(s,_,w){var j,L=s&&s.array,B=w>i?0:i-w>>_,$=1+(u-w>>_);return $>C&&($=C),function(){for(;;){if(j){var s=j();if(s!==tt)return s;j=null}if(B===$)return tt;var i=o?--$:B++;j=iterateNodeOrLeaf(L&&L[i],_-x,w+(i<<_))}}}}function makeList(s,o,i,u,_,w,x){var C=Object.create(Xe);return C.size=o-s,C._origin=s,C._capacity=o,C._level=i,C._root=u,C._tail=_,C.__ownerID=w,C.__hash=x,C.__altered=!1,C}function emptyList(){return Qe||(Qe=makeList(0,0,x))}function updateList(s,o,i){if((o=wrapIndex(s,o))!=o)return s;if(o>=s.size||o<0)return s.withMutations((function(s){o<0?setListBounds(s,o).set(0,i):setListBounds(s,0,o+1).set(o,i)}));o+=s._origin;var u=s._tail,_=s._root,w=MakeRef($);return o>=getTailOffset(s._capacity)?u=updateVNode(u,s.__ownerID,0,o,i,w):_=updateVNode(_,s.__ownerID,s._level,o,i,w),w.value?s.__ownerID?(s._root=_,s._tail=u,s.__hash=void 0,s.__altered=!0,s):makeList(s._origin,s._capacity,s._level,_,u):s}function updateVNode(s,o,i,u,_,w){var C,L=u>>>i&j,B=s&&L0){var $=s&&s.array[L],V=updateVNode($,o,i-x,u,_,w);return V===$?s:((C=editableVNode(s,o)).array[L]=V,C)}return B&&s.array[L]===_?s:(SetRef(w),C=editableVNode(s,o),void 0===_&&L===C.array.length-1?C.array.pop():C.array[L]=_,C)}function editableVNode(s,o){return o&&s&&o===s.ownerID?s:new VNode(s?s.array.slice():[],o)}function listNodeFor(s,o){if(o>=getTailOffset(s._capacity))return s._tail;if(o<1<0;)i=i.array[o>>>u&j],u-=x;return i}}function setListBounds(s,o,i){void 0!==o&&(o|=0),void 0!==i&&(i|=0);var u=s.__ownerID||new OwnerID,_=s._origin,w=s._capacity,C=_+o,L=void 0===i?w:i<0?w+i:_+i;if(C===_&&L===w)return s;if(C>=L)return s.clear();for(var B=s._level,$=s._root,V=0;C+V<0;)$=new VNode($&&$.array.length?[void 0,$]:[],u),V+=1<<(B+=x);V&&(C+=V,_+=V,L+=V,w+=V);for(var U=getTailOffset(w),z=getTailOffset(L);z>=1<U?new VNode([],u):Y;if(Y&&z>U&&Cx;ie-=x){var ae=U>>>ie&j;ee=ee.array[ae]=editableVNode(ee.array[ae],u)}ee.array[U>>>x&j]=Y}if(L=z)C-=z,L-=z,B=x,$=null,Z=Z&&Z.removeBefore(u,0,C);else if(C>_||z>>B&j;if(le!==z>>>B&j)break;le&&(V+=(1<_&&($=$.removeBefore(u,B,C-V)),$&&z_&&(_=C.size),isIterable(x)||(C=C.map((function(s){return fromJS(s)}))),u.push(C)}return _>s.size&&(s=s.setSize(_)),mergeIntoCollectionWith(s,o,u)}function getTailOffset(s){return s>>x<=C&&x.size>=2*w.size?(u=(_=x.filter((function(s,o){return void 0!==s&&j!==o}))).toKeyedSeq().map((function(s){return s[0]})).flip().toMap(),s.__ownerID&&(u.__ownerID=_.__ownerID=s.__ownerID)):(u=w.remove(o),_=j===x.size-1?x.pop():x.set(j,void 0))}else if(B){if(i===x.get(j)[1])return s;u=w,_=x.set(j,[o,i])}else u=w.set(o,x.size),_=x.set(x.size,[o,i]);return s.__ownerID?(s.size=u.size,s._map=u,s._list=_,s.__hash=void 0,s):makeOrderedMap(u,_)}function ToKeyedSequence(s,o){this._iter=s,this._useKeys=o,this.size=s.size}function ToIndexedSequence(s){this._iter=s,this.size=s.size}function ToSetSequence(s){this._iter=s,this.size=s.size}function FromEntriesSequence(s){this._iter=s,this.size=s.size}function flipFactory(s){var o=makeSequence(s);return o._iter=s,o.size=s.size,o.flip=function(){return s},o.reverse=function(){var o=s.reverse.apply(this);return o.flip=function(){return s.reverse()},o},o.has=function(o){return s.includes(o)},o.includes=function(o){return s.has(o)},o.cacheResult=cacheResultThrough,o.__iterateUncached=function(o,i){var u=this;return s.__iterate((function(s,i){return!1!==o(i,s,u)}),i)},o.__iteratorUncached=function(o,i){if(o===z){var u=s.__iterator(o,i);return new Iterator((function(){var s=u.next();if(!s.done){var o=s.value[0];s.value[0]=s.value[1],s.value[1]=o}return s}))}return s.__iterator(o===U?V:U,i)},o}function mapFactory(s,o,i){var u=makeSequence(s);return u.size=s.size,u.has=function(o){return s.has(o)},u.get=function(u,_){var w=s.get(u,L);return w===L?_:o.call(i,w,u,s)},u.__iterateUncached=function(u,_){var w=this;return s.__iterate((function(s,_,x){return!1!==u(o.call(i,s,_,x),_,w)}),_)},u.__iteratorUncached=function(u,_){var w=s.__iterator(z,_);return new Iterator((function(){var _=w.next();if(_.done)return _;var x=_.value,C=x[0];return iteratorValue(u,C,o.call(i,x[1],C,s),_)}))},u}function reverseFactory(s,o){var i=makeSequence(s);return i._iter=s,i.size=s.size,i.reverse=function(){return s},s.flip&&(i.flip=function(){var o=flipFactory(s);return o.reverse=function(){return s.flip()},o}),i.get=function(i,u){return s.get(o?i:-1-i,u)},i.has=function(i){return s.has(o?i:-1-i)},i.includes=function(o){return s.includes(o)},i.cacheResult=cacheResultThrough,i.__iterate=function(o,i){var u=this;return s.__iterate((function(s,i){return o(s,i,u)}),!i)},i.__iterator=function(o,i){return s.__iterator(o,!i)},i}function filterFactory(s,o,i,u){var _=makeSequence(s);return u&&(_.has=function(u){var _=s.get(u,L);return _!==L&&!!o.call(i,_,u,s)},_.get=function(u,_){var w=s.get(u,L);return w!==L&&o.call(i,w,u,s)?w:_}),_.__iterateUncached=function(_,w){var x=this,C=0;return s.__iterate((function(s,w,j){if(o.call(i,s,w,j))return C++,_(s,u?w:C-1,x)}),w),C},_.__iteratorUncached=function(_,w){var x=s.__iterator(z,w),C=0;return new Iterator((function(){for(;;){var w=x.next();if(w.done)return w;var j=w.value,L=j[0],B=j[1];if(o.call(i,B,L,s))return iteratorValue(_,u?L:C++,B,w)}}))},_}function countByFactory(s,o,i){var u=Map().asMutable();return s.__iterate((function(_,w){u.update(o.call(i,_,w,s),0,(function(s){return s+1}))})),u.asImmutable()}function groupByFactory(s,o,i){var u=isKeyed(s),_=(isOrdered(s)?OrderedMap():Map()).asMutable();s.__iterate((function(w,x){_.update(o.call(i,w,x,s),(function(s){return(s=s||[]).push(u?[x,w]:w),s}))}));var w=iterableClass(s);return _.map((function(o){return reify(s,w(o))}))}function sliceFactory(s,o,i,u){var _=s.size;if(void 0!==o&&(o|=0),void 0!==i&&(i===1/0?i=_:i|=0),wholeSlice(o,i,_))return s;var w=resolveBegin(o,_),x=resolveEnd(i,_);if(w!=w||x!=x)return sliceFactory(s.toSeq().cacheResult(),o,i,u);var C,j=x-w;j==j&&(C=j<0?0:j);var L=makeSequence(s);return L.size=0===C?C:s.size&&C||void 0,!u&&isSeq(s)&&C>=0&&(L.get=function(o,i){return(o=wrapIndex(this,o))>=0&&oC)return iteratorDone();var s=_.next();return u||o===U?s:iteratorValue(o,j-1,o===V?void 0:s.value[1],s)}))},L}function takeWhileFactory(s,o,i){var u=makeSequence(s);return u.__iterateUncached=function(u,_){var w=this;if(_)return this.cacheResult().__iterate(u,_);var x=0;return s.__iterate((function(s,_,C){return o.call(i,s,_,C)&&++x&&u(s,_,w)})),x},u.__iteratorUncached=function(u,_){var w=this;if(_)return this.cacheResult().__iterator(u,_);var x=s.__iterator(z,_),C=!0;return new Iterator((function(){if(!C)return iteratorDone();var s=x.next();if(s.done)return s;var _=s.value,j=_[0],L=_[1];return o.call(i,L,j,w)?u===z?s:iteratorValue(u,j,L,s):(C=!1,iteratorDone())}))},u}function skipWhileFactory(s,o,i,u){var _=makeSequence(s);return _.__iterateUncached=function(_,w){var x=this;if(w)return this.cacheResult().__iterate(_,w);var C=!0,j=0;return s.__iterate((function(s,w,L){if(!C||!(C=o.call(i,s,w,L)))return j++,_(s,u?w:j-1,x)})),j},_.__iteratorUncached=function(_,w){var x=this;if(w)return this.cacheResult().__iterator(_,w);var C=s.__iterator(z,w),j=!0,L=0;return new Iterator((function(){var s,w,B;do{if((s=C.next()).done)return u||_===U?s:iteratorValue(_,L++,_===V?void 0:s.value[1],s);var $=s.value;w=$[0],B=$[1],j&&(j=o.call(i,B,w,x))}while(j);return _===z?s:iteratorValue(_,w,B,s)}))},_}function concatFactory(s,o){var i=isKeyed(s),u=[s].concat(o).map((function(s){return isIterable(s)?i&&(s=KeyedIterable(s)):s=i?keyedSeqFromValue(s):indexedSeqFromValue(Array.isArray(s)?s:[s]),s})).filter((function(s){return 0!==s.size}));if(0===u.length)return s;if(1===u.length){var _=u[0];if(_===s||i&&isKeyed(_)||isIndexed(s)&&isIndexed(_))return _}var w=new ArraySeq(u);return i?w=w.toKeyedSeq():isIndexed(s)||(w=w.toSetSeq()),(w=w.flatten(!0)).size=u.reduce((function(s,o){if(void 0!==s){var i=o.size;if(void 0!==i)return s+i}}),0),w}function flattenFactory(s,o,i){var u=makeSequence(s);return u.__iterateUncached=function(u,_){var w=0,x=!1;function flatDeep(s,C){var j=this;s.__iterate((function(s,_){return(!o||C0}function zipWithFactory(s,o,i){var u=makeSequence(s);return u.size=new ArraySeq(i).map((function(s){return s.size})).min(),u.__iterate=function(s,o){for(var i,u=this.__iterator(U,o),_=0;!(i=u.next()).done&&!1!==s(i.value,_++,this););return _},u.__iteratorUncached=function(s,u){var _=i.map((function(s){return s=Iterable(s),getIterator(u?s.reverse():s)})),w=0,x=!1;return new Iterator((function(){var i;return x||(i=_.map((function(s){return s.next()})),x=i.some((function(s){return s.done}))),x?iteratorDone():iteratorValue(s,w++,o.apply(null,i.map((function(s){return s.value}))))}))},u}function reify(s,o){return isSeq(s)?o:s.constructor(o)}function validateEntry(s){if(s!==Object(s))throw new TypeError("Expected [K, V] tuple: "+s)}function resolveSize(s){return assertNotInfinite(s.size),ensureSize(s)}function iterableClass(s){return isKeyed(s)?KeyedIterable:isIndexed(s)?IndexedIterable:SetIterable}function makeSequence(s){return Object.create((isKeyed(s)?KeyedSeq:isIndexed(s)?IndexedSeq:SetSeq).prototype)}function cacheResultThrough(){return this._iter.cacheResult?(this._iter.cacheResult(),this.size=this._iter.size,this):Seq.prototype.cacheResult.call(this)}function defaultComparator(s,o){return s>o?1:s=0;i--)o={value:arguments[i],next:o};return this.__ownerID?(this.size=s,this._head=o,this.__hash=void 0,this.__altered=!0,this):makeStack(s,o)},Stack.prototype.pushAll=function(s){if(0===(s=IndexedIterable(s)).size)return this;assertNotInfinite(s.size);var o=this.size,i=this._head;return s.reverse().forEach((function(s){o++,i={value:s,next:i}})),this.__ownerID?(this.size=o,this._head=i,this.__hash=void 0,this.__altered=!0,this):makeStack(o,i)},Stack.prototype.pop=function(){return this.slice(1)},Stack.prototype.unshift=function(){return this.push.apply(this,arguments)},Stack.prototype.unshiftAll=function(s){return this.pushAll(s)},Stack.prototype.shift=function(){return this.pop.apply(this,arguments)},Stack.prototype.clear=function(){return 0===this.size?this:this.__ownerID?(this.size=0,this._head=void 0,this.__hash=void 0,this.__altered=!0,this):emptyStack()},Stack.prototype.slice=function(s,o){if(wholeSlice(s,o,this.size))return this;var i=resolveBegin(s,this.size);if(resolveEnd(o,this.size)!==this.size)return IndexedCollection.prototype.slice.call(this,s,o);for(var u=this.size-i,_=this._head;i--;)_=_.next;return this.__ownerID?(this.size=u,this._head=_,this.__hash=void 0,this.__altered=!0,this):makeStack(u,_)},Stack.prototype.__ensureOwner=function(s){return s===this.__ownerID?this:s?makeStack(this.size,this._head,s,this.__hash):(this.__ownerID=s,this.__altered=!1,this)},Stack.prototype.__iterate=function(s,o){if(o)return this.reverse().__iterate(s);for(var i=0,u=this._head;u&&!1!==s(u.value,i++,this);)u=u.next;return i},Stack.prototype.__iterator=function(s,o){if(o)return this.reverse().__iterator(s);var i=0,u=this._head;return new Iterator((function(){if(u){var o=u.value;return u=u.next,iteratorValue(s,i++,o)}return iteratorDone()}))},Stack.isStack=isStack;var lt,ct="@@__IMMUTABLE_STACK__@@",ut=Stack.prototype;function makeStack(s,o,i,u){var _=Object.create(ut);return _.size=s,_._head=o,_.__ownerID=i,_.__hash=u,_.__altered=!1,_}function emptyStack(){return lt||(lt=makeStack(0))}function mixin(s,o){var keyCopier=function(i){s.prototype[i]=o[i]};return Object.keys(o).forEach(keyCopier),Object.getOwnPropertySymbols&&Object.getOwnPropertySymbols(o).forEach(keyCopier),s}ut[ct]=!0,ut.withMutations=$e.withMutations,ut.asMutable=$e.asMutable,ut.asImmutable=$e.asImmutable,ut.wasAltered=$e.wasAltered,Iterable.Iterator=Iterator,mixin(Iterable,{toArray:function(){assertNotInfinite(this.size);var s=new Array(this.size||0);return this.valueSeq().__iterate((function(o,i){s[i]=o})),s},toIndexedSeq:function(){return new ToIndexedSequence(this)},toJS:function(){return this.toSeq().map((function(s){return s&&"function"==typeof s.toJS?s.toJS():s})).__toJS()},toJSON:function(){return this.toSeq().map((function(s){return s&&"function"==typeof s.toJSON?s.toJSON():s})).__toJS()},toKeyedSeq:function(){return new ToKeyedSequence(this,!0)},toMap:function(){return Map(this.toKeyedSeq())},toObject:function(){assertNotInfinite(this.size);var s={};return this.__iterate((function(o,i){s[i]=o})),s},toOrderedMap:function(){return OrderedMap(this.toKeyedSeq())},toOrderedSet:function(){return OrderedSet(isKeyed(this)?this.valueSeq():this)},toSet:function(){return Set(isKeyed(this)?this.valueSeq():this)},toSetSeq:function(){return new ToSetSequence(this)},toSeq:function(){return isIndexed(this)?this.toIndexedSeq():isKeyed(this)?this.toKeyedSeq():this.toSetSeq()},toStack:function(){return Stack(isKeyed(this)?this.valueSeq():this)},toList:function(){return List(isKeyed(this)?this.valueSeq():this)},toString:function(){return"[Iterable]"},__toString:function(s,o){return 0===this.size?s+o:s+" "+this.toSeq().map(this.__toStringMapper).join(", ")+" "+o},concat:function(){return reify(this,concatFactory(this,s.call(arguments,0)))},includes:function(s){return this.some((function(o){return is(o,s)}))},entries:function(){return this.__iterator(z)},every:function(s,o){assertNotInfinite(this.size);var i=!0;return this.__iterate((function(u,_,w){if(!s.call(o,u,_,w))return i=!1,!1})),i},filter:function(s,o){return reify(this,filterFactory(this,s,o,!0))},find:function(s,o,i){var u=this.findEntry(s,o);return u?u[1]:i},forEach:function(s,o){return assertNotInfinite(this.size),this.__iterate(o?s.bind(o):s)},join:function(s){assertNotInfinite(this.size),s=void 0!==s?""+s:",";var o="",i=!0;return this.__iterate((function(u){i?i=!1:o+=s,o+=null!=u?u.toString():""})),o},keys:function(){return this.__iterator(V)},map:function(s,o){return reify(this,mapFactory(this,s,o))},reduce:function(s,o,i){var u,_;return assertNotInfinite(this.size),arguments.length<2?_=!0:u=o,this.__iterate((function(o,w,x){_?(_=!1,u=o):u=s.call(i,u,o,w,x)})),u},reduceRight:function(s,o,i){var u=this.toKeyedSeq().reverse();return u.reduce.apply(u,arguments)},reverse:function(){return reify(this,reverseFactory(this,!0))},slice:function(s,o){return reify(this,sliceFactory(this,s,o,!0))},some:function(s,o){return!this.every(not(s),o)},sort:function(s){return reify(this,sortFactory(this,s))},values:function(){return this.__iterator(U)},butLast:function(){return this.slice(0,-1)},isEmpty:function(){return void 0!==this.size?0===this.size:!this.some((function(){return!0}))},count:function(s,o){return ensureSize(s?this.toSeq().filter(s,o):this)},countBy:function(s,o){return countByFactory(this,s,o)},equals:function(s){return deepEqual(this,s)},entrySeq:function(){var s=this;if(s._cache)return new ArraySeq(s._cache);var o=s.toSeq().map(entryMapper).toIndexedSeq();return o.fromEntrySeq=function(){return s.toSeq()},o},filterNot:function(s,o){return this.filter(not(s),o)},findEntry:function(s,o,i){var u=i;return this.__iterate((function(i,_,w){if(s.call(o,i,_,w))return u=[_,i],!1})),u},findKey:function(s,o){var i=this.findEntry(s,o);return i&&i[0]},findLast:function(s,o,i){return this.toKeyedSeq().reverse().find(s,o,i)},findLastEntry:function(s,o,i){return this.toKeyedSeq().reverse().findEntry(s,o,i)},findLastKey:function(s,o){return this.toKeyedSeq().reverse().findKey(s,o)},first:function(){return this.find(returnTrue)},flatMap:function(s,o){return reify(this,flatMapFactory(this,s,o))},flatten:function(s){return reify(this,flattenFactory(this,s,!0))},fromEntrySeq:function(){return new FromEntriesSequence(this)},get:function(s,o){return this.find((function(o,i){return is(i,s)}),void 0,o)},getIn:function(s,o){for(var i,u=this,_=forceIterator(s);!(i=_.next()).done;){var w=i.value;if((u=u&&u.get?u.get(w,L):L)===L)return o}return u},groupBy:function(s,o){return groupByFactory(this,s,o)},has:function(s){return this.get(s,L)!==L},hasIn:function(s){return this.getIn(s,L)!==L},isSubset:function(s){return s="function"==typeof s.includes?s:Iterable(s),this.every((function(o){return s.includes(o)}))},isSuperset:function(s){return(s="function"==typeof s.isSubset?s:Iterable(s)).isSubset(this)},keyOf:function(s){return this.findKey((function(o){return is(o,s)}))},keySeq:function(){return this.toSeq().map(keyMapper).toIndexedSeq()},last:function(){return this.toSeq().reverse().first()},lastKeyOf:function(s){return this.toKeyedSeq().reverse().keyOf(s)},max:function(s){return maxFactory(this,s)},maxBy:function(s,o){return maxFactory(this,o,s)},min:function(s){return maxFactory(this,s?neg(s):defaultNegComparator)},minBy:function(s,o){return maxFactory(this,o?neg(o):defaultNegComparator,s)},rest:function(){return this.slice(1)},skip:function(s){return this.slice(Math.max(0,s))},skipLast:function(s){return reify(this,this.toSeq().reverse().skip(s).reverse())},skipWhile:function(s,o){return reify(this,skipWhileFactory(this,s,o,!0))},skipUntil:function(s,o){return this.skipWhile(not(s),o)},sortBy:function(s,o){return reify(this,sortFactory(this,o,s))},take:function(s){return this.slice(0,Math.max(0,s))},takeLast:function(s){return reify(this,this.toSeq().reverse().take(s).reverse())},takeWhile:function(s,o){return reify(this,takeWhileFactory(this,s,o))},takeUntil:function(s,o){return this.takeWhile(not(s),o)},valueSeq:function(){return this.toIndexedSeq()},hashCode:function(){return this.__hash||(this.__hash=hashIterable(this))}});var pt=Iterable.prototype;pt[o]=!0,pt[ee]=pt.values,pt.__toJS=pt.toArray,pt.__toStringMapper=quoteString,pt.inspect=pt.toSource=function(){return this.toString()},pt.chain=pt.flatMap,pt.contains=pt.includes,mixin(KeyedIterable,{flip:function(){return reify(this,flipFactory(this))},mapEntries:function(s,o){var i=this,u=0;return reify(this,this.toSeq().map((function(_,w){return s.call(o,[w,_],u++,i)})).fromEntrySeq())},mapKeys:function(s,o){var i=this;return reify(this,this.toSeq().flip().map((function(u,_){return s.call(o,u,_,i)})).flip())}});var ht=KeyedIterable.prototype;function keyMapper(s,o){return o}function entryMapper(s,o){return[o,s]}function not(s){return function(){return!s.apply(this,arguments)}}function neg(s){return function(){return-s.apply(this,arguments)}}function quoteString(s){return"string"==typeof s?JSON.stringify(s):String(s)}function defaultZipper(){return arrCopy(arguments)}function defaultNegComparator(s,o){return so?-1:0}function hashIterable(s){if(s.size===1/0)return 0;var o=isOrdered(s),i=isKeyed(s),u=o?1:0;return murmurHashOfSize(s.__iterate(i?o?function(s,o){u=31*u+hashMerge(hash(s),hash(o))|0}:function(s,o){u=u+hashMerge(hash(s),hash(o))|0}:o?function(s){u=31*u+hash(s)|0}:function(s){u=u+hash(s)|0}),u)}function murmurHashOfSize(s,o){return o=pe(o,3432918353),o=pe(o<<15|o>>>-15,461845907),o=pe(o<<13|o>>>-13,5),o=pe((o=o+3864292196^s)^o>>>16,2246822507),o=smi((o=pe(o^o>>>13,3266489909))^o>>>16)}function hashMerge(s,o){return s^o+2654435769+(s<<6)+(s>>2)}return ht[i]=!0,ht[ee]=pt.entries,ht.__toJS=pt.toObject,ht.__toStringMapper=function(s,o){return JSON.stringify(o)+": "+quoteString(s)},mixin(IndexedIterable,{toKeyedSeq:function(){return new ToKeyedSequence(this,!1)},filter:function(s,o){return reify(this,filterFactory(this,s,o,!1))},findIndex:function(s,o){var i=this.findEntry(s,o);return i?i[0]:-1},indexOf:function(s){var o=this.keyOf(s);return void 0===o?-1:o},lastIndexOf:function(s){var o=this.lastKeyOf(s);return void 0===o?-1:o},reverse:function(){return reify(this,reverseFactory(this,!1))},slice:function(s,o){return reify(this,sliceFactory(this,s,o,!1))},splice:function(s,o){var i=arguments.length;if(o=Math.max(0|o,0),0===i||2===i&&!o)return this;s=resolveBegin(s,s<0?this.count():this.size);var u=this.slice(0,s);return reify(this,1===i?u:u.concat(arrCopy(arguments,2),this.slice(s+o)))},findLastIndex:function(s,o){var i=this.findLastEntry(s,o);return i?i[0]:-1},first:function(){return this.get(0)},flatten:function(s){return reify(this,flattenFactory(this,s,!1))},get:function(s,o){return(s=wrapIndex(this,s))<0||this.size===1/0||void 0!==this.size&&s>this.size?o:this.find((function(o,i){return i===s}),void 0,o)},has:function(s){return(s=wrapIndex(this,s))>=0&&(void 0!==this.size?this.size===1/0||s{"function"==typeof Object.create?s.exports=function inherits(s,o){o&&(s.super_=o,s.prototype=Object.create(o.prototype,{constructor:{value:s,enumerable:!1,writable:!0,configurable:!0}}))}:s.exports=function inherits(s,o){if(o){s.super_=o;var TempCtor=function(){};TempCtor.prototype=o.prototype,s.prototype=new TempCtor,s.prototype.constructor=s}}},5419:s=>{s.exports=function(s,o,i,u){var _=new Blob(void 0!==u?[u,s]:[s],{type:i||"application/octet-stream"});if(void 0!==window.navigator.msSaveBlob)window.navigator.msSaveBlob(_,o);else{var w=window.URL&&window.URL.createObjectURL?window.URL.createObjectURL(_):window.webkitURL.createObjectURL(_),x=document.createElement("a");x.style.display="none",x.href=w,x.setAttribute("download",o),void 0===x.download&&x.setAttribute("target","_blank"),document.body.appendChild(x),x.click(),setTimeout((function(){document.body.removeChild(x),window.URL.revokeObjectURL(w)}),200)}}},20181:(s,o,i)=>{var u=/^\s+|\s+$/g,_=/^[-+]0x[0-9a-f]+$/i,w=/^0b[01]+$/i,x=/^0o[0-7]+$/i,C=parseInt,j="object"==typeof i.g&&i.g&&i.g.Object===Object&&i.g,L="object"==typeof self&&self&&self.Object===Object&&self,B=j||L||Function("return this")(),$=Object.prototype.toString,V=Math.max,U=Math.min,now=function(){return B.Date.now()};function isObject(s){var o=typeof s;return!!s&&("object"==o||"function"==o)}function toNumber(s){if("number"==typeof s)return s;if(function isSymbol(s){return"symbol"==typeof s||function isObjectLike(s){return!!s&&"object"==typeof s}(s)&&"[object Symbol]"==$.call(s)}(s))return NaN;if(isObject(s)){var o="function"==typeof s.valueOf?s.valueOf():s;s=isObject(o)?o+"":o}if("string"!=typeof s)return 0===s?s:+s;s=s.replace(u,"");var i=w.test(s);return i||x.test(s)?C(s.slice(2),i?2:8):_.test(s)?NaN:+s}s.exports=function debounce(s,o,i){var u,_,w,x,C,j,L=0,B=!1,$=!1,z=!0;if("function"!=typeof s)throw new TypeError("Expected a function");function invokeFunc(o){var i=u,w=_;return u=_=void 0,L=o,x=s.apply(w,i)}function shouldInvoke(s){var i=s-j;return void 0===j||i>=o||i<0||$&&s-L>=w}function timerExpired(){var s=now();if(shouldInvoke(s))return trailingEdge(s);C=setTimeout(timerExpired,function remainingWait(s){var i=o-(s-j);return $?U(i,w-(s-L)):i}(s))}function trailingEdge(s){return C=void 0,z&&u?invokeFunc(s):(u=_=void 0,x)}function debounced(){var s=now(),i=shouldInvoke(s);if(u=arguments,_=this,j=s,i){if(void 0===C)return function leadingEdge(s){return L=s,C=setTimeout(timerExpired,o),B?invokeFunc(s):x}(j);if($)return C=setTimeout(timerExpired,o),invokeFunc(j)}return void 0===C&&(C=setTimeout(timerExpired,o)),x}return o=toNumber(o)||0,isObject(i)&&(B=!!i.leading,w=($="maxWait"in i)?V(toNumber(i.maxWait)||0,o):w,z="trailing"in i?!!i.trailing:z),debounced.cancel=function cancel(){void 0!==C&&clearTimeout(C),L=0,u=j=_=C=void 0},debounced.flush=function flush(){return void 0===C?x:trailingEdge(now())},debounced}},55580:(s,o,i)=>{var u=i(56110)(i(9325),"DataView");s.exports=u},21549:(s,o,i)=>{var u=i(22032),_=i(63862),w=i(66721),x=i(12749),C=i(35749);function Hash(s){var o=-1,i=null==s?0:s.length;for(this.clear();++o{var u=i(39344),_=i(94033);function LazyWrapper(s){this.__wrapped__=s,this.__actions__=[],this.__dir__=1,this.__filtered__=!1,this.__iteratees__=[],this.__takeCount__=4294967295,this.__views__=[]}LazyWrapper.prototype=u(_.prototype),LazyWrapper.prototype.constructor=LazyWrapper,s.exports=LazyWrapper},80079:(s,o,i)=>{var u=i(63702),_=i(70080),w=i(24739),x=i(48655),C=i(31175);function ListCache(s){var o=-1,i=null==s?0:s.length;for(this.clear();++o{var u=i(39344),_=i(94033);function LodashWrapper(s,o){this.__wrapped__=s,this.__actions__=[],this.__chain__=!!o,this.__index__=0,this.__values__=void 0}LodashWrapper.prototype=u(_.prototype),LodashWrapper.prototype.constructor=LodashWrapper,s.exports=LodashWrapper},68223:(s,o,i)=>{var u=i(56110)(i(9325),"Map");s.exports=u},53661:(s,o,i)=>{var u=i(63040),_=i(17670),w=i(90289),x=i(4509),C=i(72949);function MapCache(s){var o=-1,i=null==s?0:s.length;for(this.clear();++o{var u=i(56110)(i(9325),"Promise");s.exports=u},76545:(s,o,i)=>{var u=i(56110)(i(9325),"Set");s.exports=u},38859:(s,o,i)=>{var u=i(53661),_=i(31380),w=i(51459);function SetCache(s){var o=-1,i=null==s?0:s.length;for(this.__data__=new u;++o{var u=i(80079),_=i(51420),w=i(90938),x=i(63605),C=i(29817),j=i(80945);function Stack(s){var o=this.__data__=new u(s);this.size=o.size}Stack.prototype.clear=_,Stack.prototype.delete=w,Stack.prototype.get=x,Stack.prototype.has=C,Stack.prototype.set=j,s.exports=Stack},51873:(s,o,i)=>{var u=i(9325).Symbol;s.exports=u},37828:(s,o,i)=>{var u=i(9325).Uint8Array;s.exports=u},28303:(s,o,i)=>{var u=i(56110)(i(9325),"WeakMap");s.exports=u},91033:s=>{s.exports=function apply(s,o,i){switch(i.length){case 0:return s.call(o);case 1:return s.call(o,i[0]);case 2:return s.call(o,i[0],i[1]);case 3:return s.call(o,i[0],i[1],i[2])}return s.apply(o,i)}},83729:s=>{s.exports=function arrayEach(s,o){for(var i=-1,u=null==s?0:s.length;++i{s.exports=function arrayFilter(s,o){for(var i=-1,u=null==s?0:s.length,_=0,w=[];++i{var u=i(96131);s.exports=function arrayIncludes(s,o){return!!(null==s?0:s.length)&&u(s,o,0)>-1}},70695:(s,o,i)=>{var u=i(78096),_=i(72428),w=i(56449),x=i(3656),C=i(30361),j=i(37167),L=Object.prototype.hasOwnProperty;s.exports=function arrayLikeKeys(s,o){var i=w(s),B=!i&&_(s),$=!i&&!B&&x(s),V=!i&&!B&&!$&&j(s),U=i||B||$||V,z=U?u(s.length,String):[],Y=z.length;for(var Z in s)!o&&!L.call(s,Z)||U&&("length"==Z||$&&("offset"==Z||"parent"==Z)||V&&("buffer"==Z||"byteLength"==Z||"byteOffset"==Z)||C(Z,Y))||z.push(Z);return z}},34932:s=>{s.exports=function arrayMap(s,o){for(var i=-1,u=null==s?0:s.length,_=Array(u);++i{s.exports=function arrayPush(s,o){for(var i=-1,u=o.length,_=s.length;++i{s.exports=function arrayReduce(s,o,i,u){var _=-1,w=null==s?0:s.length;for(u&&w&&(i=s[++_]);++_{s.exports=function arraySome(s,o){for(var i=-1,u=null==s?0:s.length;++i{s.exports=function asciiToArray(s){return s.split("")}},1733:s=>{var o=/[^\x00-\x2f\x3a-\x40\x5b-\x60\x7b-\x7f]+/g;s.exports=function asciiWords(s){return s.match(o)||[]}},87805:(s,o,i)=>{var u=i(43360),_=i(75288);s.exports=function assignMergeValue(s,o,i){(void 0!==i&&!_(s[o],i)||void 0===i&&!(o in s))&&u(s,o,i)}},16547:(s,o,i)=>{var u=i(43360),_=i(75288),w=Object.prototype.hasOwnProperty;s.exports=function assignValue(s,o,i){var x=s[o];w.call(s,o)&&_(x,i)&&(void 0!==i||o in s)||u(s,o,i)}},26025:(s,o,i)=>{var u=i(75288);s.exports=function assocIndexOf(s,o){for(var i=s.length;i--;)if(u(s[i][0],o))return i;return-1}},74733:(s,o,i)=>{var u=i(21791),_=i(95950);s.exports=function baseAssign(s,o){return s&&u(o,_(o),s)}},43838:(s,o,i)=>{var u=i(21791),_=i(37241);s.exports=function baseAssignIn(s,o){return s&&u(o,_(o),s)}},43360:(s,o,i)=>{var u=i(93243);s.exports=function baseAssignValue(s,o,i){"__proto__"==o&&u?u(s,o,{configurable:!0,enumerable:!0,value:i,writable:!0}):s[o]=i}},9999:(s,o,i)=>{var u=i(37217),_=i(83729),w=i(16547),x=i(74733),C=i(43838),j=i(93290),L=i(23007),B=i(92271),$=i(48948),V=i(50002),U=i(83349),z=i(5861),Y=i(76189),Z=i(77199),ee=i(35529),ie=i(56449),ae=i(3656),le=i(87730),ce=i(23805),pe=i(38440),de=i(95950),fe=i(37241),ye="[object Arguments]",be="[object Function]",_e="[object Object]",we={};we[ye]=we["[object Array]"]=we["[object ArrayBuffer]"]=we["[object DataView]"]=we["[object Boolean]"]=we["[object Date]"]=we["[object Float32Array]"]=we["[object Float64Array]"]=we["[object Int8Array]"]=we["[object Int16Array]"]=we["[object Int32Array]"]=we["[object Map]"]=we["[object Number]"]=we[_e]=we["[object RegExp]"]=we["[object Set]"]=we["[object String]"]=we["[object Symbol]"]=we["[object Uint8Array]"]=we["[object Uint8ClampedArray]"]=we["[object Uint16Array]"]=we["[object Uint32Array]"]=!0,we["[object Error]"]=we[be]=we["[object WeakMap]"]=!1,s.exports=function baseClone(s,o,i,Se,xe,Pe){var Te,Re=1&o,qe=2&o,$e=4&o;if(i&&(Te=xe?i(s,Se,xe,Pe):i(s)),void 0!==Te)return Te;if(!ce(s))return s;var ze=ie(s);if(ze){if(Te=Y(s),!Re)return L(s,Te)}else{var We=z(s),He=We==be||"[object GeneratorFunction]"==We;if(ae(s))return j(s,Re);if(We==_e||We==ye||He&&!xe){if(Te=qe||He?{}:ee(s),!Re)return qe?$(s,C(Te,s)):B(s,x(Te,s))}else{if(!we[We])return xe?s:{};Te=Z(s,We,Re)}}Pe||(Pe=new u);var Ye=Pe.get(s);if(Ye)return Ye;Pe.set(s,Te),pe(s)?s.forEach((function(u){Te.add(baseClone(u,o,i,u,s,Pe))})):le(s)&&s.forEach((function(u,_){Te.set(_,baseClone(u,o,i,_,s,Pe))}));var Xe=ze?void 0:($e?qe?U:V:qe?fe:de)(s);return _(Xe||s,(function(u,_){Xe&&(u=s[_=u]),w(Te,_,baseClone(u,o,i,_,s,Pe))})),Te}},39344:(s,o,i)=>{var u=i(23805),_=Object.create,w=function(){function object(){}return function(s){if(!u(s))return{};if(_)return _(s);object.prototype=s;var o=new object;return object.prototype=void 0,o}}();s.exports=w},80909:(s,o,i)=>{var u=i(30641),_=i(38329)(u);s.exports=_},2523:s=>{s.exports=function baseFindIndex(s,o,i,u){for(var _=s.length,w=i+(u?1:-1);u?w--:++w<_;)if(o(s[w],w,s))return w;return-1}},83120:(s,o,i)=>{var u=i(14528),_=i(45891);s.exports=function baseFlatten(s,o,i,w,x){var C=-1,j=s.length;for(i||(i=_),x||(x=[]);++C0&&i(L)?o>1?baseFlatten(L,o-1,i,w,x):u(x,L):w||(x[x.length]=L)}return x}},86649:(s,o,i)=>{var u=i(83221)();s.exports=u},30641:(s,o,i)=>{var u=i(86649),_=i(95950);s.exports=function baseForOwn(s,o){return s&&u(s,o,_)}},47422:(s,o,i)=>{var u=i(31769),_=i(77797);s.exports=function baseGet(s,o){for(var i=0,w=(o=u(o,s)).length;null!=s&&i{var u=i(14528),_=i(56449);s.exports=function baseGetAllKeys(s,o,i){var w=o(s);return _(s)?w:u(w,i(s))}},72552:(s,o,i)=>{var u=i(51873),_=i(659),w=i(59350),x=u?u.toStringTag:void 0;s.exports=function baseGetTag(s){return null==s?void 0===s?"[object Undefined]":"[object Null]":x&&x in Object(s)?_(s):w(s)}},20426:s=>{var o=Object.prototype.hasOwnProperty;s.exports=function baseHas(s,i){return null!=s&&o.call(s,i)}},28077:s=>{s.exports=function baseHasIn(s,o){return null!=s&&o in Object(s)}},96131:(s,o,i)=>{var u=i(2523),_=i(85463),w=i(76959);s.exports=function baseIndexOf(s,o,i){return o==o?w(s,o,i):u(s,_,i)}},27534:(s,o,i)=>{var u=i(72552),_=i(40346);s.exports=function baseIsArguments(s){return _(s)&&"[object Arguments]"==u(s)}},60270:(s,o,i)=>{var u=i(87068),_=i(40346);s.exports=function baseIsEqual(s,o,i,w,x){return s===o||(null==s||null==o||!_(s)&&!_(o)?s!=s&&o!=o:u(s,o,i,w,baseIsEqual,x))}},87068:(s,o,i)=>{var u=i(37217),_=i(25911),w=i(21986),x=i(50689),C=i(5861),j=i(56449),L=i(3656),B=i(37167),$="[object Arguments]",V="[object Array]",U="[object Object]",z=Object.prototype.hasOwnProperty;s.exports=function baseIsEqualDeep(s,o,i,Y,Z,ee){var ie=j(s),ae=j(o),le=ie?V:C(s),ce=ae?V:C(o),pe=(le=le==$?U:le)==U,de=(ce=ce==$?U:ce)==U,fe=le==ce;if(fe&&L(s)){if(!L(o))return!1;ie=!0,pe=!1}if(fe&&!pe)return ee||(ee=new u),ie||B(s)?_(s,o,i,Y,Z,ee):w(s,o,le,i,Y,Z,ee);if(!(1&i)){var ye=pe&&z.call(s,"__wrapped__"),be=de&&z.call(o,"__wrapped__");if(ye||be){var _e=ye?s.value():s,we=be?o.value():o;return ee||(ee=new u),Z(_e,we,i,Y,ee)}}return!!fe&&(ee||(ee=new u),x(s,o,i,Y,Z,ee))}},29172:(s,o,i)=>{var u=i(5861),_=i(40346);s.exports=function baseIsMap(s){return _(s)&&"[object Map]"==u(s)}},41799:(s,o,i)=>{var u=i(37217),_=i(60270);s.exports=function baseIsMatch(s,o,i,w){var x=i.length,C=x,j=!w;if(null==s)return!C;for(s=Object(s);x--;){var L=i[x];if(j&&L[2]?L[1]!==s[L[0]]:!(L[0]in s))return!1}for(;++x{s.exports=function baseIsNaN(s){return s!=s}},45083:(s,o,i)=>{var u=i(1882),_=i(87296),w=i(23805),x=i(47473),C=/^\[object .+?Constructor\]$/,j=Function.prototype,L=Object.prototype,B=j.toString,$=L.hasOwnProperty,V=RegExp("^"+B.call($).replace(/[\\^$.*+?()[\]{}|]/g,"\\$&").replace(/hasOwnProperty|(function).*?(?=\\\()| for .+?(?=\\\])/g,"$1.*?")+"$");s.exports=function baseIsNative(s){return!(!w(s)||_(s))&&(u(s)?V:C).test(x(s))}},16038:(s,o,i)=>{var u=i(5861),_=i(40346);s.exports=function baseIsSet(s){return _(s)&&"[object Set]"==u(s)}},4901:(s,o,i)=>{var u=i(72552),_=i(30294),w=i(40346),x={};x["[object Float32Array]"]=x["[object Float64Array]"]=x["[object Int8Array]"]=x["[object Int16Array]"]=x["[object Int32Array]"]=x["[object Uint8Array]"]=x["[object Uint8ClampedArray]"]=x["[object Uint16Array]"]=x["[object Uint32Array]"]=!0,x["[object Arguments]"]=x["[object Array]"]=x["[object ArrayBuffer]"]=x["[object Boolean]"]=x["[object DataView]"]=x["[object Date]"]=x["[object Error]"]=x["[object Function]"]=x["[object Map]"]=x["[object Number]"]=x["[object Object]"]=x["[object RegExp]"]=x["[object Set]"]=x["[object String]"]=x["[object WeakMap]"]=!1,s.exports=function baseIsTypedArray(s){return w(s)&&_(s.length)&&!!x[u(s)]}},15389:(s,o,i)=>{var u=i(93663),_=i(87978),w=i(83488),x=i(56449),C=i(50583);s.exports=function baseIteratee(s){return"function"==typeof s?s:null==s?w:"object"==typeof s?x(s)?_(s[0],s[1]):u(s):C(s)}},88984:(s,o,i)=>{var u=i(55527),_=i(3650),w=Object.prototype.hasOwnProperty;s.exports=function baseKeys(s){if(!u(s))return _(s);var o=[];for(var i in Object(s))w.call(s,i)&&"constructor"!=i&&o.push(i);return o}},72903:(s,o,i)=>{var u=i(23805),_=i(55527),w=i(90181),x=Object.prototype.hasOwnProperty;s.exports=function baseKeysIn(s){if(!u(s))return w(s);var o=_(s),i=[];for(var C in s)("constructor"!=C||!o&&x.call(s,C))&&i.push(C);return i}},94033:s=>{s.exports=function baseLodash(){}},93663:(s,o,i)=>{var u=i(41799),_=i(10776),w=i(67197);s.exports=function baseMatches(s){var o=_(s);return 1==o.length&&o[0][2]?w(o[0][0],o[0][1]):function(i){return i===s||u(i,s,o)}}},87978:(s,o,i)=>{var u=i(60270),_=i(58156),w=i(80631),x=i(28586),C=i(30756),j=i(67197),L=i(77797);s.exports=function baseMatchesProperty(s,o){return x(s)&&C(o)?j(L(s),o):function(i){var x=_(i,s);return void 0===x&&x===o?w(i,s):u(o,x,3)}}},85250:(s,o,i)=>{var u=i(37217),_=i(87805),w=i(86649),x=i(42824),C=i(23805),j=i(37241),L=i(14974);s.exports=function baseMerge(s,o,i,B,$){s!==o&&w(o,(function(w,j){if($||($=new u),C(w))x(s,o,j,i,baseMerge,B,$);else{var V=B?B(L(s,j),w,j+"",s,o,$):void 0;void 0===V&&(V=w),_(s,j,V)}}),j)}},42824:(s,o,i)=>{var u=i(87805),_=i(93290),w=i(71961),x=i(23007),C=i(35529),j=i(72428),L=i(56449),B=i(83693),$=i(3656),V=i(1882),U=i(23805),z=i(11331),Y=i(37167),Z=i(14974),ee=i(69884);s.exports=function baseMergeDeep(s,o,i,ie,ae,le,ce){var pe=Z(s,i),de=Z(o,i),fe=ce.get(de);if(fe)u(s,i,fe);else{var ye=le?le(pe,de,i+"",s,o,ce):void 0,be=void 0===ye;if(be){var _e=L(de),we=!_e&&$(de),Se=!_e&&!we&&Y(de);ye=de,_e||we||Se?L(pe)?ye=pe:B(pe)?ye=x(pe):we?(be=!1,ye=_(de,!0)):Se?(be=!1,ye=w(de,!0)):ye=[]:z(de)||j(de)?(ye=pe,j(pe)?ye=ee(pe):U(pe)&&!V(pe)||(ye=C(de))):be=!1}be&&(ce.set(de,ye),ae(ye,de,ie,le,ce),ce.delete(de)),u(s,i,ye)}}},47237:s=>{s.exports=function baseProperty(s){return function(o){return null==o?void 0:o[s]}}},17255:(s,o,i)=>{var u=i(47422);s.exports=function basePropertyDeep(s){return function(o){return u(o,s)}}},54552:s=>{s.exports=function basePropertyOf(s){return function(o){return null==s?void 0:s[o]}}},85558:s=>{s.exports=function baseReduce(s,o,i,u,_){return _(s,(function(s,_,w){i=u?(u=!1,s):o(i,s,_,w)})),i}},69302:(s,o,i)=>{var u=i(83488),_=i(56757),w=i(32865);s.exports=function baseRest(s,o){return w(_(s,o,u),s+"")}},73170:(s,o,i)=>{var u=i(16547),_=i(31769),w=i(30361),x=i(23805),C=i(77797);s.exports=function baseSet(s,o,i,j){if(!x(s))return s;for(var L=-1,B=(o=_(o,s)).length,$=B-1,V=s;null!=V&&++L{var u=i(83488),_=i(48152),w=_?function(s,o){return _.set(s,o),s}:u;s.exports=w},19570:(s,o,i)=>{var u=i(37334),_=i(93243),w=i(83488),x=_?function(s,o){return _(s,"toString",{configurable:!0,enumerable:!1,value:u(o),writable:!0})}:w;s.exports=x},25160:s=>{s.exports=function baseSlice(s,o,i){var u=-1,_=s.length;o<0&&(o=-o>_?0:_+o),(i=i>_?_:i)<0&&(i+=_),_=o>i?0:i-o>>>0,o>>>=0;for(var w=Array(_);++u<_;)w[u]=s[u+o];return w}},90916:(s,o,i)=>{var u=i(80909);s.exports=function baseSome(s,o){var i;return u(s,(function(s,u,_){return!(i=o(s,u,_))})),!!i}},78096:s=>{s.exports=function baseTimes(s,o){for(var i=-1,u=Array(s);++i{var u=i(51873),_=i(34932),w=i(56449),x=i(44394),C=u?u.prototype:void 0,j=C?C.toString:void 0;s.exports=function baseToString(s){if("string"==typeof s)return s;if(w(s))return _(s,baseToString)+"";if(x(s))return j?j.call(s):"";var o=s+"";return"0"==o&&1/s==-1/0?"-0":o}},54128:(s,o,i)=>{var u=i(31800),_=/^\s+/;s.exports=function baseTrim(s){return s?s.slice(0,u(s)+1).replace(_,""):s}},27301:s=>{s.exports=function baseUnary(s){return function(o){return s(o)}}},19931:(s,o,i)=>{var u=i(31769),_=i(68090),w=i(68969),x=i(77797);s.exports=function baseUnset(s,o){return o=u(o,s),null==(s=w(s,o))||delete s[x(_(o))]}},51234:s=>{s.exports=function baseZipObject(s,o,i){for(var u=-1,_=s.length,w=o.length,x={};++u<_;){var C=u{s.exports=function cacheHas(s,o){return s.has(o)}},31769:(s,o,i)=>{var u=i(56449),_=i(28586),w=i(61802),x=i(13222);s.exports=function castPath(s,o){return u(s)?s:_(s,o)?[s]:w(x(s))}},28754:(s,o,i)=>{var u=i(25160);s.exports=function castSlice(s,o,i){var _=s.length;return i=void 0===i?_:i,!o&&i>=_?s:u(s,o,i)}},49653:(s,o,i)=>{var u=i(37828);s.exports=function cloneArrayBuffer(s){var o=new s.constructor(s.byteLength);return new u(o).set(new u(s)),o}},93290:(s,o,i)=>{s=i.nmd(s);var u=i(9325),_=o&&!o.nodeType&&o,w=_&&s&&!s.nodeType&&s,x=w&&w.exports===_?u.Buffer:void 0,C=x?x.allocUnsafe:void 0;s.exports=function cloneBuffer(s,o){if(o)return s.slice();var i=s.length,u=C?C(i):new s.constructor(i);return s.copy(u),u}},76169:(s,o,i)=>{var u=i(49653);s.exports=function cloneDataView(s,o){var i=o?u(s.buffer):s.buffer;return new s.constructor(i,s.byteOffset,s.byteLength)}},73201:s=>{var o=/\w*$/;s.exports=function cloneRegExp(s){var i=new s.constructor(s.source,o.exec(s));return i.lastIndex=s.lastIndex,i}},93736:(s,o,i)=>{var u=i(51873),_=u?u.prototype:void 0,w=_?_.valueOf:void 0;s.exports=function cloneSymbol(s){return w?Object(w.call(s)):{}}},71961:(s,o,i)=>{var u=i(49653);s.exports=function cloneTypedArray(s,o){var i=o?u(s.buffer):s.buffer;return new s.constructor(i,s.byteOffset,s.length)}},91596:s=>{var o=Math.max;s.exports=function composeArgs(s,i,u,_){for(var w=-1,x=s.length,C=u.length,j=-1,L=i.length,B=o(x-C,0),$=Array(L+B),V=!_;++j{var o=Math.max;s.exports=function composeArgsRight(s,i,u,_){for(var w=-1,x=s.length,C=-1,j=u.length,L=-1,B=i.length,$=o(x-j,0),V=Array($+B),U=!_;++w<$;)V[w]=s[w];for(var z=w;++L{s.exports=function copyArray(s,o){var i=-1,u=s.length;for(o||(o=Array(u));++i{var u=i(16547),_=i(43360);s.exports=function copyObject(s,o,i,w){var x=!i;i||(i={});for(var C=-1,j=o.length;++C{var u=i(21791),_=i(4664);s.exports=function copySymbols(s,o){return u(s,_(s),o)}},48948:(s,o,i)=>{var u=i(21791),_=i(86375);s.exports=function copySymbolsIn(s,o){return u(s,_(s),o)}},55481:(s,o,i)=>{var u=i(9325)["__core-js_shared__"];s.exports=u},58523:s=>{s.exports=function countHolders(s,o){for(var i=s.length,u=0;i--;)s[i]===o&&++u;return u}},20999:(s,o,i)=>{var u=i(69302),_=i(36800);s.exports=function createAssigner(s){return u((function(o,i){var u=-1,w=i.length,x=w>1?i[w-1]:void 0,C=w>2?i[2]:void 0;for(x=s.length>3&&"function"==typeof x?(w--,x):void 0,C&&_(i[0],i[1],C)&&(x=w<3?void 0:x,w=1),o=Object(o);++u{var u=i(64894);s.exports=function createBaseEach(s,o){return function(i,_){if(null==i)return i;if(!u(i))return s(i,_);for(var w=i.length,x=o?w:-1,C=Object(i);(o?x--:++x{s.exports=function createBaseFor(s){return function(o,i,u){for(var _=-1,w=Object(o),x=u(o),C=x.length;C--;){var j=x[s?C:++_];if(!1===i(w[j],j,w))break}return o}}},11842:(s,o,i)=>{var u=i(82819),_=i(9325);s.exports=function createBind(s,o,i){var w=1&o,x=u(s);return function wrapper(){return(this&&this!==_&&this instanceof wrapper?x:s).apply(w?i:this,arguments)}}},12507:(s,o,i)=>{var u=i(28754),_=i(49698),w=i(63912),x=i(13222);s.exports=function createCaseFirst(s){return function(o){o=x(o);var i=_(o)?w(o):void 0,C=i?i[0]:o.charAt(0),j=i?u(i,1).join(""):o.slice(1);return C[s]()+j}}},45539:(s,o,i)=>{var u=i(40882),_=i(50828),w=i(66645),x=RegExp("['’]","g");s.exports=function createCompounder(s){return function(o){return u(w(_(o).replace(x,"")),s,"")}}},82819:(s,o,i)=>{var u=i(39344),_=i(23805);s.exports=function createCtor(s){return function(){var o=arguments;switch(o.length){case 0:return new s;case 1:return new s(o[0]);case 2:return new s(o[0],o[1]);case 3:return new s(o[0],o[1],o[2]);case 4:return new s(o[0],o[1],o[2],o[3]);case 5:return new s(o[0],o[1],o[2],o[3],o[4]);case 6:return new s(o[0],o[1],o[2],o[3],o[4],o[5]);case 7:return new s(o[0],o[1],o[2],o[3],o[4],o[5],o[6])}var i=u(s.prototype),w=s.apply(i,o);return _(w)?w:i}}},77078:(s,o,i)=>{var u=i(91033),_=i(82819),w=i(37471),x=i(18073),C=i(11287),j=i(36306),L=i(9325);s.exports=function createCurry(s,o,i){var B=_(s);return function wrapper(){for(var _=arguments.length,$=Array(_),V=_,U=C(wrapper);V--;)$[V]=arguments[V];var z=_<3&&$[0]!==U&&$[_-1]!==U?[]:j($,U);return(_-=z.length){var u=i(15389),_=i(64894),w=i(95950);s.exports=function createFind(s){return function(o,i,x){var C=Object(o);if(!_(o)){var j=u(i,3);o=w(o),i=function(s){return j(C[s],s,C)}}var L=s(o,i,x);return L>-1?C[j?o[L]:L]:void 0}}},37471:(s,o,i)=>{var u=i(91596),_=i(53320),w=i(58523),x=i(82819),C=i(18073),j=i(11287),L=i(68294),B=i(36306),$=i(9325);s.exports=function createHybrid(s,o,i,V,U,z,Y,Z,ee,ie){var ae=128&o,le=1&o,ce=2&o,pe=24&o,de=512&o,fe=ce?void 0:x(s);return function wrapper(){for(var ye=arguments.length,be=Array(ye),_e=ye;_e--;)be[_e]=arguments[_e];if(pe)var we=j(wrapper),Se=w(be,we);if(V&&(be=u(be,V,U,pe)),z&&(be=_(be,z,Y,pe)),ye-=Se,pe&&ye1&&be.reverse(),ae&&ee{var u=i(91033),_=i(82819),w=i(9325);s.exports=function createPartial(s,o,i,x){var C=1&o,j=_(s);return function wrapper(){for(var o=-1,_=arguments.length,L=-1,B=x.length,$=Array(B+_),V=this&&this!==w&&this instanceof wrapper?j:s;++L{var u=i(85087),_=i(54641),w=i(70981);s.exports=function createRecurry(s,o,i,x,C,j,L,B,$,V){var U=8&o;o|=U?32:64,4&(o&=~(U?64:32))||(o&=-4);var z=[s,o,C,U?j:void 0,U?L:void 0,U?void 0:j,U?void 0:L,B,$,V],Y=i.apply(void 0,z);return u(s)&&_(Y,z),Y.placeholder=x,w(Y,s,o)}},66977:(s,o,i)=>{var u=i(68882),_=i(11842),w=i(77078),x=i(37471),C=i(24168),j=i(37381),L=i(3209),B=i(54641),$=i(70981),V=i(61489),U=Math.max;s.exports=function createWrap(s,o,i,z,Y,Z,ee,ie){var ae=2&o;if(!ae&&"function"!=typeof s)throw new TypeError("Expected a function");var le=z?z.length:0;if(le||(o&=-97,z=Y=void 0),ee=void 0===ee?ee:U(V(ee),0),ie=void 0===ie?ie:V(ie),le-=Y?Y.length:0,64&o){var ce=z,pe=Y;z=Y=void 0}var de=ae?void 0:j(s),fe=[s,o,i,z,Y,ce,pe,Z,ee,ie];if(de&&L(fe,de),s=fe[0],o=fe[1],i=fe[2],z=fe[3],Y=fe[4],!(ie=fe[9]=void 0===fe[9]?ae?0:s.length:U(fe[9]-le,0))&&24&o&&(o&=-25),o&&1!=o)ye=8==o||16==o?w(s,o,ie):32!=o&&33!=o||Y.length?x.apply(void 0,fe):C(s,o,i,z);else var ye=_(s,o,i);return $((de?u:B)(ye,fe),s,o)}},53138:(s,o,i)=>{var u=i(11331);s.exports=function customOmitClone(s){return u(s)?void 0:s}},24647:(s,o,i)=>{var u=i(54552)({À:"A",Á:"A",Â:"A",Ã:"A",Ä:"A",Å:"A",à:"a",á:"a",â:"a",ã:"a",ä:"a",å:"a",Ç:"C",ç:"c",Ð:"D",ð:"d",È:"E",É:"E",Ê:"E",Ë:"E",è:"e",é:"e",ê:"e",ë:"e",Ì:"I",Í:"I",Î:"I",Ï:"I",ì:"i",í:"i",î:"i",ï:"i",Ñ:"N",ñ:"n",Ò:"O",Ó:"O",Ô:"O",Õ:"O",Ö:"O",Ø:"O",ò:"o",ó:"o",ô:"o",õ:"o",ö:"o",ø:"o",Ù:"U",Ú:"U",Û:"U",Ü:"U",ù:"u",ú:"u",û:"u",ü:"u",Ý:"Y",ý:"y",ÿ:"y",Æ:"Ae",æ:"ae",Þ:"Th",þ:"th",ß:"ss",Ā:"A",Ă:"A",Ą:"A",ā:"a",ă:"a",ą:"a",Ć:"C",Ĉ:"C",Ċ:"C",Č:"C",ć:"c",ĉ:"c",ċ:"c",č:"c",Ď:"D",Đ:"D",ď:"d",đ:"d",Ē:"E",Ĕ:"E",Ė:"E",Ę:"E",Ě:"E",ē:"e",ĕ:"e",ė:"e",ę:"e",ě:"e",Ĝ:"G",Ğ:"G",Ġ:"G",Ģ:"G",ĝ:"g",ğ:"g",ġ:"g",ģ:"g",Ĥ:"H",Ħ:"H",ĥ:"h",ħ:"h",Ĩ:"I",Ī:"I",Ĭ:"I",Į:"I",İ:"I",ĩ:"i",ī:"i",ĭ:"i",į:"i",ı:"i",Ĵ:"J",ĵ:"j",Ķ:"K",ķ:"k",ĸ:"k",Ĺ:"L",Ļ:"L",Ľ:"L",Ŀ:"L",Ł:"L",ĺ:"l",ļ:"l",ľ:"l",ŀ:"l",ł:"l",Ń:"N",Ņ:"N",Ň:"N",Ŋ:"N",ń:"n",ņ:"n",ň:"n",ŋ:"n",Ō:"O",Ŏ:"O",Ő:"O",ō:"o",ŏ:"o",ő:"o",Ŕ:"R",Ŗ:"R",Ř:"R",ŕ:"r",ŗ:"r",ř:"r",Ś:"S",Ŝ:"S",Ş:"S",Š:"S",ś:"s",ŝ:"s",ş:"s",š:"s",Ţ:"T",Ť:"T",Ŧ:"T",ţ:"t",ť:"t",ŧ:"t",Ũ:"U",Ū:"U",Ŭ:"U",Ů:"U",Ű:"U",Ų:"U",ũ:"u",ū:"u",ŭ:"u",ů:"u",ű:"u",ų:"u",Ŵ:"W",ŵ:"w",Ŷ:"Y",ŷ:"y",Ÿ:"Y",Ź:"Z",Ż:"Z",Ž:"Z",ź:"z",ż:"z",ž:"z",IJ:"IJ",ij:"ij",Œ:"Oe",œ:"oe",ʼn:"'n",ſ:"s"});s.exports=u},93243:(s,o,i)=>{var u=i(56110),_=function(){try{var s=u(Object,"defineProperty");return s({},"",{}),s}catch(s){}}();s.exports=_},25911:(s,o,i)=>{var u=i(38859),_=i(14248),w=i(19219);s.exports=function equalArrays(s,o,i,x,C,j){var L=1&i,B=s.length,$=o.length;if(B!=$&&!(L&&$>B))return!1;var V=j.get(s),U=j.get(o);if(V&&U)return V==o&&U==s;var z=-1,Y=!0,Z=2&i?new u:void 0;for(j.set(s,o),j.set(o,s);++z{var u=i(51873),_=i(37828),w=i(75288),x=i(25911),C=i(20317),j=i(84247),L=u?u.prototype:void 0,B=L?L.valueOf:void 0;s.exports=function equalByTag(s,o,i,u,L,$,V){switch(i){case"[object DataView]":if(s.byteLength!=o.byteLength||s.byteOffset!=o.byteOffset)return!1;s=s.buffer,o=o.buffer;case"[object ArrayBuffer]":return!(s.byteLength!=o.byteLength||!$(new _(s),new _(o)));case"[object Boolean]":case"[object Date]":case"[object Number]":return w(+s,+o);case"[object Error]":return s.name==o.name&&s.message==o.message;case"[object RegExp]":case"[object String]":return s==o+"";case"[object Map]":var U=C;case"[object Set]":var z=1&u;if(U||(U=j),s.size!=o.size&&!z)return!1;var Y=V.get(s);if(Y)return Y==o;u|=2,V.set(s,o);var Z=x(U(s),U(o),u,L,$,V);return V.delete(s),Z;case"[object Symbol]":if(B)return B.call(s)==B.call(o)}return!1}},50689:(s,o,i)=>{var u=i(50002),_=Object.prototype.hasOwnProperty;s.exports=function equalObjects(s,o,i,w,x,C){var j=1&i,L=u(s),B=L.length;if(B!=u(o).length&&!j)return!1;for(var $=B;$--;){var V=L[$];if(!(j?V in o:_.call(o,V)))return!1}var U=C.get(s),z=C.get(o);if(U&&z)return U==o&&z==s;var Y=!0;C.set(s,o),C.set(o,s);for(var Z=j;++${var u=i(35970),_=i(56757),w=i(32865);s.exports=function flatRest(s){return w(_(s,void 0,u),s+"")}},34840:(s,o,i)=>{var u="object"==typeof i.g&&i.g&&i.g.Object===Object&&i.g;s.exports=u},50002:(s,o,i)=>{var u=i(82199),_=i(4664),w=i(95950);s.exports=function getAllKeys(s){return u(s,w,_)}},83349:(s,o,i)=>{var u=i(82199),_=i(86375),w=i(37241);s.exports=function getAllKeysIn(s){return u(s,w,_)}},37381:(s,o,i)=>{var u=i(48152),_=i(63950),w=u?function(s){return u.get(s)}:_;s.exports=w},62284:(s,o,i)=>{var u=i(84629),_=Object.prototype.hasOwnProperty;s.exports=function getFuncName(s){for(var o=s.name+"",i=u[o],w=_.call(u,o)?i.length:0;w--;){var x=i[w],C=x.func;if(null==C||C==s)return x.name}return o}},11287:s=>{s.exports=function getHolder(s){return s.placeholder}},12651:(s,o,i)=>{var u=i(74218);s.exports=function getMapData(s,o){var i=s.__data__;return u(o)?i["string"==typeof o?"string":"hash"]:i.map}},10776:(s,o,i)=>{var u=i(30756),_=i(95950);s.exports=function getMatchData(s){for(var o=_(s),i=o.length;i--;){var w=o[i],x=s[w];o[i]=[w,x,u(x)]}return o}},56110:(s,o,i)=>{var u=i(45083),_=i(10392);s.exports=function getNative(s,o){var i=_(s,o);return u(i)?i:void 0}},28879:(s,o,i)=>{var u=i(74335)(Object.getPrototypeOf,Object);s.exports=u},659:(s,o,i)=>{var u=i(51873),_=Object.prototype,w=_.hasOwnProperty,x=_.toString,C=u?u.toStringTag:void 0;s.exports=function getRawTag(s){var o=w.call(s,C),i=s[C];try{s[C]=void 0;var u=!0}catch(s){}var _=x.call(s);return u&&(o?s[C]=i:delete s[C]),_}},4664:(s,o,i)=>{var u=i(79770),_=i(63345),w=Object.prototype.propertyIsEnumerable,x=Object.getOwnPropertySymbols,C=x?function(s){return null==s?[]:(s=Object(s),u(x(s),(function(o){return w.call(s,o)})))}:_;s.exports=C},86375:(s,o,i)=>{var u=i(14528),_=i(28879),w=i(4664),x=i(63345),C=Object.getOwnPropertySymbols?function(s){for(var o=[];s;)u(o,w(s)),s=_(s);return o}:x;s.exports=C},5861:(s,o,i)=>{var u=i(55580),_=i(68223),w=i(32804),x=i(76545),C=i(28303),j=i(72552),L=i(47473),B="[object Map]",$="[object Promise]",V="[object Set]",U="[object WeakMap]",z="[object DataView]",Y=L(u),Z=L(_),ee=L(w),ie=L(x),ae=L(C),le=j;(u&&le(new u(new ArrayBuffer(1)))!=z||_&&le(new _)!=B||w&&le(w.resolve())!=$||x&&le(new x)!=V||C&&le(new C)!=U)&&(le=function(s){var o=j(s),i="[object Object]"==o?s.constructor:void 0,u=i?L(i):"";if(u)switch(u){case Y:return z;case Z:return B;case ee:return $;case ie:return V;case ae:return U}return o}),s.exports=le},10392:s=>{s.exports=function getValue(s,o){return null==s?void 0:s[o]}},75251:s=>{var o=/\{\n\/\* \[wrapped with (.+)\] \*/,i=/,? & /;s.exports=function getWrapDetails(s){var u=s.match(o);return u?u[1].split(i):[]}},49326:(s,o,i)=>{var u=i(31769),_=i(72428),w=i(56449),x=i(30361),C=i(30294),j=i(77797);s.exports=function hasPath(s,o,i){for(var L=-1,B=(o=u(o,s)).length,$=!1;++L{var o=RegExp("[\\u200d\\ud800-\\udfff\\u0300-\\u036f\\ufe20-\\ufe2f\\u20d0-\\u20ff\\ufe0e\\ufe0f]");s.exports=function hasUnicode(s){return o.test(s)}},45434:s=>{var o=/[a-z][A-Z]|[A-Z]{2}[a-z]|[0-9][a-zA-Z]|[a-zA-Z][0-9]|[^a-zA-Z0-9 ]/;s.exports=function hasUnicodeWord(s){return o.test(s)}},22032:(s,o,i)=>{var u=i(81042);s.exports=function hashClear(){this.__data__=u?u(null):{},this.size=0}},63862:s=>{s.exports=function hashDelete(s){var o=this.has(s)&&delete this.__data__[s];return this.size-=o?1:0,o}},66721:(s,o,i)=>{var u=i(81042),_=Object.prototype.hasOwnProperty;s.exports=function hashGet(s){var o=this.__data__;if(u){var i=o[s];return"__lodash_hash_undefined__"===i?void 0:i}return _.call(o,s)?o[s]:void 0}},12749:(s,o,i)=>{var u=i(81042),_=Object.prototype.hasOwnProperty;s.exports=function hashHas(s){var o=this.__data__;return u?void 0!==o[s]:_.call(o,s)}},35749:(s,o,i)=>{var u=i(81042);s.exports=function hashSet(s,o){var i=this.__data__;return this.size+=this.has(s)?0:1,i[s]=u&&void 0===o?"__lodash_hash_undefined__":o,this}},76189:s=>{var o=Object.prototype.hasOwnProperty;s.exports=function initCloneArray(s){var i=s.length,u=new s.constructor(i);return i&&"string"==typeof s[0]&&o.call(s,"index")&&(u.index=s.index,u.input=s.input),u}},77199:(s,o,i)=>{var u=i(49653),_=i(76169),w=i(73201),x=i(93736),C=i(71961);s.exports=function initCloneByTag(s,o,i){var j=s.constructor;switch(o){case"[object ArrayBuffer]":return u(s);case"[object Boolean]":case"[object Date]":return new j(+s);case"[object DataView]":return _(s,i);case"[object Float32Array]":case"[object Float64Array]":case"[object Int8Array]":case"[object Int16Array]":case"[object Int32Array]":case"[object Uint8Array]":case"[object Uint8ClampedArray]":case"[object Uint16Array]":case"[object Uint32Array]":return C(s,i);case"[object Map]":case"[object Set]":return new j;case"[object Number]":case"[object String]":return new j(s);case"[object RegExp]":return w(s);case"[object Symbol]":return x(s)}}},35529:(s,o,i)=>{var u=i(39344),_=i(28879),w=i(55527);s.exports=function initCloneObject(s){return"function"!=typeof s.constructor||w(s)?{}:u(_(s))}},62060:s=>{var o=/\{(?:\n\/\* \[wrapped with .+\] \*\/)?\n?/;s.exports=function insertWrapDetails(s,i){var u=i.length;if(!u)return s;var _=u-1;return i[_]=(u>1?"& ":"")+i[_],i=i.join(u>2?", ":" "),s.replace(o,"{\n/* [wrapped with "+i+"] */\n")}},45891:(s,o,i)=>{var u=i(51873),_=i(72428),w=i(56449),x=u?u.isConcatSpreadable:void 0;s.exports=function isFlattenable(s){return w(s)||_(s)||!!(x&&s&&s[x])}},30361:s=>{var o=/^(?:0|[1-9]\d*)$/;s.exports=function isIndex(s,i){var u=typeof s;return!!(i=null==i?9007199254740991:i)&&("number"==u||"symbol"!=u&&o.test(s))&&s>-1&&s%1==0&&s{var u=i(75288),_=i(64894),w=i(30361),x=i(23805);s.exports=function isIterateeCall(s,o,i){if(!x(i))return!1;var C=typeof o;return!!("number"==C?_(i)&&w(o,i.length):"string"==C&&o in i)&&u(i[o],s)}},28586:(s,o,i)=>{var u=i(56449),_=i(44394),w=/\.|\[(?:[^[\]]*|(["'])(?:(?!\1)[^\\]|\\.)*?\1)\]/,x=/^\w*$/;s.exports=function isKey(s,o){if(u(s))return!1;var i=typeof s;return!("number"!=i&&"symbol"!=i&&"boolean"!=i&&null!=s&&!_(s))||(x.test(s)||!w.test(s)||null!=o&&s in Object(o))}},74218:s=>{s.exports=function isKeyable(s){var o=typeof s;return"string"==o||"number"==o||"symbol"==o||"boolean"==o?"__proto__"!==s:null===s}},85087:(s,o,i)=>{var u=i(30980),_=i(37381),w=i(62284),x=i(53758);s.exports=function isLaziable(s){var o=w(s),i=x[o];if("function"!=typeof i||!(o in u.prototype))return!1;if(s===i)return!0;var C=_(i);return!!C&&s===C[0]}},87296:(s,o,i)=>{var u,_=i(55481),w=(u=/[^.]+$/.exec(_&&_.keys&&_.keys.IE_PROTO||""))?"Symbol(src)_1."+u:"";s.exports=function isMasked(s){return!!w&&w in s}},55527:s=>{var o=Object.prototype;s.exports=function isPrototype(s){var i=s&&s.constructor;return s===("function"==typeof i&&i.prototype||o)}},30756:(s,o,i)=>{var u=i(23805);s.exports=function isStrictComparable(s){return s==s&&!u(s)}},63702:s=>{s.exports=function listCacheClear(){this.__data__=[],this.size=0}},70080:(s,o,i)=>{var u=i(26025),_=Array.prototype.splice;s.exports=function listCacheDelete(s){var o=this.__data__,i=u(o,s);return!(i<0)&&(i==o.length-1?o.pop():_.call(o,i,1),--this.size,!0)}},24739:(s,o,i)=>{var u=i(26025);s.exports=function listCacheGet(s){var o=this.__data__,i=u(o,s);return i<0?void 0:o[i][1]}},48655:(s,o,i)=>{var u=i(26025);s.exports=function listCacheHas(s){return u(this.__data__,s)>-1}},31175:(s,o,i)=>{var u=i(26025);s.exports=function listCacheSet(s,o){var i=this.__data__,_=u(i,s);return _<0?(++this.size,i.push([s,o])):i[_][1]=o,this}},63040:(s,o,i)=>{var u=i(21549),_=i(80079),w=i(68223);s.exports=function mapCacheClear(){this.size=0,this.__data__={hash:new u,map:new(w||_),string:new u}}},17670:(s,o,i)=>{var u=i(12651);s.exports=function mapCacheDelete(s){var o=u(this,s).delete(s);return this.size-=o?1:0,o}},90289:(s,o,i)=>{var u=i(12651);s.exports=function mapCacheGet(s){return u(this,s).get(s)}},4509:(s,o,i)=>{var u=i(12651);s.exports=function mapCacheHas(s){return u(this,s).has(s)}},72949:(s,o,i)=>{var u=i(12651);s.exports=function mapCacheSet(s,o){var i=u(this,s),_=i.size;return i.set(s,o),this.size+=i.size==_?0:1,this}},20317:s=>{s.exports=function mapToArray(s){var o=-1,i=Array(s.size);return s.forEach((function(s,u){i[++o]=[u,s]})),i}},67197:s=>{s.exports=function matchesStrictComparable(s,o){return function(i){return null!=i&&(i[s]===o&&(void 0!==o||s in Object(i)))}}},62224:(s,o,i)=>{var u=i(50104);s.exports=function memoizeCapped(s){var o=u(s,(function(s){return 500===i.size&&i.clear(),s})),i=o.cache;return o}},3209:(s,o,i)=>{var u=i(91596),_=i(53320),w=i(36306),x="__lodash_placeholder__",C=128,j=Math.min;s.exports=function mergeData(s,o){var i=s[1],L=o[1],B=i|L,$=B<131,V=L==C&&8==i||L==C&&256==i&&s[7].length<=o[8]||384==L&&o[7].length<=o[8]&&8==i;if(!$&&!V)return s;1&L&&(s[2]=o[2],B|=1&i?0:4);var U=o[3];if(U){var z=s[3];s[3]=z?u(z,U,o[4]):U,s[4]=z?w(s[3],x):o[4]}return(U=o[5])&&(z=s[5],s[5]=z?_(z,U,o[6]):U,s[6]=z?w(s[5],x):o[6]),(U=o[7])&&(s[7]=U),L&C&&(s[8]=null==s[8]?o[8]:j(s[8],o[8])),null==s[9]&&(s[9]=o[9]),s[0]=o[0],s[1]=B,s}},48152:(s,o,i)=>{var u=i(28303),_=u&&new u;s.exports=_},81042:(s,o,i)=>{var u=i(56110)(Object,"create");s.exports=u},3650:(s,o,i)=>{var u=i(74335)(Object.keys,Object);s.exports=u},90181:s=>{s.exports=function nativeKeysIn(s){var o=[];if(null!=s)for(var i in Object(s))o.push(i);return o}},86009:(s,o,i)=>{s=i.nmd(s);var u=i(34840),_=o&&!o.nodeType&&o,w=_&&s&&!s.nodeType&&s,x=w&&w.exports===_&&u.process,C=function(){try{var s=w&&w.require&&w.require("util").types;return s||x&&x.binding&&x.binding("util")}catch(s){}}();s.exports=C},59350:s=>{var o=Object.prototype.toString;s.exports=function objectToString(s){return o.call(s)}},74335:s=>{s.exports=function overArg(s,o){return function(i){return s(o(i))}}},56757:(s,o,i)=>{var u=i(91033),_=Math.max;s.exports=function overRest(s,o,i){return o=_(void 0===o?s.length-1:o,0),function(){for(var w=arguments,x=-1,C=_(w.length-o,0),j=Array(C);++x{var u=i(47422),_=i(25160);s.exports=function parent(s,o){return o.length<2?s:u(s,_(o,0,-1))}},84629:s=>{s.exports={}},68294:(s,o,i)=>{var u=i(23007),_=i(30361),w=Math.min;s.exports=function reorder(s,o){for(var i=s.length,x=w(o.length,i),C=u(s);x--;){var j=o[x];s[x]=_(j,i)?C[j]:void 0}return s}},36306:s=>{var o="__lodash_placeholder__";s.exports=function replaceHolders(s,i){for(var u=-1,_=s.length,w=0,x=[];++u<_;){var C=s[u];C!==i&&C!==o||(s[u]=o,x[w++]=u)}return x}},9325:(s,o,i)=>{var u=i(34840),_="object"==typeof self&&self&&self.Object===Object&&self,w=u||_||Function("return this")();s.exports=w},14974:s=>{s.exports=function safeGet(s,o){if(("constructor"!==o||"function"!=typeof s[o])&&"__proto__"!=o)return s[o]}},31380:s=>{s.exports=function setCacheAdd(s){return this.__data__.set(s,"__lodash_hash_undefined__"),this}},51459:s=>{s.exports=function setCacheHas(s){return this.__data__.has(s)}},54641:(s,o,i)=>{var u=i(68882),_=i(51811)(u);s.exports=_},84247:s=>{s.exports=function setToArray(s){var o=-1,i=Array(s.size);return s.forEach((function(s){i[++o]=s})),i}},32865:(s,o,i)=>{var u=i(19570),_=i(51811)(u);s.exports=_},70981:(s,o,i)=>{var u=i(75251),_=i(62060),w=i(32865),x=i(75948);s.exports=function setWrapToString(s,o,i){var C=o+"";return w(s,_(C,x(u(C),i)))}},51811:s=>{var o=Date.now;s.exports=function shortOut(s){var i=0,u=0;return function(){var _=o(),w=16-(_-u);if(u=_,w>0){if(++i>=800)return arguments[0]}else i=0;return s.apply(void 0,arguments)}}},51420:(s,o,i)=>{var u=i(80079);s.exports=function stackClear(){this.__data__=new u,this.size=0}},90938:s=>{s.exports=function stackDelete(s){var o=this.__data__,i=o.delete(s);return this.size=o.size,i}},63605:s=>{s.exports=function stackGet(s){return this.__data__.get(s)}},29817:s=>{s.exports=function stackHas(s){return this.__data__.has(s)}},80945:(s,o,i)=>{var u=i(80079),_=i(68223),w=i(53661);s.exports=function stackSet(s,o){var i=this.__data__;if(i instanceof u){var x=i.__data__;if(!_||x.length<199)return x.push([s,o]),this.size=++i.size,this;i=this.__data__=new w(x)}return i.set(s,o),this.size=i.size,this}},76959:s=>{s.exports=function strictIndexOf(s,o,i){for(var u=i-1,_=s.length;++u<_;)if(s[u]===o)return u;return-1}},63912:(s,o,i)=>{var u=i(61074),_=i(49698),w=i(42054);s.exports=function stringToArray(s){return _(s)?w(s):u(s)}},61802:(s,o,i)=>{var u=i(62224),_=/[^.[\]]+|\[(?:(-?\d+(?:\.\d+)?)|(["'])((?:(?!\2)[^\\]|\\.)*?)\2)\]|(?=(?:\.|\[\])(?:\.|\[\]|$))/g,w=/\\(\\)?/g,x=u((function(s){var o=[];return 46===s.charCodeAt(0)&&o.push(""),s.replace(_,(function(s,i,u,_){o.push(u?_.replace(w,"$1"):i||s)})),o}));s.exports=x},77797:(s,o,i)=>{var u=i(44394);s.exports=function toKey(s){if("string"==typeof s||u(s))return s;var o=s+"";return"0"==o&&1/s==-1/0?"-0":o}},47473:s=>{var o=Function.prototype.toString;s.exports=function toSource(s){if(null!=s){try{return o.call(s)}catch(s){}try{return s+""}catch(s){}}return""}},31800:s=>{var o=/\s/;s.exports=function trimmedEndIndex(s){for(var i=s.length;i--&&o.test(s.charAt(i)););return i}},42054:s=>{var o="\\ud800-\\udfff",i="["+o+"]",u="[\\u0300-\\u036f\\ufe20-\\ufe2f\\u20d0-\\u20ff]",_="\\ud83c[\\udffb-\\udfff]",w="[^"+o+"]",x="(?:\\ud83c[\\udde6-\\uddff]){2}",C="[\\ud800-\\udbff][\\udc00-\\udfff]",j="(?:"+u+"|"+_+")"+"?",L="[\\ufe0e\\ufe0f]?",B=L+j+("(?:\\u200d(?:"+[w,x,C].join("|")+")"+L+j+")*"),$="(?:"+[w+u+"?",u,x,C,i].join("|")+")",V=RegExp(_+"(?="+_+")|"+$+B,"g");s.exports=function unicodeToArray(s){return s.match(V)||[]}},22225:s=>{var o="\\ud800-\\udfff",i="\\u2700-\\u27bf",u="a-z\\xdf-\\xf6\\xf8-\\xff",_="A-Z\\xc0-\\xd6\\xd8-\\xde",w="\\xac\\xb1\\xd7\\xf7\\x00-\\x2f\\x3a-\\x40\\x5b-\\x60\\x7b-\\xbf\\u2000-\\u206f \\t\\x0b\\f\\xa0\\ufeff\\n\\r\\u2028\\u2029\\u1680\\u180e\\u2000\\u2001\\u2002\\u2003\\u2004\\u2005\\u2006\\u2007\\u2008\\u2009\\u200a\\u202f\\u205f\\u3000",x="["+w+"]",C="\\d+",j="["+i+"]",L="["+u+"]",B="[^"+o+w+C+i+u+_+"]",$="(?:\\ud83c[\\udde6-\\uddff]){2}",V="[\\ud800-\\udbff][\\udc00-\\udfff]",U="["+_+"]",z="(?:"+L+"|"+B+")",Y="(?:"+U+"|"+B+")",Z="(?:['’](?:d|ll|m|re|s|t|ve))?",ee="(?:['’](?:D|LL|M|RE|S|T|VE))?",ie="(?:[\\u0300-\\u036f\\ufe20-\\ufe2f\\u20d0-\\u20ff]|\\ud83c[\\udffb-\\udfff])?",ae="[\\ufe0e\\ufe0f]?",le=ae+ie+("(?:\\u200d(?:"+["[^"+o+"]",$,V].join("|")+")"+ae+ie+")*"),ce="(?:"+[j,$,V].join("|")+")"+le,pe=RegExp([U+"?"+L+"+"+Z+"(?="+[x,U,"$"].join("|")+")",Y+"+"+ee+"(?="+[x,U+z,"$"].join("|")+")",U+"?"+z+"+"+Z,U+"+"+ee,"\\d*(?:1ST|2ND|3RD|(?![123])\\dTH)(?=\\b|[a-z_])","\\d*(?:1st|2nd|3rd|(?![123])\\dth)(?=\\b|[A-Z_])",C,ce].join("|"),"g");s.exports=function unicodeWords(s){return s.match(pe)||[]}},75948:(s,o,i)=>{var u=i(83729),_=i(15325),w=[["ary",128],["bind",1],["bindKey",2],["curry",8],["curryRight",16],["flip",512],["partial",32],["partialRight",64],["rearg",256]];s.exports=function updateWrapDetails(s,o){return u(w,(function(i){var u="_."+i[0];o&i[1]&&!_(s,u)&&s.push(u)})),s.sort()}},80257:(s,o,i)=>{var u=i(30980),_=i(56017),w=i(23007);s.exports=function wrapperClone(s){if(s instanceof u)return s.clone();var o=new _(s.__wrapped__,s.__chain__);return o.__actions__=w(s.__actions__),o.__index__=s.__index__,o.__values__=s.__values__,o}},64626:(s,o,i)=>{var u=i(66977);s.exports=function ary(s,o,i){return o=i?void 0:o,o=s&&null==o?s.length:o,u(s,128,void 0,void 0,void 0,void 0,o)}},84058:(s,o,i)=>{var u=i(14792),_=i(45539)((function(s,o,i){return o=o.toLowerCase(),s+(i?u(o):o)}));s.exports=_},14792:(s,o,i)=>{var u=i(13222),_=i(55808);s.exports=function capitalize(s){return _(u(s).toLowerCase())}},32629:(s,o,i)=>{var u=i(9999);s.exports=function clone(s){return u(s,4)}},37334:s=>{s.exports=function constant(s){return function(){return s}}},49747:(s,o,i)=>{var u=i(66977);function curry(s,o,i){var _=u(s,8,void 0,void 0,void 0,void 0,void 0,o=i?void 0:o);return _.placeholder=curry.placeholder,_}curry.placeholder={},s.exports=curry},38221:(s,o,i)=>{var u=i(23805),_=i(10124),w=i(99374),x=Math.max,C=Math.min;s.exports=function debounce(s,o,i){var j,L,B,$,V,U,z=0,Y=!1,Z=!1,ee=!0;if("function"!=typeof s)throw new TypeError("Expected a function");function invokeFunc(o){var i=j,u=L;return j=L=void 0,z=o,$=s.apply(u,i)}function shouldInvoke(s){var i=s-U;return void 0===U||i>=o||i<0||Z&&s-z>=B}function timerExpired(){var s=_();if(shouldInvoke(s))return trailingEdge(s);V=setTimeout(timerExpired,function remainingWait(s){var i=o-(s-U);return Z?C(i,B-(s-z)):i}(s))}function trailingEdge(s){return V=void 0,ee&&j?invokeFunc(s):(j=L=void 0,$)}function debounced(){var s=_(),i=shouldInvoke(s);if(j=arguments,L=this,U=s,i){if(void 0===V)return function leadingEdge(s){return z=s,V=setTimeout(timerExpired,o),Y?invokeFunc(s):$}(U);if(Z)return clearTimeout(V),V=setTimeout(timerExpired,o),invokeFunc(U)}return void 0===V&&(V=setTimeout(timerExpired,o)),$}return o=w(o)||0,u(i)&&(Y=!!i.leading,B=(Z="maxWait"in i)?x(w(i.maxWait)||0,o):B,ee="trailing"in i?!!i.trailing:ee),debounced.cancel=function cancel(){void 0!==V&&clearTimeout(V),z=0,j=U=L=V=void 0},debounced.flush=function flush(){return void 0===V?$:trailingEdge(_())},debounced}},50828:(s,o,i)=>{var u=i(24647),_=i(13222),w=/[\xc0-\xd6\xd8-\xf6\xf8-\xff\u0100-\u017f]/g,x=RegExp("[\\u0300-\\u036f\\ufe20-\\ufe2f\\u20d0-\\u20ff]","g");s.exports=function deburr(s){return(s=_(s))&&s.replace(w,u).replace(x,"")}},75288:s=>{s.exports=function eq(s,o){return s===o||s!=s&&o!=o}},60680:(s,o,i)=>{var u=i(13222),_=/[\\^$.*+?()[\]{}|]/g,w=RegExp(_.source);s.exports=function escapeRegExp(s){return(s=u(s))&&w.test(s)?s.replace(_,"\\$&"):s}},7309:(s,o,i)=>{var u=i(62006)(i(24713));s.exports=u},24713:(s,o,i)=>{var u=i(2523),_=i(15389),w=i(61489),x=Math.max;s.exports=function findIndex(s,o,i){var C=null==s?0:s.length;if(!C)return-1;var j=null==i?0:w(i);return j<0&&(j=x(C+j,0)),u(s,_(o,3),j)}},35970:(s,o,i)=>{var u=i(83120);s.exports=function flatten(s){return(null==s?0:s.length)?u(s,1):[]}},73424:(s,o,i)=>{var u=i(16962),_=i(2874),w=Array.prototype.push;function baseAry(s,o){return 2==o?function(o,i){return s(o,i)}:function(o){return s(o)}}function cloneArray(s){for(var o=s?s.length:0,i=Array(o);o--;)i[o]=s[o];return i}function wrapImmutable(s,o){return function(){var i=arguments.length;if(i){for(var u=Array(i);i--;)u[i]=arguments[i];var _=u[0]=o.apply(void 0,u);return s.apply(void 0,u),_}}}s.exports=function baseConvert(s,o,i,x){var C="function"==typeof o,j=o===Object(o);if(j&&(x=i,i=o,o=void 0),null==i)throw new TypeError;x||(x={});var L=!("cap"in x)||x.cap,B=!("curry"in x)||x.curry,$=!("fixed"in x)||x.fixed,V=!("immutable"in x)||x.immutable,U=!("rearg"in x)||x.rearg,z=C?i:_,Y="curry"in x&&x.curry,Z="fixed"in x&&x.fixed,ee="rearg"in x&&x.rearg,ie=C?i.runInContext():void 0,ae=C?i:{ary:s.ary,assign:s.assign,clone:s.clone,curry:s.curry,forEach:s.forEach,isArray:s.isArray,isError:s.isError,isFunction:s.isFunction,isWeakMap:s.isWeakMap,iteratee:s.iteratee,keys:s.keys,rearg:s.rearg,toInteger:s.toInteger,toPath:s.toPath},le=ae.ary,ce=ae.assign,pe=ae.clone,de=ae.curry,fe=ae.forEach,ye=ae.isArray,be=ae.isError,_e=ae.isFunction,we=ae.isWeakMap,Se=ae.keys,xe=ae.rearg,Pe=ae.toInteger,Te=ae.toPath,Re=Se(u.aryMethod),qe={castArray:function(s){return function(){var o=arguments[0];return ye(o)?s(cloneArray(o)):s.apply(void 0,arguments)}},iteratee:function(s){return function(){var o=arguments[1],i=s(arguments[0],o),u=i.length;return L&&"number"==typeof o?(o=o>2?o-2:1,u&&u<=o?i:baseAry(i,o)):i}},mixin:function(s){return function(o){var i=this;if(!_e(i))return s(i,Object(o));var u=[];return fe(Se(o),(function(s){_e(o[s])&&u.push([s,i.prototype[s]])})),s(i,Object(o)),fe(u,(function(s){var o=s[1];_e(o)?i.prototype[s[0]]=o:delete i.prototype[s[0]]})),i}},nthArg:function(s){return function(o){var i=o<0?1:Pe(o)+1;return de(s(o),i)}},rearg:function(s){return function(o,i){var u=i?i.length:0;return de(s(o,i),u)}},runInContext:function(o){return function(i){return baseConvert(s,o(i),x)}}};function castCap(s,o){if(L){var i=u.iterateeRearg[s];if(i)return function iterateeRearg(s,o){return overArg(s,(function(s){var i=o.length;return function baseArity(s,o){return 2==o?function(o,i){return s.apply(void 0,arguments)}:function(o){return s.apply(void 0,arguments)}}(xe(baseAry(s,i),o),i)}))}(o,i);var _=!C&&u.iterateeAry[s];if(_)return function iterateeAry(s,o){return overArg(s,(function(s){return"function"==typeof s?baseAry(s,o):s}))}(o,_)}return o}function castFixed(s,o,i){if($&&(Z||!u.skipFixed[s])){var _=u.methodSpread[s],x=_&&_.start;return void 0===x?le(o,i):function flatSpread(s,o){return function(){for(var i=arguments.length,u=i-1,_=Array(i);i--;)_[i]=arguments[i];var x=_[o],C=_.slice(0,o);return x&&w.apply(C,x),o!=u&&w.apply(C,_.slice(o+1)),s.apply(this,C)}}(o,x)}return o}function castRearg(s,o,i){return U&&i>1&&(ee||!u.skipRearg[s])?xe(o,u.methodRearg[s]||u.aryRearg[i]):o}function cloneByPath(s,o){for(var i=-1,u=(o=Te(o)).length,_=u-1,w=pe(Object(s)),x=w;null!=x&&++i1?de(o,i):o}(0,_=castCap(w,_),s),!1}})),!_})),_||(_=x),_==o&&(_=Y?de(_,1):function(){return o.apply(this,arguments)}),_.convert=createConverter(w,o),_.placeholder=o.placeholder=i,_}if(!j)return wrap(o,i,z);var $e=i,ze=[];return fe(Re,(function(s){fe(u.aryMethod[s],(function(s){var o=$e[u.remap[s]||s];o&&ze.push([s,wrap(s,o,$e)])}))})),fe(Se($e),(function(s){var o=$e[s];if("function"==typeof o){for(var i=ze.length;i--;)if(ze[i][0]==s)return;o.convert=createConverter(s,o),ze.push([s,o])}})),fe(ze,(function(s){$e[s[0]]=s[1]})),$e.convert=function convertLib(s){return $e.runInContext.convert(s)(void 0)},$e.placeholder=$e,fe(Se($e),(function(s){fe(u.realToAlias[s]||[],(function(o){$e[o]=$e[s]}))})),$e}},16962:(s,o)=>{o.aliasToReal={each:"forEach",eachRight:"forEachRight",entries:"toPairs",entriesIn:"toPairsIn",extend:"assignIn",extendAll:"assignInAll",extendAllWith:"assignInAllWith",extendWith:"assignInWith",first:"head",conforms:"conformsTo",matches:"isMatch",property:"get",__:"placeholder",F:"stubFalse",T:"stubTrue",all:"every",allPass:"overEvery",always:"constant",any:"some",anyPass:"overSome",apply:"spread",assoc:"set",assocPath:"set",complement:"negate",compose:"flowRight",contains:"includes",dissoc:"unset",dissocPath:"unset",dropLast:"dropRight",dropLastWhile:"dropRightWhile",equals:"isEqual",identical:"eq",indexBy:"keyBy",init:"initial",invertObj:"invert",juxt:"over",omitAll:"omit",nAry:"ary",path:"get",pathEq:"matchesProperty",pathOr:"getOr",paths:"at",pickAll:"pick",pipe:"flow",pluck:"map",prop:"get",propEq:"matchesProperty",propOr:"getOr",props:"at",symmetricDifference:"xor",symmetricDifferenceBy:"xorBy",symmetricDifferenceWith:"xorWith",takeLast:"takeRight",takeLastWhile:"takeRightWhile",unapply:"rest",unnest:"flatten",useWith:"overArgs",where:"conformsTo",whereEq:"isMatch",zipObj:"zipObject"},o.aryMethod={1:["assignAll","assignInAll","attempt","castArray","ceil","create","curry","curryRight","defaultsAll","defaultsDeepAll","floor","flow","flowRight","fromPairs","invert","iteratee","memoize","method","mergeAll","methodOf","mixin","nthArg","over","overEvery","overSome","rest","reverse","round","runInContext","spread","template","trim","trimEnd","trimStart","uniqueId","words","zipAll"],2:["add","after","ary","assign","assignAllWith","assignIn","assignInAllWith","at","before","bind","bindAll","bindKey","chunk","cloneDeepWith","cloneWith","concat","conformsTo","countBy","curryN","curryRightN","debounce","defaults","defaultsDeep","defaultTo","delay","difference","divide","drop","dropRight","dropRightWhile","dropWhile","endsWith","eq","every","filter","find","findIndex","findKey","findLast","findLastIndex","findLastKey","flatMap","flatMapDeep","flattenDepth","forEach","forEachRight","forIn","forInRight","forOwn","forOwnRight","get","groupBy","gt","gte","has","hasIn","includes","indexOf","intersection","invertBy","invoke","invokeMap","isEqual","isMatch","join","keyBy","lastIndexOf","lt","lte","map","mapKeys","mapValues","matchesProperty","maxBy","meanBy","merge","mergeAllWith","minBy","multiply","nth","omit","omitBy","overArgs","pad","padEnd","padStart","parseInt","partial","partialRight","partition","pick","pickBy","propertyOf","pull","pullAll","pullAt","random","range","rangeRight","rearg","reject","remove","repeat","restFrom","result","sampleSize","some","sortBy","sortedIndex","sortedIndexOf","sortedLastIndex","sortedLastIndexOf","sortedUniqBy","split","spreadFrom","startsWith","subtract","sumBy","take","takeRight","takeRightWhile","takeWhile","tap","throttle","thru","times","trimChars","trimCharsEnd","trimCharsStart","truncate","union","uniqBy","uniqWith","unset","unzipWith","without","wrap","xor","zip","zipObject","zipObjectDeep"],3:["assignInWith","assignWith","clamp","differenceBy","differenceWith","findFrom","findIndexFrom","findLastFrom","findLastIndexFrom","getOr","includesFrom","indexOfFrom","inRange","intersectionBy","intersectionWith","invokeArgs","invokeArgsMap","isEqualWith","isMatchWith","flatMapDepth","lastIndexOfFrom","mergeWith","orderBy","padChars","padCharsEnd","padCharsStart","pullAllBy","pullAllWith","rangeStep","rangeStepRight","reduce","reduceRight","replace","set","slice","sortedIndexBy","sortedLastIndexBy","transform","unionBy","unionWith","update","xorBy","xorWith","zipWith"],4:["fill","setWith","updateWith"]},o.aryRearg={2:[1,0],3:[2,0,1],4:[3,2,0,1]},o.iterateeAry={dropRightWhile:1,dropWhile:1,every:1,filter:1,find:1,findFrom:1,findIndex:1,findIndexFrom:1,findKey:1,findLast:1,findLastFrom:1,findLastIndex:1,findLastIndexFrom:1,findLastKey:1,flatMap:1,flatMapDeep:1,flatMapDepth:1,forEach:1,forEachRight:1,forIn:1,forInRight:1,forOwn:1,forOwnRight:1,map:1,mapKeys:1,mapValues:1,partition:1,reduce:2,reduceRight:2,reject:1,remove:1,some:1,takeRightWhile:1,takeWhile:1,times:1,transform:2},o.iterateeRearg={mapKeys:[1],reduceRight:[1,0]},o.methodRearg={assignInAllWith:[1,0],assignInWith:[1,2,0],assignAllWith:[1,0],assignWith:[1,2,0],differenceBy:[1,2,0],differenceWith:[1,2,0],getOr:[2,1,0],intersectionBy:[1,2,0],intersectionWith:[1,2,0],isEqualWith:[1,2,0],isMatchWith:[2,1,0],mergeAllWith:[1,0],mergeWith:[1,2,0],padChars:[2,1,0],padCharsEnd:[2,1,0],padCharsStart:[2,1,0],pullAllBy:[2,1,0],pullAllWith:[2,1,0],rangeStep:[1,2,0],rangeStepRight:[1,2,0],setWith:[3,1,2,0],sortedIndexBy:[2,1,0],sortedLastIndexBy:[2,1,0],unionBy:[1,2,0],unionWith:[1,2,0],updateWith:[3,1,2,0],xorBy:[1,2,0],xorWith:[1,2,0],zipWith:[1,2,0]},o.methodSpread={assignAll:{start:0},assignAllWith:{start:0},assignInAll:{start:0},assignInAllWith:{start:0},defaultsAll:{start:0},defaultsDeepAll:{start:0},invokeArgs:{start:2},invokeArgsMap:{start:2},mergeAll:{start:0},mergeAllWith:{start:0},partial:{start:1},partialRight:{start:1},without:{start:1},zipAll:{start:0}},o.mutate={array:{fill:!0,pull:!0,pullAll:!0,pullAllBy:!0,pullAllWith:!0,pullAt:!0,remove:!0,reverse:!0},object:{assign:!0,assignAll:!0,assignAllWith:!0,assignIn:!0,assignInAll:!0,assignInAllWith:!0,assignInWith:!0,assignWith:!0,defaults:!0,defaultsAll:!0,defaultsDeep:!0,defaultsDeepAll:!0,merge:!0,mergeAll:!0,mergeAllWith:!0,mergeWith:!0},set:{set:!0,setWith:!0,unset:!0,update:!0,updateWith:!0}},o.realToAlias=function(){var s=Object.prototype.hasOwnProperty,i=o.aliasToReal,u={};for(var _ in i){var w=i[_];s.call(u,w)?u[w].push(_):u[w]=[_]}return u}(),o.remap={assignAll:"assign",assignAllWith:"assignWith",assignInAll:"assignIn",assignInAllWith:"assignInWith",curryN:"curry",curryRightN:"curryRight",defaultsAll:"defaults",defaultsDeepAll:"defaultsDeep",findFrom:"find",findIndexFrom:"findIndex",findLastFrom:"findLast",findLastIndexFrom:"findLastIndex",getOr:"get",includesFrom:"includes",indexOfFrom:"indexOf",invokeArgs:"invoke",invokeArgsMap:"invokeMap",lastIndexOfFrom:"lastIndexOf",mergeAll:"merge",mergeAllWith:"mergeWith",padChars:"pad",padCharsEnd:"padEnd",padCharsStart:"padStart",propertyOf:"get",rangeStep:"range",rangeStepRight:"rangeRight",restFrom:"rest",spreadFrom:"spread",trimChars:"trim",trimCharsEnd:"trimEnd",trimCharsStart:"trimStart",zipAll:"zip"},o.skipFixed={castArray:!0,flow:!0,flowRight:!0,iteratee:!0,mixin:!0,rearg:!0,runInContext:!0},o.skipRearg={add:!0,assign:!0,assignIn:!0,bind:!0,bindKey:!0,concat:!0,difference:!0,divide:!0,eq:!0,gt:!0,gte:!0,isEqual:!0,lt:!0,lte:!0,matchesProperty:!0,merge:!0,multiply:!0,overArgs:!0,partial:!0,partialRight:!0,propertyOf:!0,random:!0,range:!0,rangeRight:!0,subtract:!0,zip:!0,zipObject:!0,zipObjectDeep:!0}},47934:(s,o,i)=>{s.exports={ary:i(64626),assign:i(74733),clone:i(32629),curry:i(49747),forEach:i(83729),isArray:i(56449),isError:i(23546),isFunction:i(1882),isWeakMap:i(47886),iteratee:i(33855),keys:i(88984),rearg:i(84195),toInteger:i(61489),toPath:i(42072)}},56367:(s,o,i)=>{s.exports=i(77731)},79920:(s,o,i)=>{var u=i(73424),_=i(47934);s.exports=function convert(s,o,i){return u(_,s,o,i)}},2874:s=>{s.exports={}},77731:(s,o,i)=>{var u=i(79920)("set",i(63560));u.placeholder=i(2874),s.exports=u},58156:(s,o,i)=>{var u=i(47422);s.exports=function get(s,o,i){var _=null==s?void 0:u(s,o);return void 0===_?i:_}},61448:(s,o,i)=>{var u=i(20426),_=i(49326);s.exports=function has(s,o){return null!=s&&_(s,o,u)}},80631:(s,o,i)=>{var u=i(28077),_=i(49326);s.exports=function hasIn(s,o){return null!=s&&_(s,o,u)}},83488:s=>{s.exports=function identity(s){return s}},72428:(s,o,i)=>{var u=i(27534),_=i(40346),w=Object.prototype,x=w.hasOwnProperty,C=w.propertyIsEnumerable,j=u(function(){return arguments}())?u:function(s){return _(s)&&x.call(s,"callee")&&!C.call(s,"callee")};s.exports=j},56449:s=>{var o=Array.isArray;s.exports=o},64894:(s,o,i)=>{var u=i(1882),_=i(30294);s.exports=function isArrayLike(s){return null!=s&&_(s.length)&&!u(s)}},83693:(s,o,i)=>{var u=i(64894),_=i(40346);s.exports=function isArrayLikeObject(s){return _(s)&&u(s)}},53812:(s,o,i)=>{var u=i(72552),_=i(40346);s.exports=function isBoolean(s){return!0===s||!1===s||_(s)&&"[object Boolean]"==u(s)}},3656:(s,o,i)=>{s=i.nmd(s);var u=i(9325),_=i(89935),w=o&&!o.nodeType&&o,x=w&&s&&!s.nodeType&&s,C=x&&x.exports===w?u.Buffer:void 0,j=(C?C.isBuffer:void 0)||_;s.exports=j},62193:(s,o,i)=>{var u=i(88984),_=i(5861),w=i(72428),x=i(56449),C=i(64894),j=i(3656),L=i(55527),B=i(37167),$=Object.prototype.hasOwnProperty;s.exports=function isEmpty(s){if(null==s)return!0;if(C(s)&&(x(s)||"string"==typeof s||"function"==typeof s.splice||j(s)||B(s)||w(s)))return!s.length;var o=_(s);if("[object Map]"==o||"[object Set]"==o)return!s.size;if(L(s))return!u(s).length;for(var i in s)if($.call(s,i))return!1;return!0}},2404:(s,o,i)=>{var u=i(60270);s.exports=function isEqual(s,o){return u(s,o)}},23546:(s,o,i)=>{var u=i(72552),_=i(40346),w=i(11331);s.exports=function isError(s){if(!_(s))return!1;var o=u(s);return"[object Error]"==o||"[object DOMException]"==o||"string"==typeof s.message&&"string"==typeof s.name&&!w(s)}},1882:(s,o,i)=>{var u=i(72552),_=i(23805);s.exports=function isFunction(s){if(!_(s))return!1;var o=u(s);return"[object Function]"==o||"[object GeneratorFunction]"==o||"[object AsyncFunction]"==o||"[object Proxy]"==o}},30294:s=>{s.exports=function isLength(s){return"number"==typeof s&&s>-1&&s%1==0&&s<=9007199254740991}},87730:(s,o,i)=>{var u=i(29172),_=i(27301),w=i(86009),x=w&&w.isMap,C=x?_(x):u;s.exports=C},5187:s=>{s.exports=function isNull(s){return null===s}},98023:(s,o,i)=>{var u=i(72552),_=i(40346);s.exports=function isNumber(s){return"number"==typeof s||_(s)&&"[object Number]"==u(s)}},23805:s=>{s.exports=function isObject(s){var o=typeof s;return null!=s&&("object"==o||"function"==o)}},40346:s=>{s.exports=function isObjectLike(s){return null!=s&&"object"==typeof s}},11331:(s,o,i)=>{var u=i(72552),_=i(28879),w=i(40346),x=Function.prototype,C=Object.prototype,j=x.toString,L=C.hasOwnProperty,B=j.call(Object);s.exports=function isPlainObject(s){if(!w(s)||"[object Object]"!=u(s))return!1;var o=_(s);if(null===o)return!0;var i=L.call(o,"constructor")&&o.constructor;return"function"==typeof i&&i instanceof i&&j.call(i)==B}},38440:(s,o,i)=>{var u=i(16038),_=i(27301),w=i(86009),x=w&&w.isSet,C=x?_(x):u;s.exports=C},85015:(s,o,i)=>{var u=i(72552),_=i(56449),w=i(40346);s.exports=function isString(s){return"string"==typeof s||!_(s)&&w(s)&&"[object String]"==u(s)}},44394:(s,o,i)=>{var u=i(72552),_=i(40346);s.exports=function isSymbol(s){return"symbol"==typeof s||_(s)&&"[object Symbol]"==u(s)}},37167:(s,o,i)=>{var u=i(4901),_=i(27301),w=i(86009),x=w&&w.isTypedArray,C=x?_(x):u;s.exports=C},47886:(s,o,i)=>{var u=i(5861),_=i(40346);s.exports=function isWeakMap(s){return _(s)&&"[object WeakMap]"==u(s)}},33855:(s,o,i)=>{var u=i(9999),_=i(15389);s.exports=function iteratee(s){return _("function"==typeof s?s:u(s,1))}},95950:(s,o,i)=>{var u=i(70695),_=i(88984),w=i(64894);s.exports=function keys(s){return w(s)?u(s):_(s)}},37241:(s,o,i)=>{var u=i(70695),_=i(72903),w=i(64894);s.exports=function keysIn(s){return w(s)?u(s,!0):_(s)}},68090:s=>{s.exports=function last(s){var o=null==s?0:s.length;return o?s[o-1]:void 0}},50104:(s,o,i)=>{var u=i(53661);function memoize(s,o){if("function"!=typeof s||null!=o&&"function"!=typeof o)throw new TypeError("Expected a function");var memoized=function(){var i=arguments,u=o?o.apply(this,i):i[0],_=memoized.cache;if(_.has(u))return _.get(u);var w=s.apply(this,i);return memoized.cache=_.set(u,w)||_,w};return memoized.cache=new(memoize.Cache||u),memoized}memoize.Cache=u,s.exports=memoize},55364:(s,o,i)=>{var u=i(85250),_=i(20999)((function(s,o,i){u(s,o,i)}));s.exports=_},6048:s=>{s.exports=function negate(s){if("function"!=typeof s)throw new TypeError("Expected a function");return function(){var o=arguments;switch(o.length){case 0:return!s.call(this);case 1:return!s.call(this,o[0]);case 2:return!s.call(this,o[0],o[1]);case 3:return!s.call(this,o[0],o[1],o[2])}return!s.apply(this,o)}}},63950:s=>{s.exports=function noop(){}},10124:(s,o,i)=>{var u=i(9325);s.exports=function(){return u.Date.now()}},90179:(s,o,i)=>{var u=i(34932),_=i(9999),w=i(19931),x=i(31769),C=i(21791),j=i(53138),L=i(38816),B=i(83349),$=L((function(s,o){var i={};if(null==s)return i;var L=!1;o=u(o,(function(o){return o=x(o,s),L||(L=o.length>1),o})),C(s,B(s),i),L&&(i=_(i,7,j));for(var $=o.length;$--;)w(i,o[$]);return i}));s.exports=$},50583:(s,o,i)=>{var u=i(47237),_=i(17255),w=i(28586),x=i(77797);s.exports=function property(s){return w(s)?u(x(s)):_(s)}},84195:(s,o,i)=>{var u=i(66977),_=i(38816),w=_((function(s,o){return u(s,256,void 0,void 0,void 0,o)}));s.exports=w},40860:(s,o,i)=>{var u=i(40882),_=i(80909),w=i(15389),x=i(85558),C=i(56449);s.exports=function reduce(s,o,i){var j=C(s)?u:x,L=arguments.length<3;return j(s,w(o,4),i,L,_)}},63560:(s,o,i)=>{var u=i(73170);s.exports=function set(s,o,i){return null==s?s:u(s,o,i)}},42426:(s,o,i)=>{var u=i(14248),_=i(15389),w=i(90916),x=i(56449),C=i(36800);s.exports=function some(s,o,i){var j=x(s)?u:w;return i&&C(s,o,i)&&(o=void 0),j(s,_(o,3))}},63345:s=>{s.exports=function stubArray(){return[]}},89935:s=>{s.exports=function stubFalse(){return!1}},17400:(s,o,i)=>{var u=i(99374),_=1/0;s.exports=function toFinite(s){return s?(s=u(s))===_||s===-1/0?17976931348623157e292*(s<0?-1:1):s==s?s:0:0===s?s:0}},61489:(s,o,i)=>{var u=i(17400);s.exports=function toInteger(s){var o=u(s),i=o%1;return o==o?i?o-i:o:0}},80218:(s,o,i)=>{var u=i(13222);s.exports=function toLower(s){return u(s).toLowerCase()}},99374:(s,o,i)=>{var u=i(54128),_=i(23805),w=i(44394),x=/^[-+]0x[0-9a-f]+$/i,C=/^0b[01]+$/i,j=/^0o[0-7]+$/i,L=parseInt;s.exports=function toNumber(s){if("number"==typeof s)return s;if(w(s))return NaN;if(_(s)){var o="function"==typeof s.valueOf?s.valueOf():s;s=_(o)?o+"":o}if("string"!=typeof s)return 0===s?s:+s;s=u(s);var i=C.test(s);return i||j.test(s)?L(s.slice(2),i?2:8):x.test(s)?NaN:+s}},42072:(s,o,i)=>{var u=i(34932),_=i(23007),w=i(56449),x=i(44394),C=i(61802),j=i(77797),L=i(13222);s.exports=function toPath(s){return w(s)?u(s,j):x(s)?[s]:_(C(L(s)))}},69884:(s,o,i)=>{var u=i(21791),_=i(37241);s.exports=function toPlainObject(s){return u(s,_(s))}},13222:(s,o,i)=>{var u=i(77556);s.exports=function toString(s){return null==s?"":u(s)}},55808:(s,o,i)=>{var u=i(12507)("toUpperCase");s.exports=u},66645:(s,o,i)=>{var u=i(1733),_=i(45434),w=i(13222),x=i(22225);s.exports=function words(s,o,i){return s=w(s),void 0===(o=i?void 0:o)?_(s)?x(s):u(s):s.match(o)||[]}},53758:(s,o,i)=>{var u=i(30980),_=i(56017),w=i(94033),x=i(56449),C=i(40346),j=i(80257),L=Object.prototype.hasOwnProperty;function lodash(s){if(C(s)&&!x(s)&&!(s instanceof u)){if(s instanceof _)return s;if(L.call(s,"__wrapped__"))return j(s)}return new _(s)}lodash.prototype=w.prototype,lodash.prototype.constructor=lodash,s.exports=lodash},47248:(s,o,i)=>{var u=i(16547),_=i(51234);s.exports=function zipObject(s,o){return _(s||[],o||[],u)}},43768:(s,o,i)=>{"use strict";var u=i(45981),_=i(85587);o.highlight=highlight,o.highlightAuto=function highlightAuto(s,o){var i,x,C,j,L=o||{},B=L.subset||u.listLanguages(),$=L.prefix,V=B.length,U=-1;null==$&&($=w);if("string"!=typeof s)throw _("Expected `string` for value, got `%s`",s);x={relevance:0,language:null,value:[]},i={relevance:0,language:null,value:[]};for(;++Ux.relevance&&(x=C),C.relevance>i.relevance&&(x=i,i=C));x.language&&(i.secondBest=x);return i},o.registerLanguage=function registerLanguage(s,o){u.registerLanguage(s,o)},o.listLanguages=function listLanguages(){return u.listLanguages()},o.registerAlias=function registerAlias(s,o){var i,_=s;o&&((_={})[s]=o);for(i in _)u.registerAliases(_[i],{languageName:i})},Emitter.prototype.addText=function text(s){var o,i,u=this.stack;if(""===s)return;o=u[u.length-1],(i=o.children[o.children.length-1])&&"text"===i.type?i.value+=s:o.children.push({type:"text",value:s})},Emitter.prototype.addKeyword=function addKeyword(s,o){this.openNode(o),this.addText(s),this.closeNode()},Emitter.prototype.addSublanguage=function addSublanguage(s,o){var i=this.stack,u=i[i.length-1],_=s.rootNode.children,w=o?{type:"element",tagName:"span",properties:{className:[o]},children:_}:_;u.children=u.children.concat(w)},Emitter.prototype.openNode=function open(s){var o=this.stack,i=this.options.classPrefix+s,u=o[o.length-1],_={type:"element",tagName:"span",properties:{className:[i]},children:[]};u.children.push(_),o.push(_)},Emitter.prototype.closeNode=function close(){this.stack.pop()},Emitter.prototype.closeAllNodes=noop,Emitter.prototype.finalize=noop,Emitter.prototype.toHTML=function toHtmlNoop(){return""};var w="hljs-";function highlight(s,o,i){var x,C=u.configure({}),j=(i||{}).prefix;if("string"!=typeof s)throw _("Expected `string` for name, got `%s`",s);if(!u.getLanguage(s))throw _("Unknown language: `%s` is not registered",s);if("string"!=typeof o)throw _("Expected `string` for value, got `%s`",o);if(null==j&&(j=w),u.configure({__emitter:Emitter,classPrefix:j}),x=u.highlight(o,{language:s,ignoreIllegals:!0}),u.configure(C||{}),x.errorRaised)throw x.errorRaised;return{relevance:x.relevance,language:x.language,value:x.emitter.rootNode.children}}function Emitter(s){this.options=s,this.rootNode={children:[]},this.stack=[this.rootNode]}function noop(){}},92340:(s,o,i)=>{const u=i(6048);function coerceElementMatchingCallback(s){return"string"==typeof s?o=>o.element===s:s.constructor&&s.extend?o=>o instanceof s:s}class ArraySlice{constructor(s){this.elements=s||[]}toValue(){return this.elements.map((s=>s.toValue()))}map(s,o){return this.elements.map(s,o)}flatMap(s,o){return this.map(s,o).reduce(((s,o)=>s.concat(o)),[])}compactMap(s,o){const i=[];return this.forEach((u=>{const _=s.bind(o)(u);_&&i.push(_)})),i}filter(s,o){return s=coerceElementMatchingCallback(s),new ArraySlice(this.elements.filter(s,o))}reject(s,o){return s=coerceElementMatchingCallback(s),new ArraySlice(this.elements.filter(u(s),o))}find(s,o){return s=coerceElementMatchingCallback(s),this.elements.find(s,o)}forEach(s,o){this.elements.forEach(s,o)}reduce(s,o){return this.elements.reduce(s,o)}includes(s){return this.elements.some((o=>o.equals(s)))}shift(){return this.elements.shift()}unshift(s){this.elements.unshift(this.refract(s))}push(s){return this.elements.push(this.refract(s)),this}add(s){this.push(s)}get(s){return this.elements[s]}getValue(s){const o=this.elements[s];if(o)return o.toValue()}get length(){return this.elements.length}get isEmpty(){return 0===this.elements.length}get first(){return this.elements[0]}}"undefined"!=typeof Symbol&&(ArraySlice.prototype[Symbol.iterator]=function symbol(){return this.elements[Symbol.iterator]()}),s.exports=ArraySlice},55973:s=>{class KeyValuePair{constructor(s,o){this.key=s,this.value=o}clone(){const s=new KeyValuePair;return this.key&&(s.key=this.key.clone()),this.value&&(s.value=this.value.clone()),s}}s.exports=KeyValuePair},3110:(s,o,i)=>{const u=i(5187),_=i(85015),w=i(98023),x=i(53812),C=i(23805),j=i(85105),L=i(86804);class Namespace{constructor(s){this.elementMap={},this.elementDetection=[],this.Element=L.Element,this.KeyValuePair=L.KeyValuePair,s&&s.noDefault||this.useDefault(),this._attributeElementKeys=[],this._attributeElementArrayKeys=[]}use(s){return s.namespace&&s.namespace({base:this}),s.load&&s.load({base:this}),this}useDefault(){return this.register("null",L.NullElement).register("string",L.StringElement).register("number",L.NumberElement).register("boolean",L.BooleanElement).register("array",L.ArrayElement).register("object",L.ObjectElement).register("member",L.MemberElement).register("ref",L.RefElement).register("link",L.LinkElement),this.detect(u,L.NullElement,!1).detect(_,L.StringElement,!1).detect(w,L.NumberElement,!1).detect(x,L.BooleanElement,!1).detect(Array.isArray,L.ArrayElement,!1).detect(C,L.ObjectElement,!1),this}register(s,o){return this._elements=void 0,this.elementMap[s]=o,this}unregister(s){return this._elements=void 0,delete this.elementMap[s],this}detect(s,o,i){return void 0===i||i?this.elementDetection.unshift([s,o]):this.elementDetection.push([s,o]),this}toElement(s){if(s instanceof this.Element)return s;let o;for(let i=0;i{const o=s[0].toUpperCase()+s.substr(1);this._elements[o]=this.elementMap[s]}))),this._elements}get serialiser(){return new j(this)}}j.prototype.Namespace=Namespace,s.exports=Namespace},10866:(s,o,i)=>{const u=i(6048),_=i(92340);class ObjectSlice extends _{map(s,o){return this.elements.map((i=>s.bind(o)(i.value,i.key,i)))}filter(s,o){return new ObjectSlice(this.elements.filter((i=>s.bind(o)(i.value,i.key,i))))}reject(s,o){return this.filter(u(s.bind(o)))}forEach(s,o){return this.elements.forEach(((i,u)=>{s.bind(o)(i.value,i.key,i,u)}))}keys(){return this.map(((s,o)=>o.toValue()))}values(){return this.map((s=>s.toValue()))}}s.exports=ObjectSlice},86804:(s,o,i)=>{const u=i(10316),_=i(41067),w=i(71167),x=i(40239),C=i(12242),j=i(6233),L=i(87726),B=i(61045),$=i(86303),V=i(14540),U=i(92340),z=i(10866),Y=i(55973);function refract(s){if(s instanceof u)return s;if("string"==typeof s)return new w(s);if("number"==typeof s)return new x(s);if("boolean"==typeof s)return new C(s);if(null===s)return new _;if(Array.isArray(s))return new j(s.map(refract));if("object"==typeof s){return new B(s)}return s}u.prototype.ObjectElement=B,u.prototype.RefElement=V,u.prototype.MemberElement=L,u.prototype.refract=refract,U.prototype.refract=refract,s.exports={Element:u,NullElement:_,StringElement:w,NumberElement:x,BooleanElement:C,ArrayElement:j,MemberElement:L,ObjectElement:B,LinkElement:$,RefElement:V,refract,ArraySlice:U,ObjectSlice:z,KeyValuePair:Y}},86303:(s,o,i)=>{const u=i(10316);s.exports=class LinkElement extends u{constructor(s,o,i){super(s||[],o,i),this.element="link"}get relation(){return this.attributes.get("relation")}set relation(s){this.attributes.set("relation",s)}get href(){return this.attributes.get("href")}set href(s){this.attributes.set("href",s)}}},14540:(s,o,i)=>{const u=i(10316);s.exports=class RefElement extends u{constructor(s,o,i){super(s||[],o,i),this.element="ref",this.path||(this.path="element")}get path(){return this.attributes.get("path")}set path(s){this.attributes.set("path",s)}}},34035:(s,o,i)=>{const u=i(3110),_=i(86804);o.g$=u,o.KeyValuePair=i(55973),o.G6=_.ArraySlice,o.ot=_.ObjectSlice,o.Hg=_.Element,o.Om=_.StringElement,o.kT=_.NumberElement,o.bd=_.BooleanElement,o.Os=_.NullElement,o.wE=_.ArrayElement,o.Sh=_.ObjectElement,o.Pr=_.MemberElement,o.sI=_.RefElement,o.Ft=_.LinkElement,o.e=_.refract,i(85105),i(75147)},6233:(s,o,i)=>{const u=i(6048),_=i(10316),w=i(92340);class ArrayElement extends _{constructor(s,o,i){super(s||[],o,i),this.element="array"}primitive(){return"array"}get(s){return this.content[s]}getValue(s){const o=this.get(s);if(o)return o.toValue()}getIndex(s){return this.content[s]}set(s,o){return this.content[s]=this.refract(o),this}remove(s){const o=this.content.splice(s,1);return o.length?o[0]:null}map(s,o){return this.content.map(s,o)}flatMap(s,o){return this.map(s,o).reduce(((s,o)=>s.concat(o)),[])}compactMap(s,o){const i=[];return this.forEach((u=>{const _=s.bind(o)(u);_&&i.push(_)})),i}filter(s,o){return new w(this.content.filter(s,o))}reject(s,o){return this.filter(u(s),o)}reduce(s,o){let i,u;void 0!==o?(i=0,u=this.refract(o)):(i=1,u="object"===this.primitive()?this.first.value:this.first);for(let o=i;o{s.bind(o)(i,this.refract(u))}))}shift(){return this.content.shift()}unshift(s){this.content.unshift(this.refract(s))}push(s){return this.content.push(this.refract(s)),this}add(s){this.push(s)}findElements(s,o){const i=o||{},u=!!i.recursive,_=void 0===i.results?[]:i.results;return this.forEach(((o,i,w)=>{u&&void 0!==o.findElements&&o.findElements(s,{results:_,recursive:u}),s(o,i,w)&&_.push(o)})),_}find(s){return new w(this.findElements(s,{recursive:!0}))}findByElement(s){return this.find((o=>o.element===s))}findByClass(s){return this.find((o=>o.classes.includes(s)))}getById(s){return this.find((o=>o.id.toValue()===s)).first}includes(s){return this.content.some((o=>o.equals(s)))}contains(s){return this.includes(s)}empty(){return new this.constructor([])}"fantasy-land/empty"(){return this.empty()}concat(s){return new this.constructor(this.content.concat(s.content))}"fantasy-land/concat"(s){return this.concat(s)}"fantasy-land/map"(s){return new this.constructor(this.map(s))}"fantasy-land/chain"(s){return this.map((o=>s(o)),this).reduce(((s,o)=>s.concat(o)),this.empty())}"fantasy-land/filter"(s){return new this.constructor(this.content.filter(s))}"fantasy-land/reduce"(s,o){return this.content.reduce(s,o)}get length(){return this.content.length}get isEmpty(){return 0===this.content.length}get first(){return this.getIndex(0)}get second(){return this.getIndex(1)}get last(){return this.getIndex(this.length-1)}}ArrayElement.empty=function empty(){return new this},ArrayElement["fantasy-land/empty"]=ArrayElement.empty,"undefined"!=typeof Symbol&&(ArrayElement.prototype[Symbol.iterator]=function symbol(){return this.content[Symbol.iterator]()}),s.exports=ArrayElement},12242:(s,o,i)=>{const u=i(10316);s.exports=class BooleanElement extends u{constructor(s,o,i){super(s,o,i),this.element="boolean"}primitive(){return"boolean"}}},10316:(s,o,i)=>{const u=i(2404),_=i(55973),w=i(92340);class Element{constructor(s,o,i){o&&(this.meta=o),i&&(this.attributes=i),this.content=s}freeze(){Object.isFrozen(this)||(this._meta&&(this.meta.parent=this,this.meta.freeze()),this._attributes&&(this.attributes.parent=this,this.attributes.freeze()),this.children.forEach((s=>{s.parent=this,s.freeze()}),this),this.content&&Array.isArray(this.content)&&Object.freeze(this.content),Object.freeze(this))}primitive(){}clone(){const s=new this.constructor;return s.element=this.element,this.meta.length&&(s._meta=this.meta.clone()),this.attributes.length&&(s._attributes=this.attributes.clone()),this.content?this.content.clone?s.content=this.content.clone():Array.isArray(this.content)?s.content=this.content.map((s=>s.clone())):s.content=this.content:s.content=this.content,s}toValue(){return this.content instanceof Element?this.content.toValue():this.content instanceof _?{key:this.content.key.toValue(),value:this.content.value?this.content.value.toValue():void 0}:this.content&&this.content.map?this.content.map((s=>s.toValue()),this):this.content}toRef(s){if(""===this.id.toValue())throw Error("Cannot create reference to an element that does not contain an ID");const o=new this.RefElement(this.id.toValue());return s&&(o.path=s),o}findRecursive(...s){if(arguments.length>1&&!this.isFrozen)throw new Error("Cannot find recursive with multiple element names without first freezing the element. Call `element.freeze()`");const o=s.pop();let i=new w;const append=(s,o)=>(s.push(o),s),checkElement=(s,i)=>{i.element===o&&s.push(i);const u=i.findRecursive(o);return u&&u.reduce(append,s),i.content instanceof _&&(i.content.key&&checkElement(s,i.content.key),i.content.value&&checkElement(s,i.content.value)),s};return this.content&&(this.content.element&&checkElement(i,this.content),Array.isArray(this.content)&&this.content.reduce(checkElement,i)),s.isEmpty||(i=i.filter((o=>{let i=o.parents.map((s=>s.element));for(const o in s){const u=s[o],_=i.indexOf(u);if(-1===_)return!1;i=i.splice(0,_)}return!0}))),i}set(s){return this.content=s,this}equals(s){return u(this.toValue(),s)}getMetaProperty(s,o){if(!this.meta.hasKey(s)){if(this.isFrozen){const s=this.refract(o);return s.freeze(),s}this.meta.set(s,o)}return this.meta.get(s)}setMetaProperty(s,o){this.meta.set(s,o)}get element(){return this._storedElement||"element"}set element(s){this._storedElement=s}get content(){return this._content}set content(s){if(s instanceof Element)this._content=s;else if(s instanceof w)this.content=s.elements;else if("string"==typeof s||"number"==typeof s||"boolean"==typeof s||"null"===s||null==s)this._content=s;else if(s instanceof _)this._content=s;else if(Array.isArray(s))this._content=s.map(this.refract);else{if("object"!=typeof s)throw new Error("Cannot set content to given value");this._content=Object.keys(s).map((o=>new this.MemberElement(o,s[o])))}}get meta(){if(!this._meta){if(this.isFrozen){const s=new this.ObjectElement;return s.freeze(),s}this._meta=new this.ObjectElement}return this._meta}set meta(s){s instanceof this.ObjectElement?this._meta=s:this.meta.set(s||{})}get attributes(){if(!this._attributes){if(this.isFrozen){const s=new this.ObjectElement;return s.freeze(),s}this._attributes=new this.ObjectElement}return this._attributes}set attributes(s){s instanceof this.ObjectElement?this._attributes=s:this.attributes.set(s||{})}get id(){return this.getMetaProperty("id","")}set id(s){this.setMetaProperty("id",s)}get classes(){return this.getMetaProperty("classes",[])}set classes(s){this.setMetaProperty("classes",s)}get title(){return this.getMetaProperty("title","")}set title(s){this.setMetaProperty("title",s)}get description(){return this.getMetaProperty("description","")}set description(s){this.setMetaProperty("description",s)}get links(){return this.getMetaProperty("links",[])}set links(s){this.setMetaProperty("links",s)}get isFrozen(){return Object.isFrozen(this)}get parents(){let{parent:s}=this;const o=new w;for(;s;)o.push(s),s=s.parent;return o}get children(){if(Array.isArray(this.content))return new w(this.content);if(this.content instanceof _){const s=new w([this.content.key]);return this.content.value&&s.push(this.content.value),s}return this.content instanceof Element?new w([this.content]):new w}get recursiveChildren(){const s=new w;return this.children.forEach((o=>{s.push(o),o.recursiveChildren.forEach((o=>{s.push(o)}))})),s}}s.exports=Element},87726:(s,o,i)=>{const u=i(55973),_=i(10316);s.exports=class MemberElement extends _{constructor(s,o,i,_){super(new u,i,_),this.element="member",this.key=s,this.value=o}get key(){return this.content.key}set key(s){this.content.key=this.refract(s)}get value(){return this.content.value}set value(s){this.content.value=this.refract(s)}}},41067:(s,o,i)=>{const u=i(10316);s.exports=class NullElement extends u{constructor(s,o,i){super(s||null,o,i),this.element="null"}primitive(){return"null"}set(){return new Error("Cannot set the value of null")}}},40239:(s,o,i)=>{const u=i(10316);s.exports=class NumberElement extends u{constructor(s,o,i){super(s,o,i),this.element="number"}primitive(){return"number"}}},61045:(s,o,i)=>{const u=i(6048),_=i(23805),w=i(6233),x=i(87726),C=i(10866);s.exports=class ObjectElement extends w{constructor(s,o,i){super(s||[],o,i),this.element="object"}primitive(){return"object"}toValue(){return this.content.reduce(((s,o)=>(s[o.key.toValue()]=o.value?o.value.toValue():void 0,s)),{})}get(s){const o=this.getMember(s);if(o)return o.value}getMember(s){if(void 0!==s)return this.content.find((o=>o.key.toValue()===s))}remove(s){let o=null;return this.content=this.content.filter((i=>i.key.toValue()!==s||(o=i,!1))),o}getKey(s){const o=this.getMember(s);if(o)return o.key}set(s,o){if(_(s))return Object.keys(s).forEach((o=>{this.set(o,s[o])})),this;const i=s,u=this.getMember(i);return u?u.value=o:this.content.push(new x(i,o)),this}keys(){return this.content.map((s=>s.key.toValue()))}values(){return this.content.map((s=>s.value.toValue()))}hasKey(s){return this.content.some((o=>o.key.equals(s)))}items(){return this.content.map((s=>[s.key.toValue(),s.value.toValue()]))}map(s,o){return this.content.map((i=>s.bind(o)(i.value,i.key,i)))}compactMap(s,o){const i=[];return this.forEach(((u,_,w)=>{const x=s.bind(o)(u,_,w);x&&i.push(x)})),i}filter(s,o){return new C(this.content).filter(s,o)}reject(s,o){return this.filter(u(s),o)}forEach(s,o){return this.content.forEach((i=>s.bind(o)(i.value,i.key,i)))}}},71167:(s,o,i)=>{const u=i(10316);s.exports=class StringElement extends u{constructor(s,o,i){super(s,o,i),this.element="string"}primitive(){return"string"}get length(){return this.content.length}}},75147:(s,o,i)=>{const u=i(85105);s.exports=class JSON06Serialiser extends u{serialise(s){if(!(s instanceof this.namespace.elements.Element))throw new TypeError(`Given element \`${s}\` is not an Element instance`);let o;s._attributes&&s.attributes.get("variable")&&(o=s.attributes.get("variable"));const i={element:s.element};s._meta&&s._meta.length>0&&(i.meta=this.serialiseObject(s.meta));const u="enum"===s.element||-1!==s.attributes.keys().indexOf("enumerations");if(u){const o=this.enumSerialiseAttributes(s);o&&(i.attributes=o)}else if(s._attributes&&s._attributes.length>0){let{attributes:u}=s;u.get("metadata")&&(u=u.clone(),u.set("meta",u.get("metadata")),u.remove("metadata")),"member"===s.element&&o&&(u=u.clone(),u.remove("variable")),u.length>0&&(i.attributes=this.serialiseObject(u))}if(u)i.content=this.enumSerialiseContent(s,i);else if(this[`${s.element}SerialiseContent`])i.content=this[`${s.element}SerialiseContent`](s,i);else if(void 0!==s.content){let u;o&&s.content.key?(u=s.content.clone(),u.key.attributes.set("variable",o),u=this.serialiseContent(u)):u=this.serialiseContent(s.content),this.shouldSerialiseContent(s,u)&&(i.content=u)}else this.shouldSerialiseContent(s,s.content)&&s instanceof this.namespace.elements.Array&&(i.content=[]);return i}shouldSerialiseContent(s,o){return"parseResult"===s.element||"httpRequest"===s.element||"httpResponse"===s.element||"category"===s.element||"link"===s.element||void 0!==o&&(!Array.isArray(o)||0!==o.length)}refSerialiseContent(s,o){return delete o.attributes,{href:s.toValue(),path:s.path.toValue()}}sourceMapSerialiseContent(s){return s.toValue()}dataStructureSerialiseContent(s){return[this.serialiseContent(s.content)]}enumSerialiseAttributes(s){const o=s.attributes.clone(),i=o.remove("enumerations")||new this.namespace.elements.Array([]),u=o.get("default");let _=o.get("samples")||new this.namespace.elements.Array([]);if(u&&u.content&&(u.content.attributes&&u.content.attributes.remove("typeAttributes"),o.set("default",new this.namespace.elements.Array([u.content]))),_.forEach((s=>{s.content&&s.content.element&&s.content.attributes.remove("typeAttributes")})),s.content&&0!==i.length&&_.unshift(s.content),_=_.map((s=>s instanceof this.namespace.elements.Array?[s]:new this.namespace.elements.Array([s.content]))),_.length&&o.set("samples",_),o.length>0)return this.serialiseObject(o)}enumSerialiseContent(s){if(s._attributes){const o=s.attributes.get("enumerations");if(o&&o.length>0)return o.content.map((s=>{const o=s.clone();return o.attributes.remove("typeAttributes"),this.serialise(o)}))}if(s.content){const o=s.content.clone();return o.attributes.remove("typeAttributes"),[this.serialise(o)]}return[]}deserialise(s){if("string"==typeof s)return new this.namespace.elements.String(s);if("number"==typeof s)return new this.namespace.elements.Number(s);if("boolean"==typeof s)return new this.namespace.elements.Boolean(s);if(null===s)return new this.namespace.elements.Null;if(Array.isArray(s))return new this.namespace.elements.Array(s.map(this.deserialise,this));const o=this.namespace.getElementClass(s.element),i=new o;i.element!==s.element&&(i.element=s.element),s.meta&&this.deserialiseObject(s.meta,i.meta),s.attributes&&this.deserialiseObject(s.attributes,i.attributes);const u=this.deserialiseContent(s.content);if(void 0===u&&null!==i.content||(i.content=u),"enum"===i.element){i.content&&i.attributes.set("enumerations",i.content);let s=i.attributes.get("samples");if(i.attributes.remove("samples"),s){const u=s;s=new this.namespace.elements.Array,u.forEach((u=>{u.forEach((u=>{const _=new o(u);_.element=i.element,s.push(_)}))}));const _=s.shift();i.content=_?_.content:void 0,i.attributes.set("samples",s)}else i.content=void 0;let u=i.attributes.get("default");if(u&&u.length>0){u=u.get(0);const s=new o(u);s.element=i.element,i.attributes.set("default",s)}}else if("dataStructure"===i.element&&Array.isArray(i.content))[i.content]=i.content;else if("category"===i.element){const s=i.attributes.get("meta");s&&(i.attributes.set("metadata",s),i.attributes.remove("meta"))}else"member"===i.element&&i.key&&i.key._attributes&&i.key._attributes.getValue("variable")&&(i.attributes.set("variable",i.key.attributes.get("variable")),i.key.attributes.remove("variable"));return i}serialiseContent(s){if(s instanceof this.namespace.elements.Element)return this.serialise(s);if(s instanceof this.namespace.KeyValuePair){const o={key:this.serialise(s.key)};return s.value&&(o.value=this.serialise(s.value)),o}return s&&s.map?s.map(this.serialise,this):s}deserialiseContent(s){if(s){if(s.element)return this.deserialise(s);if(s.key){const o=new this.namespace.KeyValuePair(this.deserialise(s.key));return s.value&&(o.value=this.deserialise(s.value)),o}if(s.map)return s.map(this.deserialise,this)}return s}shouldRefract(s){return!!(s._attributes&&s.attributes.keys().length||s._meta&&s.meta.keys().length)||"enum"!==s.element&&(s.element!==s.primitive()||"member"===s.element)}convertKeyToRefract(s,o){return this.shouldRefract(o)?this.serialise(o):"enum"===o.element?this.serialiseEnum(o):"array"===o.element?o.map((o=>this.shouldRefract(o)||"default"===s?this.serialise(o):"array"===o.element||"object"===o.element||"enum"===o.element?o.children.map((s=>this.serialise(s))):o.toValue())):"object"===o.element?(o.content||[]).map(this.serialise,this):o.toValue()}serialiseEnum(s){return s.children.map((s=>this.serialise(s)))}serialiseObject(s){const o={};return s.forEach(((s,i)=>{if(s){const u=i.toValue();o[u]=this.convertKeyToRefract(u,s)}})),o}deserialiseObject(s,o){Object.keys(s).forEach((i=>{o.set(i,this.deserialise(s[i]))}))}}},85105:s=>{s.exports=class JSONSerialiser{constructor(s){this.namespace=s||new this.Namespace}serialise(s){if(!(s instanceof this.namespace.elements.Element))throw new TypeError(`Given element \`${s}\` is not an Element instance`);const o={element:s.element};s._meta&&s._meta.length>0&&(o.meta=this.serialiseObject(s.meta)),s._attributes&&s._attributes.length>0&&(o.attributes=this.serialiseObject(s.attributes));const i=this.serialiseContent(s.content);return void 0!==i&&(o.content=i),o}deserialise(s){if(!s.element)throw new Error("Given value is not an object containing an element name");const o=new(this.namespace.getElementClass(s.element));o.element!==s.element&&(o.element=s.element),s.meta&&this.deserialiseObject(s.meta,o.meta),s.attributes&&this.deserialiseObject(s.attributes,o.attributes);const i=this.deserialiseContent(s.content);return void 0===i&&null!==o.content||(o.content=i),o}serialiseContent(s){if(s instanceof this.namespace.elements.Element)return this.serialise(s);if(s instanceof this.namespace.KeyValuePair){const o={key:this.serialise(s.key)};return s.value&&(o.value=this.serialise(s.value)),o}if(s&&s.map){if(0===s.length)return;return s.map(this.serialise,this)}return s}deserialiseContent(s){if(s){if(s.element)return this.deserialise(s);if(s.key){const o=new this.namespace.KeyValuePair(this.deserialise(s.key));return s.value&&(o.value=this.deserialise(s.value)),o}if(s.map)return s.map(this.deserialise,this)}return s}serialiseObject(s){const o={};if(s.forEach(((s,i)=>{s&&(o[i.toValue()]=this.serialise(s))})),0!==Object.keys(o).length)return o}deserialiseObject(s,o){Object.keys(s).forEach((i=>{o.set(i,this.deserialise(s[i]))}))}}},65606:s=>{var o,i,u=s.exports={};function defaultSetTimout(){throw new Error("setTimeout has not been defined")}function defaultClearTimeout(){throw new Error("clearTimeout has not been defined")}function runTimeout(s){if(o===setTimeout)return setTimeout(s,0);if((o===defaultSetTimout||!o)&&setTimeout)return o=setTimeout,setTimeout(s,0);try{return o(s,0)}catch(i){try{return o.call(null,s,0)}catch(i){return o.call(this,s,0)}}}!function(){try{o="function"==typeof setTimeout?setTimeout:defaultSetTimout}catch(s){o=defaultSetTimout}try{i="function"==typeof clearTimeout?clearTimeout:defaultClearTimeout}catch(s){i=defaultClearTimeout}}();var _,w=[],x=!1,C=-1;function cleanUpNextTick(){x&&_&&(x=!1,_.length?w=_.concat(w):C=-1,w.length&&drainQueue())}function drainQueue(){if(!x){var s=runTimeout(cleanUpNextTick);x=!0;for(var o=w.length;o;){for(_=w,w=[];++C1)for(var i=1;i{"use strict";var u=i(6925);function emptyFunction(){}function emptyFunctionWithReset(){}emptyFunctionWithReset.resetWarningCache=emptyFunction,s.exports=function(){function shim(s,o,i,_,w,x){if(x!==u){var C=new Error("Calling PropTypes validators directly is not supported by the `prop-types` package. Use PropTypes.checkPropTypes() to call them. Read more at http://fb.me/use-check-prop-types");throw C.name="Invariant Violation",C}}function getShim(){return shim}shim.isRequired=shim;var s={array:shim,bigint:shim,bool:shim,func:shim,number:shim,object:shim,string:shim,symbol:shim,any:shim,arrayOf:getShim,element:shim,elementType:shim,instanceOf:getShim,node:shim,objectOf:getShim,oneOf:getShim,oneOfType:getShim,shape:getShim,exact:getShim,checkPropTypes:emptyFunctionWithReset,resetWarningCache:emptyFunction};return s.PropTypes=s,s}},5556:(s,o,i)=>{s.exports=i(2694)()},6925:s=>{"use strict";s.exports="SECRET_DO_NOT_PASS_THIS_OR_YOU_WILL_BE_FIRED"},73992:(s,o)=>{"use strict";var i=Object.prototype.hasOwnProperty;function decode(s){try{return decodeURIComponent(s.replace(/\+/g," "))}catch(s){return null}}function encode(s){try{return encodeURIComponent(s)}catch(s){return null}}o.stringify=function querystringify(s,o){o=o||"";var u,_,w=[];for(_ in"string"!=typeof o&&(o="?"),s)if(i.call(s,_)){if((u=s[_])||null!=u&&!isNaN(u)||(u=""),_=encode(_),u=encode(u),null===_||null===u)continue;w.push(_+"="+u)}return w.length?o+w.join("&"):""},o.parse=function querystring(s){for(var o,i=/([^=?#&]+)=?([^&]*)/g,u={};o=i.exec(s);){var _=decode(o[1]),w=decode(o[2]);null===_||null===w||_ in u||(u[_]=w)}return u}},41859:(s,o,i)=>{const u=i(27096),_=i(78004),w=u.types;s.exports=class RandExp{constructor(s,o){if(this._setDefaults(s),s instanceof RegExp)this.ignoreCase=s.ignoreCase,this.multiline=s.multiline,s=s.source;else{if("string"!=typeof s)throw new Error("Expected a regexp or string");this.ignoreCase=o&&-1!==o.indexOf("i"),this.multiline=o&&-1!==o.indexOf("m")}this.tokens=u(s)}_setDefaults(s){this.max=null!=s.max?s.max:null!=RandExp.prototype.max?RandExp.prototype.max:100,this.defaultRange=s.defaultRange?s.defaultRange:this.defaultRange.clone(),s.randInt&&(this.randInt=s.randInt)}gen(){return this._gen(this.tokens,[])}_gen(s,o){var i,u,_,x,C;switch(s.type){case w.ROOT:case w.GROUP:if(s.followedBy||s.notFollowedBy)return"";for(s.remember&&void 0===s.groupNumber&&(s.groupNumber=o.push(null)-1),u="",x=0,C=(i=s.options?this._randSelect(s.options):s.stack).length;x{"use strict";var u=i(65606),_=65536,w=4294967295;var x=i(92861).Buffer,C=i.g.crypto||i.g.msCrypto;C&&C.getRandomValues?s.exports=function randomBytes(s,o){if(s>w)throw new RangeError("requested too many random bytes");var i=x.allocUnsafe(s);if(s>0)if(s>_)for(var j=0;j{"use strict";function _typeof(s){return _typeof="function"==typeof Symbol&&"symbol"==typeof Symbol.iterator?function(s){return typeof s}:function(s){return s&&"function"==typeof Symbol&&s.constructor===Symbol&&s!==Symbol.prototype?"symbol":typeof s},_typeof(s)}Object.defineProperty(o,"__esModule",{value:!0}),o.CopyToClipboard=void 0;var u=_interopRequireDefault(i(96540)),_=_interopRequireDefault(i(17965)),w=["text","onCopy","options","children"];function _interopRequireDefault(s){return s&&s.__esModule?s:{default:s}}function ownKeys(s,o){var i=Object.keys(s);if(Object.getOwnPropertySymbols){var u=Object.getOwnPropertySymbols(s);o&&(u=u.filter((function(o){return Object.getOwnPropertyDescriptor(s,o).enumerable}))),i.push.apply(i,u)}return i}function _objectSpread(s){for(var o=1;o=0||(_[i]=s[i]);return _}(s,o);if(Object.getOwnPropertySymbols){var w=Object.getOwnPropertySymbols(s);for(u=0;u=0||Object.prototype.propertyIsEnumerable.call(s,i)&&(_[i]=s[i])}return _}function _defineProperties(s,o){for(var i=0;i{"use strict";var u=i(25264).CopyToClipboard;u.CopyToClipboard=u,s.exports=u},81214:(s,o,i)=>{"use strict";function _typeof(s){return _typeof="function"==typeof Symbol&&"symbol"==typeof Symbol.iterator?function(s){return typeof s}:function(s){return s&&"function"==typeof Symbol&&s.constructor===Symbol&&s!==Symbol.prototype?"symbol":typeof s},_typeof(s)}Object.defineProperty(o,"__esModule",{value:!0}),o.DebounceInput=void 0;var u=_interopRequireDefault(i(96540)),_=_interopRequireDefault(i(20181)),w=["element","onChange","value","minLength","debounceTimeout","forceNotifyByEnter","forceNotifyOnBlur","onKeyDown","onBlur","inputRef"];function _interopRequireDefault(s){return s&&s.__esModule?s:{default:s}}function _objectWithoutProperties(s,o){if(null==s)return{};var i,u,_=function _objectWithoutPropertiesLoose(s,o){if(null==s)return{};var i,u,_={},w=Object.keys(s);for(u=0;u=0||(_[i]=s[i]);return _}(s,o);if(Object.getOwnPropertySymbols){var w=Object.getOwnPropertySymbols(s);for(u=0;u=0||Object.prototype.propertyIsEnumerable.call(s,i)&&(_[i]=s[i])}return _}function ownKeys(s,o){var i=Object.keys(s);if(Object.getOwnPropertySymbols){var u=Object.getOwnPropertySymbols(s);o&&(u=u.filter((function(o){return Object.getOwnPropertyDescriptor(s,o).enumerable}))),i.push.apply(i,u)}return i}function _objectSpread(s){for(var o=1;o=u?i.notify(s):o.length>_.length&&i.notify(_objectSpread(_objectSpread({},s),{},{target:_objectSpread(_objectSpread({},s.target),{},{value:""})}))}))})),_defineProperty(_assertThisInitialized(i),"onKeyDown",(function(s){"Enter"===s.key&&i.forceNotify(s);var o=i.props.onKeyDown;o&&(s.persist(),o(s))})),_defineProperty(_assertThisInitialized(i),"onBlur",(function(s){i.forceNotify(s);var o=i.props.onBlur;o&&(s.persist(),o(s))})),_defineProperty(_assertThisInitialized(i),"createNotifier",(function(s){if(s<0)i.notify=function(){return null};else if(0===s)i.notify=i.doNotify;else{var o=(0,_.default)((function(s){i.isDebouncing=!1,i.doNotify(s)}),s);i.notify=function(s){i.isDebouncing=!0,o(s)},i.flush=function(){return o.flush()},i.cancel=function(){i.isDebouncing=!1,o.cancel()}}})),_defineProperty(_assertThisInitialized(i),"doNotify",(function(){i.props.onChange.apply(void 0,arguments)})),_defineProperty(_assertThisInitialized(i),"forceNotify",(function(s){var o=i.props.debounceTimeout;if(i.isDebouncing||!(o>0)){i.cancel&&i.cancel();var u=i.state.value,_=i.props.minLength;u.length>=_?i.doNotify(s):i.doNotify(_objectSpread(_objectSpread({},s),{},{target:_objectSpread(_objectSpread({},s.target),{},{value:u})}))}})),i.isDebouncing=!1,i.state={value:void 0===s.value||null===s.value?"":s.value};var u=i.props.debounceTimeout;return i.createNotifier(u),i}return function _createClass(s,o,i){return o&&_defineProperties(s.prototype,o),i&&_defineProperties(s,i),Object.defineProperty(s,"prototype",{writable:!1}),s}(DebounceInput,[{key:"componentDidUpdate",value:function componentDidUpdate(s){if(!this.isDebouncing){var o=this.props,i=o.value,u=o.debounceTimeout,_=s.debounceTimeout,w=s.value,x=this.state.value;void 0!==i&&w!==i&&x!==i&&this.setState({value:i}),u!==_&&this.createNotifier(u)}}},{key:"componentWillUnmount",value:function componentWillUnmount(){this.flush&&this.flush()}},{key:"render",value:function render(){var s,o,i=this.props,_=i.element,x=(i.onChange,i.value,i.minLength,i.debounceTimeout,i.forceNotifyByEnter),C=i.forceNotifyOnBlur,j=i.onKeyDown,L=i.onBlur,B=i.inputRef,$=_objectWithoutProperties(i,w),V=this.state.value;s=x?{onKeyDown:this.onKeyDown}:j?{onKeyDown:j}:{},o=C?{onBlur:this.onBlur}:L?{onBlur:L}:{};var U=B?{ref:B}:{};return u.default.createElement(_,_objectSpread(_objectSpread(_objectSpread(_objectSpread({},$),{},{onChange:this.onChange,value:V},s),o),U))}}]),DebounceInput}(u.default.PureComponent);o.DebounceInput=x,_defineProperty(x,"defaultProps",{element:"input",type:"text",onKeyDown:void 0,onBlur:void 0,value:void 0,minLength:0,debounceTimeout:100,forceNotifyByEnter:!0,forceNotifyOnBlur:!0,inputRef:void 0})},24677:(s,o,i)=>{"use strict";var u=i(81214).DebounceInput;u.DebounceInput=u,s.exports=u},22551:(s,o,i)=>{"use strict";var u=i(96540),_=i(69982);function p(s){for(var o="https://reactjs.org/docs/error-decoder.html?invariant="+s,i=1;i
: \" + paramEnum.map(function(item) {\n return item\n }).toArray().map(String).join(\", \")}/>\n : null\n }\n\n { (bodyParam || !isExecute) && paramDefaultValue !== undefined ?\n Default value : \" + paramDefaultValue}/>\n : null\n }\n\n { (bodyParam || !isExecute) && paramExample !== undefined ?\n Example : \" + paramExample}/>\n : null\n }\n\n {(isFormData && !isFormDataSupported) &&
Error: your browser does not support FormData
}\n\n {\n isOAS3 && param.get(\"examples\") ? (\n
\n \n
\n ) : null\n }\n\n { bodyParam ? null\n : \n }\n\n\n {\n bodyParam && schema ? \n : null\n }\n\n {\n !bodyParam && isExecute && param.get(\"allowEmptyValue\") ?\n \n : null\n }\n\n {\n isOAS3 && param.get(\"examples\") ? (\n \n ) : null\n }\n\n { !showCommonExtensions || !commonExt.size ? null : commonExt.entrySeq().map(([key, v]) => )}\n { !showExtensions || !extensions.size ? null : extensions.entrySeq().map(([key, v]) => )}\n\n \n\n \n )\n\n }\n\n}\n","import React, { Component } from \"react\"\nimport PropTypes from \"prop-types\"\n\nexport default class Execute extends Component {\n\n static propTypes = {\n specSelectors: PropTypes.object.isRequired,\n specActions: PropTypes.object.isRequired,\n operation: PropTypes.object.isRequired,\n path: PropTypes.string.isRequired,\n method: PropTypes.string.isRequired,\n oas3Selectors: PropTypes.object.isRequired,\n oas3Actions: PropTypes.object.isRequired,\n onExecute: PropTypes.func,\n disabled: PropTypes.bool\n }\n\n handleValidateParameters = () => {\n let { specSelectors, specActions, path, method } = this.props\n specActions.validateParams([path, method])\n return specSelectors.validateBeforeExecute([path, method])\n }\n\n handleValidateRequestBody = () => {\n let { path, method, specSelectors, oas3Selectors, oas3Actions } = this.props\n let validationErrors = {\n missingBodyValue: false,\n missingRequiredKeys: []\n }\n // context: reset errors, then (re)validate\n oas3Actions.clearRequestBodyValidateError({ path, method })\n let oas3RequiredRequestBodyContentType = specSelectors.getOAS3RequiredRequestBodyContentType([path, method])\n let oas3RequestBodyValue = oas3Selectors.requestBodyValue(path, method)\n let oas3ValidateBeforeExecuteSuccess = oas3Selectors.validateBeforeExecute([path, method])\n let oas3RequestContentType = oas3Selectors.requestContentType(path, method)\n\n if (!oas3ValidateBeforeExecuteSuccess) {\n validationErrors.missingBodyValue = true\n oas3Actions.setRequestBodyValidateError({ path, method, validationErrors })\n return false\n }\n if (!oas3RequiredRequestBodyContentType) {\n return true\n }\n let missingRequiredKeys = oas3Selectors.validateShallowRequired({\n oas3RequiredRequestBodyContentType,\n oas3RequestContentType,\n oas3RequestBodyValue\n })\n if (!missingRequiredKeys || missingRequiredKeys.length < 1) {\n return true\n }\n missingRequiredKeys.forEach((missingKey) => {\n validationErrors.missingRequiredKeys.push(missingKey)\n })\n oas3Actions.setRequestBodyValidateError({ path, method, validationErrors })\n return false\n }\n\n handleValidationResultPass = () => {\n let { specActions, operation, path, method } = this.props\n if (this.props.onExecute) {\n // loading spinner\n this.props.onExecute()\n }\n specActions.execute({ operation, path, method })\n }\n\n handleValidationResultFail = () => {\n let { specActions, path, method } = this.props\n // deferred by 40ms, to give element class change time to settle.\n specActions.clearValidateParams([path, method])\n setTimeout(() => {\n specActions.validateParams([path, method])\n }, 40)\n }\n\n handleValidationResult = (isPass) => {\n if (isPass) {\n this.handleValidationResultPass()\n } else {\n this.handleValidationResultFail()\n }\n }\n\n onClick = () => {\n let paramsResult = this.handleValidateParameters()\n let requestBodyResult = this.handleValidateRequestBody()\n let isPass = paramsResult && requestBodyResult\n this.handleValidationResult(isPass)\n }\n\n onChangeProducesWrapper = ( val ) => this.props.specActions.changeProducesValue([this.props.path, this.props.method], val)\n\n render(){\n const { disabled } = this.props\n return (\n \n )\n }\n}\n","import React from \"react\"\nimport PropTypes from \"prop-types\"\nimport Im from \"immutable\"\n\nconst propClass = \"header-example\"\n\nexport default class Headers extends React.Component {\n static propTypes = {\n headers: PropTypes.object.isRequired,\n getComponent: PropTypes.func.isRequired\n }\n\n render() {\n let { headers, getComponent } = this.props\n\n const Property = getComponent(\"Property\")\n const Markdown = getComponent(\"Markdown\", true)\n\n if ( !headers || !headers.size )\n return null\n\n return (\n
\n

Headers:

\n \n \n \n \n \n \n \n \n \n {\n headers.entrySeq().map( ([ key, header ]) => {\n if(!Im.Map.isMap(header)) {\n return null\n }\n\n const description = header.get(\"description\")\n const type = header.getIn([\"schema\"]) ? header.getIn([\"schema\", \"type\"]) : header.getIn([\"type\"])\n const schemaExample = header.getIn([\"schema\", \"example\"])\n\n return (\n \n \n \n )\n }).toArray()\n }\n \n
NameDescriptionType
{ key }{\n !description ? null : \n }{ type } { schemaExample ? : null }
\n
\n )\n }\n}\n","import React from \"react\"\nimport PropTypes from \"prop-types\"\nimport { List } from \"immutable\"\n\nexport default class Errors extends React.Component {\n\n static propTypes = {\n editorActions: PropTypes.object,\n errSelectors: PropTypes.object.isRequired,\n layoutSelectors: PropTypes.object.isRequired,\n layoutActions: PropTypes.object.isRequired,\n getComponent: PropTypes.func.isRequired,\n }\n\n render() {\n let { editorActions, errSelectors, layoutSelectors, layoutActions, getComponent } = this.props\n\n const Collapse = getComponent(\"Collapse\")\n\n if(editorActions && editorActions.jumpToLine) {\n var jumpToLine = editorActions.jumpToLine\n }\n\n let errors = errSelectors.allErrors()\n\n // all thrown errors, plus error-level everything else\n let allErrorsToDisplay = errors.filter(err => err.get(\"type\") === \"thrown\" ? true :err.get(\"level\") === \"error\")\n\n if(!allErrorsToDisplay || allErrorsToDisplay.count() < 1) {\n return null\n }\n\n let isVisible = layoutSelectors.isShown([\"errorPane\"], true)\n let toggleVisibility = () => layoutActions.show([\"errorPane\"], !isVisible)\n\n let sortedJSErrors = allErrorsToDisplay.sortBy(err => err.get(\"line\"))\n\n return (\n
\n        
\n

Errors

\n \n
\n \n
\n { sortedJSErrors.map((err, i) => {\n let type = err.get(\"type\")\n if(type === \"thrown\" || type === \"auth\") {\n return \n }\n if(type === \"spec\") {\n return \n }\n }) }\n
\n
\n
\n )\n }\n}\n\nconst ThrownErrorItem = ( { error, jumpToLine } ) => {\n if(!error) {\n return null\n }\n let errorLine = error.get(\"line\")\n\n return (\n
\n { !error ? null :\n
\n

{ (error.get(\"source\") && error.get(\"level\")) ?\n toTitleCase(error.get(\"source\")) + \" \" + error.get(\"level\") : \"\" }\n { error.get(\"path\") ? at {error.get(\"path\")}: null }

\n \n { error.get(\"message\") }\n \n
\n { errorLine && jumpToLine ? Jump to line { errorLine } : null }\n
\n
\n }\n
\n )\n }\n\nconst SpecErrorItem = ( { error, jumpToLine = null } ) => {\n let locationMessage = null\n\n if(error.get(\"path\")) {\n if(List.isList(error.get(\"path\"))) {\n locationMessage = at { error.get(\"path\").join(\".\") }\n } else {\n locationMessage = at { error.get(\"path\") }\n }\n } else if(error.get(\"line\") && !jumpToLine) {\n locationMessage = on line { error.get(\"line\") }\n }\n\n return (\n
\n { !error ? null :\n
\n

{ toTitleCase(error.get(\"source\")) + \" \" + error.get(\"level\") } { locationMessage }

\n { error.get(\"message\") }\n
\n { jumpToLine ? (\n Jump to line { error.get(\"line\") }\n ) : null }\n
\n
\n }\n
\n )\n }\n\nfunction toTitleCase(str) {\n return (str || \"\")\n .split(\" \")\n .map(substr => substr[0].toUpperCase() + substr.slice(1))\n .join(\" \")\n}\n\nThrownErrorItem.propTypes = {\n error: PropTypes.object.isRequired,\n jumpToLine: PropTypes.func\n}\n\nSpecErrorItem.propTypes = {\n error: PropTypes.object.isRequired,\n jumpToLine: PropTypes.func\n}\n","import React from \"react\"\nimport PropTypes from \"prop-types\"\nimport ImPropTypes from \"react-immutable-proptypes\"\nimport { fromJS } from \"immutable\"\n\nconst noop = ()=>{}\n\nexport default class ContentType extends React.Component {\n\n static propTypes = {\n ariaControls: PropTypes.string,\n contentTypes: PropTypes.oneOfType([ImPropTypes.list, ImPropTypes.set, ImPropTypes.seq]),\n controlId: PropTypes.string,\n value: PropTypes.string,\n onChange: PropTypes.func,\n className: PropTypes.string,\n ariaLabel: PropTypes.string\n }\n\n static defaultProps = {\n onChange: noop,\n value: null,\n contentTypes: fromJS([\"application/json\"]),\n }\n\n componentDidMount() {\n // Needed to populate the form, initially\n if(this.props.contentTypes) {\n this.props.onChange(this.props.contentTypes.first())\n }\n }\n\n UNSAFE_componentWillReceiveProps(nextProps) {\n if(!nextProps.contentTypes || !nextProps.contentTypes.size) {\n return\n }\n\n if(!nextProps.contentTypes.includes(nextProps.value)) {\n nextProps.onChange(nextProps.contentTypes.first())\n }\n }\n\n onChangeWrapper = e => this.props.onChange(e.target.value)\n\n render() {\n let { ariaControls, ariaLabel, className, contentTypes, controlId, value } = this.props\n\n if ( !contentTypes || !contentTypes.size )\n return null\n\n return (\n
\n \n
\n )\n }\n}\n","import React from \"react\"\nimport PropTypes from \"prop-types\"\n\nfunction xclass(...args) {\n return args.filter(a => !!a).join(\" \").trim()\n}\n\nexport class Container extends React.Component {\n render() {\n let { fullscreen, full, ...rest } = this.props\n // Normal element\n\n if(fullscreen)\n return
\n\n let containerClass = \"swagger-container\" + (full ? \"-full\" : \"\")\n return (\n
\n )\n }\n}\n\nContainer.propTypes = {\n fullscreen: PropTypes.bool,\n full: PropTypes.bool,\n className: PropTypes.string\n}\n\nconst DEVICES = {\n \"mobile\": \"\",\n \"tablet\": \"-tablet\",\n \"desktop\": \"-desktop\",\n \"large\": \"-hd\"\n}\n\nexport class Col extends React.Component {\n\n render() {\n const {\n hide,\n keepContents,\n /* we don't want these in the `rest` object that passes to the final component,\n since React now complains. So we extract them */\n /* eslint-disable no-unused-vars */\n mobile,\n tablet,\n desktop,\n large,\n /* eslint-enable no-unused-vars */\n ...rest\n } = this.props\n\n if(hide && !keepContents)\n return \n\n let classesAr = []\n\n for (let device in DEVICES) {\n if (!Object.prototype.hasOwnProperty.call(DEVICES, device)) {\n continue\n }\n let deviceClass = DEVICES[device]\n if(device in this.props) {\n let val = this.props[device]\n\n if(val < 1) {\n classesAr.push(\"none\" + deviceClass)\n continue\n }\n\n classesAr.push(\"block\" + deviceClass)\n classesAr.push(\"col-\" + val + deviceClass)\n }\n }\n\n if (hide) {\n classesAr.push(\"hidden\")\n }\n\n let classes = xclass(rest.className, ...classesAr)\n\n return (\n
\n )\n }\n\n}\n\nCol.propTypes = {\n hide: PropTypes.bool,\n keepContents: PropTypes.bool,\n mobile: PropTypes.number,\n tablet: PropTypes.number,\n desktop: PropTypes.number,\n large: PropTypes.number,\n className: PropTypes.string\n}\n\nexport class Row extends React.Component {\n\n render() {\n return
\n }\n\n}\n\nRow.propTypes = {\n className: PropTypes.string\n}\n\nexport class Button extends React.Component {\n\n static propTypes = {\n className: PropTypes.string\n }\n\n static defaultProps = {\n className: \"\"\n }\n\n render() {\n return